(data stored in ACNUC7421 zone)

EMBL: AE006641

ID   AE006641; SV 1; circular; genomic DNA; STD; PRO; 2992245 BP.
XX
AC   AE006641; AE006642-AE006913;
XX
PR   Project:PRJNA108;
XX
DT   26-NOV-2002 (Rel. 73, Created)
DT   23-AUG-2017 (Rel. 133, Last updated, Version 9)
XX
DE   Sulfolobus solfataricus P2, complete genome.
XX
KW   .
XX
OS   Saccharolobus solfataricus P2
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Saccharolobus.
XX
RN   [1]
RP   1-2992245
RA   She Q., Singh R.K., Confalonieri F., Zivanovic Y., Allard G., Awayez M.J.,
RA   Chan-Weiher C.C.-Y., Clausen I.G., Curtis B.A., De Moors A., Erauso G.,
RA   Fletcher C., Gordon P.M.K., Heikamp-de Jong I., Jeffries A.C., Kozera C.J.,
RA   Medina N., Peng X., Thi-Ngoc H.P., Redder P., Schenk M.E., Theriault C.,
RA   Tolstrup N., Charlebois R.L., Doolittle W.F., Duguet M., Gaasterland T.,
RA   Garrett R.A., Ragan M.A., Sensen C.W., Van der Oost J.;
RT   ;
RL   Submitted (24-APR-2001) to the INSDC.
RL   Europe/Canada joint project: Copenhagen University, Denmark; Universite
RL   Paris-Sud, France; Wageningen University, The Netherlands; Institute for
RL   Marine Biosciences & University of Ottawa, Canada
XX
DR   MD5; acc4fa97ce7b67731db49d1e4b3232d2.
DR   BioSample; SAMN02603227.
DR   EnsemblGenomes-Gn; EBG00001176132.
DR   EnsemblGenomes-Gn; EBG00001176133.
DR   EnsemblGenomes-Gn; EBG00001176135.
DR   EnsemblGenomes-Gn; EBG00001176138.
DR   EnsemblGenomes-Gn; EBG00001176140.
DR   EnsemblGenomes-Gn; EBG00001176143.
DR   EnsemblGenomes-Gn; EBG00001176146.
DR   EnsemblGenomes-Gn; EBG00001176148.
DR   EnsemblGenomes-Gn; EBG00001176149.
DR   EnsemblGenomes-Gn; EBG00001176152.
DR   EnsemblGenomes-Gn; EBG00001176154.
DR   EnsemblGenomes-Gn; EBG00001176156.
DR   EnsemblGenomes-Gn; EBG00001176159.
DR   EnsemblGenomes-Gn; EBG00001176161.
DR   EnsemblGenomes-Gn; EBG00001176164.
DR   EnsemblGenomes-Gn; EBG00001176167.
DR   EnsemblGenomes-Gn; EBG00001176169.
DR   EnsemblGenomes-Gn; EBG00001176171.
DR   EnsemblGenomes-Gn; EBG00001176174.
DR   EnsemblGenomes-Gn; EBG00001176176.
DR   EnsemblGenomes-Gn; EBG00001176177.
DR   EnsemblGenomes-Gn; EBG00001176179.
DR   EnsemblGenomes-Gn; EBG00001176181.
DR   EnsemblGenomes-Gn; EBG00001176197.
DR   EnsemblGenomes-Gn; EBG00001176198.
DR   EnsemblGenomes-Gn; EBG00001176199.
DR   EnsemblGenomes-Gn; EBG00001176200.
DR   EnsemblGenomes-Gn; EBG00001176201.
DR   EnsemblGenomes-Gn; EBG00001176202.
DR   EnsemblGenomes-Gn; EBG00001176203.
DR   EnsemblGenomes-Gn; EBG00001176204.
DR   EnsemblGenomes-Gn; EBG00001176205.
DR   EnsemblGenomes-Gn; EBG00001176206.
DR   EnsemblGenomes-Gn; EBG00001176207.
DR   EnsemblGenomes-Gn; EBG00001176208.
DR   EnsemblGenomes-Gn; EBG00001176209.
DR   EnsemblGenomes-Gn; EBG00001176210.
DR   EnsemblGenomes-Gn; EBG00001176211.
DR   EnsemblGenomes-Gn; EBG00001176212.
DR   EnsemblGenomes-Gn; EBG00001176213.
DR   EnsemblGenomes-Gn; EBG00001176214.
DR   EnsemblGenomes-Gn; EBG00001176215.
DR   EnsemblGenomes-Gn; EBG00001176216.
DR   EnsemblGenomes-Gn; EBG00001176217.
DR   EnsemblGenomes-Gn; EBG00001176218.
DR   EnsemblGenomes-Gn; EBG00001176219.
DR   EnsemblGenomes-Gn; EBG00001176220.
DR   EnsemblGenomes-Gn; EBG00001176221.
DR   EnsemblGenomes-Gn; EBG00001176222.
DR   EnsemblGenomes-Gn; EBG00001176223.
DR   EnsemblGenomes-Gn; EBG00001176224.
DR   EnsemblGenomes-Gn; EBG00001176225.
DR   EnsemblGenomes-Gn; EBG00001176226.
DR   EnsemblGenomes-Gn; EBG00001176227.
DR   EnsemblGenomes-Gn; EBG00001176228.
DR   EnsemblGenomes-Gn; EBG00001176229.
DR   EnsemblGenomes-Gn; EBG00001176230.
DR   EnsemblGenomes-Gn; EBG00001176231.
DR   EnsemblGenomes-Gn; EBG00001176232.
DR   EnsemblGenomes-Gn; EBG00001176233.
DR   EnsemblGenomes-Gn; EBG00001176234.
DR   EnsemblGenomes-Gn; EBG00001176235.
DR   EnsemblGenomes-Gn; EBG00001176236.
DR   EnsemblGenomes-Gn; EBG00001176237.
DR   EnsemblGenomes-Gn; EBG00001176238.
DR   EnsemblGenomes-Gn; EBG00001176239.
DR   EnsemblGenomes-Gn; EBG00001176240.
DR   EnsemblGenomes-Gn; EBG00001176241.
DR   EnsemblGenomes-Gn; EBG00001176242.
DR   EnsemblGenomes-Gn; EBG00001176243.
DR   EnsemblGenomes-Gn; EBG00001176244.
DR   EnsemblGenomes-Gn; EBG00001176245.
DR   EnsemblGenomes-Gn; EBG00001176246.
DR   EnsemblGenomes-Gn; EBG00001176247.
DR   EnsemblGenomes-Gn; EBG00001176248.
DR   EnsemblGenomes-Gn; EBG00001176249.
DR   EnsemblGenomes-Gn; EBG00001176250.
DR   EnsemblGenomes-Gn; EBG00001176251.
DR   EnsemblGenomes-Gn; EBG00001176252.
DR   EnsemblGenomes-Gn; EBG00001176253.
DR   EnsemblGenomes-Gn; EBG00001176254.
DR   EnsemblGenomes-Gn; EBG00001176255.
DR   EnsemblGenomes-Gn; EBG00001176256.
DR   EnsemblGenomes-Gn; EBG00001176257.
DR   EnsemblGenomes-Gn; EBG00001176258.
DR   EnsemblGenomes-Gn; EBG00001176259.
DR   EnsemblGenomes-Gn; EBG00001176260.
DR   EnsemblGenomes-Gn; EBG00001176261.
DR   EnsemblGenomes-Gn; EBG00001176262.
DR   EnsemblGenomes-Gn; EBG00001176263.
DR   EnsemblGenomes-Gn; EBG00001176264.
DR   EnsemblGenomes-Gn; EBG00001176265.
DR   EnsemblGenomes-Gn; EBG00001176266.
DR   EnsemblGenomes-Gn; EBG00001176267.
DR   EnsemblGenomes-Gn; EBG00001176268.
DR   EnsemblGenomes-Gn; EBG00001176269.
DR   EnsemblGenomes-Gn; EBG00001176270.
DR   EnsemblGenomes-Gn; EBG00001176271.
DR   EnsemblGenomes-Gn; EBG00001176272.
DR   EnsemblGenomes-Gn; EBG00001176273.
DR   EnsemblGenomes-Gn; EBG00001176274.
DR   EnsemblGenomes-Gn; EBG00001176275.
DR   EnsemblGenomes-Gn; EBG00001176276.
DR   EnsemblGenomes-Gn; EBG00001176277.
DR   EnsemblGenomes-Gn; EBG00001176278.
DR   EnsemblGenomes-Gn; EBG00001176279.
DR   EnsemblGenomes-Gn; EBG00001176280.
DR   EnsemblGenomes-Gn; EBG00001176281.
DR   EnsemblGenomes-Gn; EBG00001176282.
DR   EnsemblGenomes-Gn; EBG00001176283.
DR   EnsemblGenomes-Gn; EBG00001176284.
DR   EnsemblGenomes-Gn; EBG00001176285.
DR   EnsemblGenomes-Gn; EBG00001176286.
DR   EnsemblGenomes-Gn; EBG00001176287.
DR   EnsemblGenomes-Gn; EBG00001176288.
DR   EnsemblGenomes-Gn; EBG00001176289.
DR   EnsemblGenomes-Gn; EBG00001176290.
DR   EnsemblGenomes-Gn; EBG00001176291.
DR   EnsemblGenomes-Gn; EBG00001176292.
DR   EnsemblGenomes-Gn; EBG00001176293.
DR   EnsemblGenomes-Gn; EBG00001176294.
DR   EnsemblGenomes-Gn; EBG00001176295.
DR   EnsemblGenomes-Gn; EBG00001176296.
DR   EnsemblGenomes-Gn; EBG00001176297.
DR   EnsemblGenomes-Gn; EBG00001176298.
DR   EnsemblGenomes-Gn; EBG00001176299.
DR   EnsemblGenomes-Gn; EBG00001176300.
DR   EnsemblGenomes-Gn; EBG00001176301.
DR   EnsemblGenomes-Gn; EBG00001176302.
DR   EnsemblGenomes-Gn; EBG00001176303.
DR   EnsemblGenomes-Gn; EBG00001176304.
DR   EnsemblGenomes-Gn; EBG00001176305.
DR   EnsemblGenomes-Gn; EBG00001176306.
DR   EnsemblGenomes-Gn; EBG00001176307.
DR   EnsemblGenomes-Gn; EBG00001176308.
DR   EnsemblGenomes-Gn; EBG00001176309.
DR   EnsemblGenomes-Gn; EBG00001176310.
DR   EnsemblGenomes-Gn; EBG00001176311.
DR   EnsemblGenomes-Gn; EBG00001176312.
DR   EnsemblGenomes-Gn; EBG00001176313.
DR   EnsemblGenomes-Gn; EBG00001176314.
DR   EnsemblGenomes-Gn; EBG00001176315.
DR   EnsemblGenomes-Gn; EBG00001176316.
DR   EnsemblGenomes-Gn; EBG00001176317.
DR   EnsemblGenomes-Gn; EBG00001176318.
DR   EnsemblGenomes-Gn; EBG00001176319.
DR   EnsemblGenomes-Gn; EBG00001176320.
DR   EnsemblGenomes-Gn; EBG00001176321.
DR   EnsemblGenomes-Gn; EBG00001176322.
DR   EnsemblGenomes-Gn; EBG00001176323.
DR   EnsemblGenomes-Gn; EBG00001176324.
DR   EnsemblGenomes-Gn; EBG00001176325.
DR   EnsemblGenomes-Gn; EBG00001176326.
DR   EnsemblGenomes-Gn; EBG00001176327.
DR   EnsemblGenomes-Gn; EBG00001176328.
DR   EnsemblGenomes-Gn; EBG00001176329.
DR   EnsemblGenomes-Gn; EBG00001176330.
DR   EnsemblGenomes-Gn; EBG00001176331.
DR   EnsemblGenomes-Gn; EBG00001176332.
DR   EnsemblGenomes-Gn; EBG00001176333.
DR   EnsemblGenomes-Gn; EBG00001176334.
DR   EnsemblGenomes-Gn; EBG00001176335.
DR   EnsemblGenomes-Gn; EBG00001176336.
DR   EnsemblGenomes-Gn; EBG00001176337.
DR   EnsemblGenomes-Gn; EBG00001176338.
DR   EnsemblGenomes-Gn; EBG00001176339.
DR   EnsemblGenomes-Gn; EBG00001176340.
DR   EnsemblGenomes-Gn; EBG00001176341.
DR   EnsemblGenomes-Gn; EBG00001176342.
DR   EnsemblGenomes-Gn; EBG00001176343.
DR   EnsemblGenomes-Gn; EBG00001176344.
DR   EnsemblGenomes-Gn; EBG00001176345.
DR   EnsemblGenomes-Gn; EBG00001176346.
DR   EnsemblGenomes-Gn; EBG00001176347.
DR   EnsemblGenomes-Gn; EBG00001176349.
DR   EnsemblGenomes-Gn; EBG00001176350.
DR   EnsemblGenomes-Gn; EBG00001176351.
DR   EnsemblGenomes-Gn; EBG00001176352.
DR   EnsemblGenomes-Gn; EBG00001176353.
DR   EnsemblGenomes-Gn; EBG00001176354.
DR   EnsemblGenomes-Gn; EBG00001176355.
DR   EnsemblGenomes-Gn; EBG00001176356.
DR   EnsemblGenomes-Gn; EBG00001176357.
DR   EnsemblGenomes-Gn; EBG00001176358.
DR   EnsemblGenomes-Gn; EBG00001176359.
DR   EnsemblGenomes-Gn; EBG00001176360.
DR   EnsemblGenomes-Gn; EBG00001176361.
DR   EnsemblGenomes-Gn; EBG00001176362.
DR   EnsemblGenomes-Gn; EBG00001176363.
DR   EnsemblGenomes-Gn; EBG00001176364.
DR   EnsemblGenomes-Gn; EBG00001176365.
DR   EnsemblGenomes-Gn; EBG00001176366.
DR   EnsemblGenomes-Gn; EBG00001176367.
DR   EnsemblGenomes-Gn; EBG00001176368.
DR   EnsemblGenomes-Gn; EBG00001176369.
DR   EnsemblGenomes-Gn; EBG00001176370.
DR   EnsemblGenomes-Gn; EBG00001176371.
DR   EnsemblGenomes-Gn; EBG00001176372.
DR   EnsemblGenomes-Gn; EBG00001176373.
DR   EnsemblGenomes-Gn; EBG00001176374.
DR   EnsemblGenomes-Gn; EBG00001176375.
DR   EnsemblGenomes-Gn; EBG00001176376.
DR   EnsemblGenomes-Gn; EBG00001176377.
DR   EnsemblGenomes-Gn; EBG00001176378.
DR   EnsemblGenomes-Gn; EBG00001176379.
DR   EnsemblGenomes-Gn; EBG00001176380.
DR   EnsemblGenomes-Gn; EBG00001176381.
DR   EnsemblGenomes-Gn; EBG00001176382.
DR   EnsemblGenomes-Gn; EBG00001176383.
DR   EnsemblGenomes-Gn; EBG00001176384.
DR   EnsemblGenomes-Gn; EBG00001176385.
DR   EnsemblGenomes-Gn; EBG00001176386.
DR   EnsemblGenomes-Gn; EBG00001176387.
DR   EnsemblGenomes-Gn; EBG00001176388.
DR   EnsemblGenomes-Gn; EBG00001176389.
DR   EnsemblGenomes-Gn; SSOr01.
DR   EnsemblGenomes-Gn; SSOr02.
DR   EnsemblGenomes-Gn; SSOr03.
DR   EnsemblGenomes-Gn; SSOr04.
DR   EnsemblGenomes-Gn; SSOs01.
DR   EnsemblGenomes-Gn; SSOs02.
DR   EnsemblGenomes-Gn; SSOs03.
DR   EnsemblGenomes-Gn; SSOs04.
DR   EnsemblGenomes-Gn; SSOs05.
DR   EnsemblGenomes-Gn; SSOs06.
DR   EnsemblGenomes-Gn; SSOt01.
DR   EnsemblGenomes-Gn; SSOt02.
DR   EnsemblGenomes-Gn; SSOt03.
DR   EnsemblGenomes-Gn; SSOt04.
DR   EnsemblGenomes-Gn; SSOt05.
DR   EnsemblGenomes-Gn; SSOt06.
DR   EnsemblGenomes-Gn; SSOt07.
DR   EnsemblGenomes-Gn; SSOt08.
DR   EnsemblGenomes-Gn; SSOt09.
DR   EnsemblGenomes-Gn; SSOt10.
DR   EnsemblGenomes-Gn; SSOt11.
DR   EnsemblGenomes-Gn; SSOt12.
DR   EnsemblGenomes-Gn; SSOt13.
DR   EnsemblGenomes-Gn; SSOt14.
DR   EnsemblGenomes-Gn; SSOt15.
DR   EnsemblGenomes-Gn; SSOt16.
DR   EnsemblGenomes-Gn; SSOt17.
DR   EnsemblGenomes-Gn; SSOt18.
DR   EnsemblGenomes-Gn; SSOt19.
DR   EnsemblGenomes-Gn; SSOt20.
DR   EnsemblGenomes-Gn; SSOt21.
DR   EnsemblGenomes-Gn; SSOt22.
DR   EnsemblGenomes-Gn; SSOt23.
DR   EnsemblGenomes-Gn; SSOt24.
DR   EnsemblGenomes-Gn; SSOt25.
DR   EnsemblGenomes-Gn; SSOt26.
DR   EnsemblGenomes-Gn; SSOt27.
DR   EnsemblGenomes-Gn; SSOt28.
DR   EnsemblGenomes-Gn; SSOt29.
DR   EnsemblGenomes-Gn; SSOt30.
DR   EnsemblGenomes-Gn; SSOt31.
DR   EnsemblGenomes-Gn; SSOt32.
DR   EnsemblGenomes-Gn; SSOt33.
DR   EnsemblGenomes-Gn; SSOt34.
DR   EnsemblGenomes-Gn; SSOt35.
DR   EnsemblGenomes-Gn; SSOt36.
DR   EnsemblGenomes-Gn; SSOt37.
DR   EnsemblGenomes-Gn; SSOt38.
DR   EnsemblGenomes-Gn; SSOt39.
DR   EnsemblGenomes-Gn; SSOt40.
DR   EnsemblGenomes-Gn; SSOt41.
DR   EnsemblGenomes-Gn; SSOt42.
DR   EnsemblGenomes-Gn; SSOt43.
DR   EnsemblGenomes-Gn; SSOt44.
DR   EnsemblGenomes-Gn; SSOt45.
DR   EnsemblGenomes-Gn; SSOt46.
DR   EnsemblGenomes-Tr; EBT00001754092.
DR   EnsemblGenomes-Tr; EBT00001754093.
DR   EnsemblGenomes-Tr; EBT00001754094.
DR   EnsemblGenomes-Tr; EBT00001754095.
DR   EnsemblGenomes-Tr; EBT00001754096.
DR   EnsemblGenomes-Tr; EBT00001754097.
DR   EnsemblGenomes-Tr; EBT00001754098.
DR   EnsemblGenomes-Tr; EBT00001754099.
DR   EnsemblGenomes-Tr; EBT00001754100.
DR   EnsemblGenomes-Tr; EBT00001754101.
DR   EnsemblGenomes-Tr; EBT00001754102.
DR   EnsemblGenomes-Tr; EBT00001754103.
DR   EnsemblGenomes-Tr; EBT00001754104.
DR   EnsemblGenomes-Tr; EBT00001754105.
DR   EnsemblGenomes-Tr; EBT00001754106.
DR   EnsemblGenomes-Tr; EBT00001754107.
DR   EnsemblGenomes-Tr; EBT00001754108.
DR   EnsemblGenomes-Tr; EBT00001754109.
DR   EnsemblGenomes-Tr; EBT00001754110.
DR   EnsemblGenomes-Tr; EBT00001754111.
DR   EnsemblGenomes-Tr; EBT00001754112.
DR   EnsemblGenomes-Tr; EBT00001754113.
DR   EnsemblGenomes-Tr; EBT00001754114.
DR   EnsemblGenomes-Tr; EBT00001754115.
DR   EnsemblGenomes-Tr; EBT00001754116.
DR   EnsemblGenomes-Tr; EBT00001754117.
DR   EnsemblGenomes-Tr; EBT00001754118.
DR   EnsemblGenomes-Tr; EBT00001754119.
DR   EnsemblGenomes-Tr; EBT00001754120.
DR   EnsemblGenomes-Tr; EBT00001754121.
DR   EnsemblGenomes-Tr; EBT00001754122.
DR   EnsemblGenomes-Tr; EBT00001754123.
DR   EnsemblGenomes-Tr; EBT00001754124.
DR   EnsemblGenomes-Tr; EBT00001754125.
DR   EnsemblGenomes-Tr; EBT00001754126.
DR   EnsemblGenomes-Tr; EBT00001754127.
DR   EnsemblGenomes-Tr; EBT00001754128.
DR   EnsemblGenomes-Tr; EBT00001754129.
DR   EnsemblGenomes-Tr; EBT00001754130.
DR   EnsemblGenomes-Tr; EBT00001754131.
DR   EnsemblGenomes-Tr; EBT00001754132.
DR   EnsemblGenomes-Tr; EBT00001754133.
DR   EnsemblGenomes-Tr; EBT00001754134.
DR   EnsemblGenomes-Tr; EBT00001754135.
DR   EnsemblGenomes-Tr; EBT00001754136.
DR   EnsemblGenomes-Tr; EBT00001754137.
DR   EnsemblGenomes-Tr; EBT00001754138.
DR   EnsemblGenomes-Tr; EBT00001754139.
DR   EnsemblGenomes-Tr; EBT00001754140.
DR   EnsemblGenomes-Tr; EBT00001754141.
DR   EnsemblGenomes-Tr; EBT00001754142.
DR   EnsemblGenomes-Tr; EBT00001754143.
DR   EnsemblGenomes-Tr; EBT00001754144.
DR   EnsemblGenomes-Tr; EBT00001754145.
DR   EnsemblGenomes-Tr; EBT00001754146.
DR   EnsemblGenomes-Tr; EBT00001754147.
DR   EnsemblGenomes-Tr; EBT00001754148.
DR   EnsemblGenomes-Tr; EBT00001754149.
DR   EnsemblGenomes-Tr; EBT00001754150.
DR   EnsemblGenomes-Tr; EBT00001754151.
DR   EnsemblGenomes-Tr; EBT00001754152.
DR   EnsemblGenomes-Tr; EBT00001754153.
DR   EnsemblGenomes-Tr; EBT00001754154.
DR   EnsemblGenomes-Tr; EBT00001754155.
DR   EnsemblGenomes-Tr; EBT00001754156.
DR   EnsemblGenomes-Tr; EBT00001754157.
DR   EnsemblGenomes-Tr; EBT00001754158.
DR   EnsemblGenomes-Tr; EBT00001754159.
DR   EnsemblGenomes-Tr; EBT00001754160.
DR   EnsemblGenomes-Tr; EBT00001754161.
DR   EnsemblGenomes-Tr; EBT00001754162.
DR   EnsemblGenomes-Tr; EBT00001754163.
DR   EnsemblGenomes-Tr; EBT00001754164.
DR   EnsemblGenomes-Tr; EBT00001754165.
DR   EnsemblGenomes-Tr; EBT00001754166.
DR   EnsemblGenomes-Tr; EBT00001754167.
DR   EnsemblGenomes-Tr; EBT00001754168.
DR   EnsemblGenomes-Tr; EBT00001754169.
DR   EnsemblGenomes-Tr; EBT00001754170.
DR   EnsemblGenomes-Tr; EBT00001754171.
DR   EnsemblGenomes-Tr; EBT00001754172.
DR   EnsemblGenomes-Tr; EBT00001754173.
DR   EnsemblGenomes-Tr; EBT00001754174.
DR   EnsemblGenomes-Tr; EBT00001754175.
DR   EnsemblGenomes-Tr; EBT00001754176.
DR   EnsemblGenomes-Tr; EBT00001754177.
DR   EnsemblGenomes-Tr; EBT00001754178.
DR   EnsemblGenomes-Tr; EBT00001754179.
DR   EnsemblGenomes-Tr; EBT00001754180.
DR   EnsemblGenomes-Tr; EBT00001754181.
DR   EnsemblGenomes-Tr; EBT00001754182.
DR   EnsemblGenomes-Tr; EBT00001754183.
DR   EnsemblGenomes-Tr; EBT00001754184.
DR   EnsemblGenomes-Tr; EBT00001754185.
DR   EnsemblGenomes-Tr; EBT00001754186.
DR   EnsemblGenomes-Tr; EBT00001754187.
DR   EnsemblGenomes-Tr; EBT00001754188.
DR   EnsemblGenomes-Tr; EBT00001754189.
DR   EnsemblGenomes-Tr; EBT00001754190.
DR   EnsemblGenomes-Tr; EBT00001754191.
DR   EnsemblGenomes-Tr; EBT00001754192.
DR   EnsemblGenomes-Tr; EBT00001754193.
DR   EnsemblGenomes-Tr; EBT00001754194.
DR   EnsemblGenomes-Tr; EBT00001754195.
DR   EnsemblGenomes-Tr; EBT00001754196.
DR   EnsemblGenomes-Tr; EBT00001754197.
DR   EnsemblGenomes-Tr; EBT00001754198.
DR   EnsemblGenomes-Tr; EBT00001754199.
DR   EnsemblGenomes-Tr; EBT00001754200.
DR   EnsemblGenomes-Tr; EBT00001754201.
DR   EnsemblGenomes-Tr; EBT00001754202.
DR   EnsemblGenomes-Tr; EBT00001754203.
DR   EnsemblGenomes-Tr; EBT00001754204.
DR   EnsemblGenomes-Tr; EBT00001754205.
DR   EnsemblGenomes-Tr; EBT00001754206.
DR   EnsemblGenomes-Tr; EBT00001754207.
DR   EnsemblGenomes-Tr; EBT00001754208.
DR   EnsemblGenomes-Tr; EBT00001754209.
DR   EnsemblGenomes-Tr; EBT00001754210.
DR   EnsemblGenomes-Tr; EBT00001754211.
DR   EnsemblGenomes-Tr; EBT00001754212.
DR   EnsemblGenomes-Tr; EBT00001754214.
DR   EnsemblGenomes-Tr; EBT00001754215.
DR   EnsemblGenomes-Tr; EBT00001754216.
DR   EnsemblGenomes-Tr; EBT00001754217.
DR   EnsemblGenomes-Tr; EBT00001754218.
DR   EnsemblGenomes-Tr; EBT00001754219.
DR   EnsemblGenomes-Tr; EBT00001754220.
DR   EnsemblGenomes-Tr; EBT00001754221.
DR   EnsemblGenomes-Tr; EBT00001754222.
DR   EnsemblGenomes-Tr; EBT00001754223.
DR   EnsemblGenomes-Tr; EBT00001754224.
DR   EnsemblGenomes-Tr; EBT00001754225.
DR   EnsemblGenomes-Tr; EBT00001754226.
DR   EnsemblGenomes-Tr; EBT00001754227.
DR   EnsemblGenomes-Tr; EBT00001754228.
DR   EnsemblGenomes-Tr; EBT00001754229.
DR   EnsemblGenomes-Tr; EBT00001754230.
DR   EnsemblGenomes-Tr; EBT00001754231.
DR   EnsemblGenomes-Tr; EBT00001754232.
DR   EnsemblGenomes-Tr; EBT00001754233.
DR   EnsemblGenomes-Tr; EBT00001754234.
DR   EnsemblGenomes-Tr; EBT00001754235.
DR   EnsemblGenomes-Tr; EBT00001754237.
DR   EnsemblGenomes-Tr; EBT00001754238.
DR   EnsemblGenomes-Tr; EBT00001754240.
DR   EnsemblGenomes-Tr; EBT00001754241.
DR   EnsemblGenomes-Tr; EBT00001754243.
DR   EnsemblGenomes-Tr; EBT00001754245.
DR   EnsemblGenomes-Tr; EBT00001754247.
DR   EnsemblGenomes-Tr; EBT00001754250.
DR   EnsemblGenomes-Tr; EBT00001754253.
DR   EnsemblGenomes-Tr; EBT00001754255.
DR   EnsemblGenomes-Tr; EBT00001754256.
DR   EnsemblGenomes-Tr; EBT00001754258.
DR   EnsemblGenomes-Tr; EBT00001754260.
DR   EnsemblGenomes-Tr; EBT00001754262.
DR   EnsemblGenomes-Tr; EBT00001754264.
DR   EnsemblGenomes-Tr; EBT00001754266.
DR   EnsemblGenomes-Tr; EBT00001754267.
DR   EnsemblGenomes-Tr; EBT00001754269.
DR   EnsemblGenomes-Tr; EBT00001754272.
DR   EnsemblGenomes-Tr; EBT00001754274.
DR   EnsemblGenomes-Tr; EBT00001754276.
DR   EnsemblGenomes-Tr; EBT00001754278.
DR   EnsemblGenomes-Tr; EBT00001754279.
DR   EnsemblGenomes-Tr; EBT00001754280.
DR   EnsemblGenomes-Tr; EBT00001754281.
DR   EnsemblGenomes-Tr; EBT00001754282.
DR   EnsemblGenomes-Tr; EBT00001754285.
DR   EnsemblGenomes-Tr; EBT00001754288.
DR   EnsemblGenomes-Tr; EBT00001754291.
DR   EnsemblGenomes-Tr; EBT00001754293.
DR   EnsemblGenomes-Tr; EBT00001754295.
DR   EnsemblGenomes-Tr; EBT00001754298.
DR   EnsemblGenomes-Tr; EBT00001754301.
DR   EnsemblGenomes-Tr; EBT00001754303.
DR   EnsemblGenomes-Tr; EBT00001754305.
DR   EnsemblGenomes-Tr; EBT00001754307.
DR   EnsemblGenomes-Tr; EBT00001754309.
DR   EnsemblGenomes-Tr; EBT00001754311.
DR   EnsemblGenomes-Tr; EBT00001754314.
DR   EnsemblGenomes-Tr; EBT00001754316.
DR   EnsemblGenomes-Tr; EBT00001754319.
DR   EnsemblGenomes-Tr; EBT00001754322.
DR   EnsemblGenomes-Tr; EBT00001754326.
DR   EnsemblGenomes-Tr; EBT00001754329.
DR   EnsemblGenomes-Tr; EBT00001754332.
DR   EnsemblGenomes-Tr; EBT00001754335.
DR   EnsemblGenomes-Tr; EBT00001754338.
DR   EnsemblGenomes-Tr; EBT00001754340.
DR   EnsemblGenomes-Tr; EBT00001754346.
DR   EnsemblGenomes-Tr; EBT00001754348.
DR   EnsemblGenomes-Tr; EBT00001754351.
DR   EnsemblGenomes-Tr; EBT00001754353.
DR   EnsemblGenomes-Tr; EBT00001754356.
DR   EnsemblGenomes-Tr; EBT00001754358.
DR   EnsemblGenomes-Tr; EBT00001754360.
DR   EnsemblGenomes-Tr; EBT00001754364.
DR   EnsemblGenomes-Tr; EBT00001754366.
DR   EnsemblGenomes-Tr; EBT00001754369.
DR   EnsemblGenomes-Tr; EBT00001754372.
DR   EnsemblGenomes-Tr; EBT00001754375.
DR   EnsemblGenomes-Tr; EBT00001754377.
DR   EnsemblGenomes-Tr; EBT00001754381.
DR   EnsemblGenomes-Tr; EBT00001754383.
DR   EnsemblGenomes-Tr; EBT00001754386.
DR   EnsemblGenomes-Tr; EBT00001754387.
DR   EnsemblGenomes-Tr; EBT00001754390.
DR   EnsemblGenomes-Tr; EBT00001754392.
DR   EnsemblGenomes-Tr; EBT00001754395.
DR   EnsemblGenomes-Tr; EBT00001754397.
DR   EnsemblGenomes-Tr; EBT00001754399.
DR   EnsemblGenomes-Tr; EBT00001754400.
DR   EnsemblGenomes-Tr; EBT00001754403.
DR   EnsemblGenomes-Tr; SSOr01-1.
DR   EnsemblGenomes-Tr; SSOr02-1.
DR   EnsemblGenomes-Tr; SSOr03-1.
DR   EnsemblGenomes-Tr; SSOr04-1.
DR   EnsemblGenomes-Tr; SSOs01-1.
DR   EnsemblGenomes-Tr; SSOs02-1.
DR   EnsemblGenomes-Tr; SSOs03-1.
DR   EnsemblGenomes-Tr; SSOs04-1.
DR   EnsemblGenomes-Tr; SSOs05-1.
DR   EnsemblGenomes-Tr; SSOs06-1.
DR   EnsemblGenomes-Tr; SSOt01-1.
DR   EnsemblGenomes-Tr; SSOt02-1.
DR   EnsemblGenomes-Tr; SSOt03-1.
DR   EnsemblGenomes-Tr; SSOt04-1.
DR   EnsemblGenomes-Tr; SSOt05-1.
DR   EnsemblGenomes-Tr; SSOt06-1.
DR   EnsemblGenomes-Tr; SSOt07-1.
DR   EnsemblGenomes-Tr; SSOt08-1.
DR   EnsemblGenomes-Tr; SSOt09-1.
DR   EnsemblGenomes-Tr; SSOt10-1.
DR   EnsemblGenomes-Tr; SSOt11-1.
DR   EnsemblGenomes-Tr; SSOt12-1.
DR   EnsemblGenomes-Tr; SSOt13-1.
DR   EnsemblGenomes-Tr; SSOt14-1.
DR   EnsemblGenomes-Tr; SSOt15-1.
DR   EnsemblGenomes-Tr; SSOt16-1.
DR   EnsemblGenomes-Tr; SSOt17-1.
DR   EnsemblGenomes-Tr; SSOt18-1.
DR   EnsemblGenomes-Tr; SSOt19-1.
DR   EnsemblGenomes-Tr; SSOt20-1.
DR   EnsemblGenomes-Tr; SSOt21-1.
DR   EnsemblGenomes-Tr; SSOt22-1.
DR   EnsemblGenomes-Tr; SSOt23-1.
DR   EnsemblGenomes-Tr; SSOt24-1.
DR   EnsemblGenomes-Tr; SSOt25-1.
DR   EnsemblGenomes-Tr; SSOt26-1.
DR   EnsemblGenomes-Tr; SSOt27-1.
DR   EnsemblGenomes-Tr; SSOt28-1.
DR   EnsemblGenomes-Tr; SSOt29-1.
DR   EnsemblGenomes-Tr; SSOt30-1.
DR   EnsemblGenomes-Tr; SSOt31-1.
DR   EnsemblGenomes-Tr; SSOt32-1.
DR   EnsemblGenomes-Tr; SSOt33-1.
DR   EnsemblGenomes-Tr; SSOt34-1.
DR   EnsemblGenomes-Tr; SSOt35-1.
DR   EnsemblGenomes-Tr; SSOt36-1.
DR   EnsemblGenomes-Tr; SSOt37-1.
DR   EnsemblGenomes-Tr; SSOt38-1.
DR   EnsemblGenomes-Tr; SSOt39-1.
DR   EnsemblGenomes-Tr; SSOt40-1.
DR   EnsemblGenomes-Tr; SSOt41-1.
DR   EnsemblGenomes-Tr; SSOt42-1.
DR   EnsemblGenomes-Tr; SSOt43-1.
DR   EnsemblGenomes-Tr; SSOt44-1.
DR   EnsemblGenomes-Tr; SSOt45-1.
DR   EnsemblGenomes-Tr; SSOt46-1.
DR   EuropePMC; PMC142822; 12533469.
DR   EuropePMC; PMC155377; 12754243.
DR   EuropePMC; PMC1574309; 16869956.
DR   EuropePMC; PMC166490; 12897009.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2685585; 16877322.
DR   EuropePMC; PMC2779898; 17573465.
DR   EuropePMC; PMC2944543; 20675475.
DR   EuropePMC; PMC35428; 11427726.
DR   EuropePMC; PMC3604779; 23481601.
DR   EuropePMC; PMC3754733; 23836868.
DR   EuropePMC; PMC3977132; 23078543.
DR   EuropePMC; PMC5023256; 27682106.
DR   EuropePMC; PMC5127849; 27965637.
DR   EuropePMC; PMC5312242; 28031352.
DR   EuropePMC; PMC5605242; 28158820.
DR   EuropePMC; PMC5797428; 29434576.
DR   EuropePMC; PMC6080066; 30094064.
DR   EuropePMC; PMC92520; 11713310.
DR   EuropePMC; PMC99098; 11752244.
DR   GOA; P60465.
DR   GOA; P60833.
DR   GOA; P81551.
DR   GOA; P81552.
DR   InterPro; IPR002730; RNase_P/MRP_p29.
DR   InterPro; IPR016482; SecG/Sec61-beta/Sbh.
DR   InterPro; IPR023531; Preprot_translocase_SecG.
DR   InterPro; IPR023534; Rof/RNase_P-like.
DR   InterPro; IPR023538; RNP1.
DR   InterPro; IPR036980; RNase_P/MRP_p29_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01147; sR12.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01311; sR8.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01338; CRISPR-DR25.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE006641.
DR   SILVA-SSU; AE006641.
DR   StrainInfo; 267483; 0.
DR   UniProtKB/Swiss-Prot; P60465; SECG_SACS2.
DR   UniProtKB/Swiss-Prot; P60833; RNP1_SACS2.
DR   UniProtKB/Swiss-Prot; P81551; S7C3_SACS2.
DR   UniProtKB/Swiss-Prot; P81552; S7C4_SACS2.
XX
CC   On or before Feb 19, 2009 this sequence version replaced
CC   AE006642.1, AE006643.1, AE006644.1, AE006645.1, AE006646.1,
CC   AE006647.1, AE006648.1, AE006649.1, AE006650.1, AE006651.1,
CC   AE006652.1, AE006653.1, AE006654.1, AE006655.1, AE006656.1,
CC   AE006657.1, AE006658.1, AE006659.1, AE006660.1, AE006661.1,
CC   AE006662.1, AE006663.1, AE006664.1, AE006665.1, AE006666.1,
CC   AE006667.1, AE006668.1, AE006669.1, AE006670.1, AE006671.1,
CC   AE006672.1, AE006673.1, AE006674.1, AE006675.1, AE006676.1,
CC   AE006677.1, AE006678.1, AE006679.1, AE006680.1, AE006681.1,
CC   AE006682.1, AE006683.1, AE006684.1, AE006685.1, AE006686.1,
CC   AE006687.1, AE006688.1, AE006689.1, AE006690.1, AE006691.1,
CC   AE006692.1, AE006693.1, AE006694.1, AE006695.1, AE006696.1,
CC   AE006697.1, AE006698.1, AE006699.1, AE006700.1, AE006701.1,
CC   AE006702.1, AE006703.1, AE006704.1, AE006705.1, AE006706.1,
CC   AE006707.1, AE006708.1, AE006709.1, AE006710.1, AE006711.1,
CC   AE006712.1, AE006713.1, AE006714.1, AE006715.1, AE006716.1,
CC   AE006717.1, AE006718.1, AE006719.1, AE006720.1, AE006721.1,
CC   AE006722.1, AE006723.1, AE006724.1, AE006725.1, AE006726.1,
CC   AE006727.1, AE006728.1, AE006729.1, AE006730.1, AE006731.1,
CC   AE006732.1, AE006733.1, AE006734.1, AE006735.1, AE006736.1,
CC   AE006737.1, AE006738.1, AE006739.1, AE006740.1, AE006741.1,
CC   AE006742.1, AE006743.1, AE006744.1, AE006745.1, AE006746.1,
CC   AE006747.1, AE006748.1, AE006749.1, AE006750.1, AE006751.1,
CC   AE006752.1, AE006753.1, AE006754.1, AE006755.1, AE006756.1,
CC   AE006757.1, AE006758.1, AE006759.1, AE006760.1, AE006761.1,
CC   AE006762.1, AE006763.1, AE006764.1, AE006765.1, AE006766.1,
CC   AE006767.1, AE006768.1, AE006769.1, AE006770.1, AE006771.1,
CC   AE006772.1, AE006773.1, AE006774.1, AE006775.1, AE006776.1,
CC   AE006777.1, AE006778.1, AE006779.1, AE006780.1, AE006781.1,
CC   AE006782.1, AE006783.1, AE006784.1, AE006785.1, AE006786.1,
CC   AE006787.1, AE006788.1, AE006789.1, AE006790.1, AE006791.1,
CC   AE006792.1, AE006793.1, AE006794.1, AE006795.1, AE006796.1,
CC   AE006797.1, AE006798.1, AE006799.1, AE006800.1, AE006801.1,
CC   AE006802.1, AE006803.1, AE006804.1, AE006805.1, AE006806.1,
CC   AE006807.1, AE006808.1, AE006809.1, AE006810.1, AE006811.1,
CC   AE006812.1, AE006813.1, AE006814.1, AE006815.1, AE006816.1,
CC   AE006817.1, AE006818.1, AE006819.1, AE006820.1, AE006821.1,
CC   AE006822.1, AE006823.1, AE006824.1, AE006825.1, AE006826.1,
CC   AE006827.1, AE006828.1, AE006829.1, AE006830.1, AE006831.1,
CC   AE006832.1, AE006833.1, AE006834.1, AE006835.1, AE006836.1,
CC   AE006837.1, AE006838.1, AE006839.1, AE006840.1, AE006841.1,
CC   AE006842.1, AE006843.1, AE006844.1, AE006845.1, AE006846.1,
CC   AE006847.1, AE006848.1, AE006849.1, AE006850.1, AE006851.1,
CC   AE006852.1, AE006853.1, AE006854.1, AE006855.1, AE006856.1,
CC   AE006857.1, AE006858.1, AE006859.1, AE006860.1, AE006861.1,
CC   AE006862.1, AE006863.1, AE006864.1, AE006865.1, AE006866.1,
CC   AE006867.1, AE006868.1, AE006869.1, AE006870.1, AE006871.1,
CC   AE006872.1, AE006873.1, AE006874.1, AE006875.1, AE006876.1,
CC   AE006877.1, AE006878.1, AE006879.1, AE006880.1, AE006881.1,
CC   AE006882.1, AE006883.1, AE006884.1, AE006885.1, AE006886.1,
CC   AE006887.1, AE006888.1, AE006889.1, AE006890.1, AE006891.1,
CC   AE006892.1, AE006893.1, AE006894.1, AE006895.1, AE006896.1,
CC   AE006897.1, AE006898.1, AE006899.1, AE006900.1, AE006901.1,
CC   AE006902.1, AE006903.1, AE006904.1, AE006905.1, AE006906.1,
CC   AE006907.1, AE006908.1, AE006909.1, AE006910.1, AE006911.1,
CC   AE006912.1, AE006913.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2992245
FT                   /organism="Saccharolobus solfataricus P2"
FT                   /strain="P2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:273057"
FT   gene            join(2991448..2992245,1..252)
FT                   /locus_tag="SSO12256"
FT   CDS_pept        join(2991448..2992245,1..252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO12256"
FT                   /product="Glycosyltransferase, putative"
FT                   /note="Similar to cellulose synthase homologs ydaM and
FT                   icaA, probably involved in cell wall biogenesis or
FT                   intercellular adhesion; Cell Envelope, Surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO12256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK43339"
FT                   /db_xref="GOA:Q97TY0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q97TY0"
FT                   /protein_id="AAK43339.1"
FT                   /translation="MIVPVKNEERVLPRLLDRLVNLEYDKSKYEIIVVEDGSTDRTFQI
FT                   CKEYEIKYNNLIRCYSLPRANVPNGKSRALNFALRISKGEIIGIFDGDTVPRLDILEYV
FT                   EPKFEDITVGAVQGKLVPINVRESVTSRLAAIEELIYEYSIAGRAKVGLFVPIEGTCSF
FT                   IRKSIIMELGGWNEYSLTEDLDISLKIVNKGCKIVYSPTTISWREVPVSLRVLIRQRLR
FT                   WYRGHLEVQLGKLRKIDLRIIDGILIVLTPFFMVLNLVNYSLVLVYSSSLYIVAASLVS
FT                   LASLLSLLLIILIARRHMIEYFYMIPSFVYMNFIVALNFTAIFLELIRAPRVWVKTERS
FT                   AKVTGEVMG"
FT   gene            249..857
FT                   /locus_tag="SSO0001"
FT   CDS_pept        249..857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0001"
FT                   /product="Hypothetical protein"
FT                   /note="Predicted membrane protein, conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK43340"
FT                   /db_xref="GOA:Q97TX9"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="PDB:4IC1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97TX9"
FT                   /protein_id="AAK43340.1"
FT                   /translation="MITEFLLKKKLEEHLSHVKEENTIYVTDLVRCPRRVRYESEYKEL
FT                   AISQVYAPSAILGDILHLGLESVLKGNFNAETEVETLREINVGGKVYKIKGRADAIIRN
FT                   DNGKSIVIEIKTSRSDKGLPLIHHKMQLQIYLWLFSAEKGILVYITPDRIAEYEINEPL
FT                   DEATIVRLAEDTIMLQNSPRFNWECKYCIFSVICPAKLT"
FT   gene            889..2091
FT                   /gene="thiD-1"
FT                   /locus_tag="SSO0002"
FT   CDS_pept        889..2091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-1"
FT                   /locus_tag="SSO0002"
FT                   /product="Phosphomethylpyrimidine kinase (thiD-1)"
FT                   /EC_number="2.7.4.7"
FT                   /note="Cofactor Biosynthesis, Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40369"
FT                   /db_xref="GOA:Q981E3"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q981E3"
FT                   /protein_id="AAK40369.1"
FT                   /translation="MHTRPVVATIAGSDSGGGAGLQADLKTFSALGVFGTTIITGLTAQ
FT                   NTRTVTKVLEIPLDFIEAQFDAVCLDLHPTHAKTGMLASGKVVELVLRKIREYNIKLVL
FT                   DPVMVAKSGSLLVTEDISEQIKKAMKEAIISTPNRYEAEIINKTKINSQDDVIKAAREI
FT                   YSKYGNVVVKGFNGVDYAIIDGEEIELKGDYISTKNTHGSGDVFSASITAYLALGYKLK
FT                   DALIRAKKFATMTVKYGLDLGGGYGPVDPFAPIESIVKREEGRNQLENLLWYLESNLNV
FT                   ILKLINDTSKVNVAYMTKYNDVLSLAGGLIKYLDKLKIDGPILNNVNNEITRIMRETPD
FT                   EKIGILLPFTDKILDAAEKGKIKLNKSGINGDAILRDNMVLIIAKDKDELIRKLKEVAI
FT                   G"
FT   gene            2088..2969
FT                   /gene="rbsK-1"
FT                   /locus_tag="SSO0004"
FT   CDS_pept        2088..2969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK-1"
FT                   /locus_tag="SSO0004"
FT                   /product="Ribokinase (rbsK-1)"
FT                   /EC_number="2.7.1.15"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40370"
FT                   /db_xref="GOA:Q981E2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q981E2"
FT                   /protein_id="AAK40370.1"
FT                   /translation="MIIVVGSYNVDVILKVNKIPEIGETVIADELYITHGGKGSNQAVS
FT                   ASRLGSHVKIIVAVGDDKHGTDAIEFWKSENIDVSKVKVKSGINTGTAYIFVDKKGRNI
FT                   IVVNRGANYYLSEDDLNNSLEGDILLMQLEIRESVVKKAAKEFNGIKILNPAPANLKDT
FT                   EILSLVDIITPNEIEFKELVNTDDFEYGLNLLLKKVKKAVIVTLGERGALLATRDGKKV
FT                   LIPAPKVNVIDETGAGDVFNAALSVYLEKGYDLETAVEYANKVAALSVTKIGALGPKLD
FT                   EVVRFLEEIDKA"
FT   gene            3057..3743
FT                   /locus_tag="SSO0006"
FT   CDS_pept        3057..3743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0006"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Present in archaea and some bacteria and eukarya,
FT                   including M. jannaschii, E. coli, B. subtilus, yeast, and
FT                   human."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40371"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q981E1"
FT                   /protein_id="AAK40371.1"
FT                   /translation="MKITFIGTGAGSSLGLKRVKSSILINDKVLLDLGPGAELRLEDLR
FT                   IHPKALFITHLHIDHFSGVFDYLVQRKIRQIPELVIYSPKGFSEVLNIYTRIGNNISAK
FT                   IYESDLPSGKIDEMEIYSIQACHSIYAVSYIISDGNTRVLYTGDTKEPCNAILENIKDV
FT                   DLIIHETTCVDDCSIWGHTSIKQIFELFSNKRIFATHIPAEIEEKIISLANNKINIAFD
FT                   GLSLNV"
FT   gene            3736..4458
FT                   /locus_tag="SSO0007"
FT   CDS_pept        3736..4458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0007"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40372"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q981E0"
FT                   /protein_id="AAK40372.1"
FT                   /translation="MCRILAFHTKGEISKEYVNALIRASRNDIFSKYGSHPDGWGLSIF
FT                   LKRNDKWKVIYYRSEDPIYEDPNISYLIDIAKGEDIVGVIHARKAGRKFLTGLSHAHPY
FT                   YMRANIYDLYFAHNGSVSRTSFKDSNRPFTDSYLILEEIKTLIESNMSPFDAYAITLDK
FT                   LKDCSTSLNSSLIYYNKKEGPSILIGYYYNRNRLSKETNEEYYKLYTDNKRYIFSSTIK
FT                   YYLGVDAEELIMGSIIHL"
FT   gene            4500..5348
FT                   /locus_tag="SSO0008"
FT   CDS_pept        4500..5348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0008"
FT                   /product="Transposase, probably IS605-TnpB family"
FT                   /note="Cannot be named yet because only one copy exists and
FT                   therfore the length is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40373"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D9"
FT                   /protein_id="AAK40373.1"
FT                   /translation="MKESLIEAKVMDYGKLKDIQKEILYYKLYVDALKKKGIKEKVDPP
FT                   PTLPKSIVSSVLTGGIPRDGPLQIELVSNDVVKIKEYNTLVKIQSDSRLPLYAIVEYRD
FT                   TDIRVYLAYRENPSIVGLDLGLRHLITIVAIKDTKPWKVRFFDEPKLMEKFANFLSENQ
FT                   GIIKLEEMKSNAKRIIYEAVSFIEDLEPKVVAMENLEYFETKTGKGLRALQNMLENEIR
FT                   RRGIRYRKIDPYNTSRVCAKCGYKKGEILGSLFVCPACGYKADRDYNAAYNIALKCYYT
FT                   C"
FT   gene            complement(5351..6334)
FT                   /locus_tag="SSO0009"
FT   CDS_pept        complement(5351..6334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0009"
FT                   /product="Deacetylase, putative"
FT                   /note="Histone deacetylase family; Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40374"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D8"
FT                   /protein_id="AAK40374.1"
FT                   /translation="MITIVYDDIYKYHAPKGYHVENPSRIDKALSAINQLKVKFKKPIK
FT                   VDDPQIIHSEDYVKLVEKHSKLEENLDEDTYTNRYTYESALYAMGGALEAFETNGFALV
FT                   RPPGHHAGVNGRAFGAPTLGFCIFNNVAYPIKKYKLKRVAIIDFDVHYGNGTQEIFYDD
FT                   PDILHIDVHQDPRTIYPGNGFPDMIGEKDAEGTKINLLIPPLGSDDLYEELIPIIQAIL
FT                   DDFKPAVIAYSAGFDSYMGDGLASVNATEYTFYSFGVLSNKFTKKYAVLEGGYDKGLIK
FT                   GLKAFLEGFANIKMEYKKYQSNDSVRSRFMNYLSEEKNILRNYWSI"
FT   gene            6376..7431
FT                   /locus_tag="SSO0010"
FT   CDS_pept        6376..7431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0010"
FT                   /product="X-pro aminopeptidase"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40375"
FT                   /db_xref="GOA:Q981D7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D7"
FT                   /protein_id="AAK40375.1"
FT                   /translation="MNRIQRVQKELERANADYLITGTTSNMYYLIGFSEEQMERPLLLF
FT                   ITRDDYFLLVPKLYEEQLKQFPLIVYRDGEDPYSKLNLKENSNVLIDDTTFSLFTIEIL
FT                   NRFKPGRIGRASRILGKLRQVKDDEELEKMEKGVKKAEQLILEFVSNIKENMTECQIER
FT                   KLKSFLIEEAGNISFDPIVTSGPNSSMPHLRCSDKKVKRGEAIVIDYGIKHDGYSTDTT
FT                   RVFSLGKPNDPLILEIVEIVKTANEEAEKHVREGMRAKEIDYFAREVITNKGYGDYFIH
FT                   RTGHGIGIDVHEDPYISPDNDDVIEQNMVFTIEPGIYLPGKFGIRIEDEVVVKKGYGKT
FT                   LNMLQKELYII"
FT   gene            7555..10479
FT                   /locus_tag="SSO0011"
FT   CDS_pept        7555..10479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0011"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Predicted membrane protein conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40376"
FT                   /db_xref="GOA:Q981D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D6"
FT                   /protein_id="AAK40376.1"
FT                   /translation="MKVISVKKSLIILLFVILSPITYLTLPLSSQSTPIQGYATSSELI
FT                   TPGEIEVPITFHLINLGQTLTEVTITPADTYPFYLYPYNNGTELTHIPLWNQGQTVNVT
FT                   YLFDIASTAKTGTYTDVVVVQGITTSGTQVTYDVLVPVVIAGYVNFSASSVWGTTSNPM
FT                   VVGPGENNIPLTIILQNLGNSLVTNITLELNSQFPVGFLQNNATISAIPAGYYGEVTVM
FT                   TSVYPNATEGLYYIKLNVIYYHNATTTVLVPIDIGSSNQVSLEDAWGTPSDPMVAAPGE
FT                   TLLPLTIYVKNLGENLLSNVMLILQSHYPIQFLQNYTMIGFVPAGGYNYVTVVANVYKN
FT                   VTPGVYYVPITLVAYDGGFMQTFEMPVYVLGYVNFSASSVWGTTSNPMVVGPGENNIPL
FT                   TIILQNSGIVTVTNATLFLQSQYPVQFLQNNVTLGNVPAGYPIPVTVLANVYPNVTNTG
FT                   VYYITAKVMYYDGVIQYVKVPIYIESLNQVSVEGIWGSLSNPILVAPGENNVPLTLVIK
FT                   NLGENLLSNVSLILQSHYPIQFLQQNASVGFVPAGSYNYVTVTANVFPNATPGVYYIPA
FT                   TLVAYGGFKENIMITVDILGYVTIQAQSLWGEVTSPITVSSGETDVPLTVLLKNTGDVN
FT                   ILNATLVFQNVEYPLIFHQATAQIGIVPAGQENYATVTVSVFPNATPGVYYIPATLYYF
FT                   NHQTTITVPITIYSPNISVNLVTIPPQVFPSYYDVRLLVILTNFGGGIAENANVSIQSP
FT                   FQVISSNPLHLGALPVGVPINATFLINVPNNTVPKIYIVNITINYDGGKETYQYPLQIY
FT                   PKANLIVVGVSYPSLSAGDSNVPITITLKNAGNSTAKNVIVRLGTSNLIYPHVSSSNPL
FT                   QALTASEVFAGDIAPGQAINVTFVVDVSGGASAGTYPLAIALIWNQTGALFPFEQSDTF
FT                   YVTISPPFYEQFFKSPIGIITIIVIIVIIIVIAAVLLRVRNKRR"
FT   gene            10496..10651
FT                   /locus_tag="SSO5023"
FT   CDS_pept        10496..10651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40377"
FT                   /db_xref="GOA:Q981D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D5"
FT                   /protein_id="AAK40377.1"
FT                   /translation="MIRAFLLLTLFFRPIYSELALVLSLILILLILLLSSLSLLIKILR
FT                   LLKNIY"
FT   gene            11143..11760
FT                   /locus_tag="SSO0012"
FT   CDS_pept        11143..11760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0012"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40378"
FT                   /db_xref="GOA:Q981D4"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="PDB:5H35"
FT                   /db_xref="PDB:5WTR"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D4"
FT                   /protein_id="AAK40378.1"
FT                   /translation="MYMILELLNIIGIIAFTISGSLKGTNKGLDIFGVVTLGVITSYAG
FT                   GIIADILLGIYPPQILKELNYLLLSVGISIFVFYFYKWLQTNPIKMIIAISDAVGLSTF
FT                   ATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDVLVNEIPMVLTKEIYATAALLSGFI
FT                   YYFTTPYLHHDSLFVAFLGSFLLRILSIKYNFNLPKREDNKS"
FT   gene            complement(11767..11946)
FT                   /locus_tag="SSO5027"
FT   CDS_pept        complement(11767..11946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5027"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40379"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D3"
FT                   /protein_id="AAK40379.1"
FT                   /translation="MEDVKQSVEKIIKDREWITFNDLLKYIPYPAPEVYNALSQLIKEN
FT                   KVGRRGRYFYYIKR"
FT   gene            12050..12673
FT                   /locus_tag="SSO0013"
FT   CDS_pept        12050..12673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0013"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40380"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D2"
FT                   /protein_id="AAK40380.1"
FT                   /translation="MLLYFKPTKKERDINVALEIVSELFASRIGKLMGLPILEVSLIKH
FT                   GDEIGLLMDYLPDKATEQNIYNLDEIKMSLAFEEWILNIDLKEDHVLSKNGKGFIIDHG
FT                   HSLSAWKPLYYIIQIIDKKVSRFNLWASEDDFRDGIELLSSIDHNTISEILKESFSEVV
FT                   ESNFCKLFTREVAAEYMDLNIKILEKRMKYLKDGKILFTYNYRQ"
FT   gene            complement(12647..13030)
FT                   /locus_tag="SSO0014"
FT   CDS_pept        complement(12647..13030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0014"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40381"
FT                   /db_xref="GOA:Q981D1"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D1"
FT                   /protein_id="AAK40381.1"
FT                   /translation="MDFNNIIGNTLRIGVIISAIIIIFGVALLFVNNGSNGFTITQISS
FT                   SNSIVNSSIFKPSEIFSGLPKLYGLDYIYLGLMVLIATPVLRVLLGIAQFASERNKLYT
FT                   IITIIVFFNLMFAIFLLPIIIGK"
FT   gene            complement(13020..13880)
FT                   /locus_tag="SSO0015"
FT   CDS_pept        complement(13020..13880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0015"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40382"
FT                   /db_xref="GOA:Q981D0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q981D0"
FT                   /protein_id="AAK40382.1"
FT                   /translation="MLTPIEFFVTVVLISALSGILGALTGLGGATFLVPIYTLYLNVPI
FT                   AYASGASLISTIATSSGAASAYVKDRITNVKIGMGLEIATTTGSIAGALTVAYIYAHHL
FT                   EFIVYIVFGIVLLSQVYVQLAKSKFELPKPIKPDWTTRVFELYGKYYDTVLKQEVEYHG
FT                   VRWWLGEIIMFFAGFISGLLGIGSGALKVLGMDWAMNLPMKVSTTTSNFMIGVTAATGS
FT                   SIYWIFGYIQPFLAAGTALGVLIGAFVGTKILVRVTNKTIRYIFTAILIFLGIQMILRG
FT                   FGYGL"
FT   gene            complement(13920..15314)
FT                   /locus_tag="SSO0016"
FT   CDS_pept        complement(13920..15314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0016"
FT                   /product="Transcription regulator (exsB) related protein"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40383"
FT                   /db_xref="GOA:Q981C9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q981C9"
FT                   /protein_id="AAK40383.1"
FT                   /translation="MCSVSGVLILNPKNFEKVELKLASILKKAEDRGRDSFGIVVIQKD
FT                   GTVKVRKSIGKPSEKEELLYGILDEDSRVVIANNRAEPTTEYVRQKTEDDIQPFIGDRY
FT                   IVTHNGIIANDLELEKKYELKRKTKIDSAILPLLLDKTWDGNLEALKGILEQIKGSFAL
FT                   VIGDKKNPDRIFLAQNFKPLYMAYDHSLESLFFTSLDEYFDAKPFDPVNITKLEPYSVV
FT                   MVTSNKLITTLPIMEKRKKYRVLVVASGGLDSTVAATKLLREGHEVTLIHFNYHHKAEE
FT                   KEREAVRKIAEYLQIPLLEINTDLFKIIGHATLIKGGGEIVKDRKGEEGAEFAHEWVPA
FT                   RNLIFFSVSLAIAEAYGYDAIASGINLEEAGAYPDNEMEFIRMLNKLSPYATGPNKRIE
FT                   ILMPVGNLVKHEIVKLGYEIGAPLHLTWSCYEGGQKHCGKCGPCYMRKMAFRINGLKDP
FT                   VEYDEE"
FT   gene            15589..17808
FT                   /locus_tag="SSO0017"
FT   CDS_pept        15589..17808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0017"
FT                   /product="ATP-dependent helicase"
FT                   /note="Lhr-like protein; Helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40384"
FT                   /db_xref="GOA:Q981C8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C8"
FT                   /protein_id="AAK40384.1"
FT                   /translation="MEILSEVNDKLKTFNAKIAHVHTETFLEPEYGPSINEIDIDDKLK
FT                   KSIIEYGIERLYKYQYDAYRKIKNKENVMIISGTGTGKTEAFLIPILDLALKGERSVLV
FT                   YPTKALARDQLTRVYKLARELGLNVGIFDGDTPEKERERLYRNPPHILITNPDMIHLGL
FT                   ALSTRFRFLLRTADHFIFDEVHVYEGVLGAHIRNLADRIKEFKNDIHIVASSATVGATK
FT                   YLFEELFGVEGEIIEGIRRRKGIAIHSIIDSGNSSRWTLAAYLAAVLVKNGLKVLVFTD
FT                   SQQMAELVAKIADRFRVNLEVHRAGLIAEERIKVEEKLRNGELDGVVATPTLELGIDIG
FT                   TIDAVIMAENPPSYTKYVQRAGRAGRRNNAGLVFTILGDDPIDSYYLRHPEEFFTRKIQ
FT                   ALTFDPTNIEVIKIHALAYLAEKYRVKLNNLPPLWKKAYEILATESRAKIVGSYVLATP
FT                   ETKKYVATTSLRSVGPIVRIYEDKKKIGERELPAALHDLYPNAVYLISKKTYIIEEFDI
FT                   DRLIAKVRKVNSELSYYTKPLYSMDLLEFNKKDEREVYGEKVEYGDMKLVMRVEGYVTY
FT                   DVYSKRGKNEYFYENPISFTYNTKGLLIYHPLIDDFTLIDHMETYHATEHVLISAARVA
FT                   AGASLTDLGGISYPSGHVVIYDSSIGGSGVSKLLFERLEQAYEVALDIVKSCNCEDGCP
FT                   NCVYSPYCGNNNKYLSRKKSLRLIDGLIKGTIKGVNKDREGNPIA"
FT   gene            17801..19660
FT                   /locus_tag="SSO0018"
FT   CDS_pept        17801..19660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0018"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40385"
FT                   /db_xref="GOA:Q981C7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C7"
FT                   /protein_id="AAK40385.1"
FT                   /translation="MHNNFYRILKPTKVGNVEVKNVIKYSEGISILPNAVPRYEYFRGL
FT                   EGENVIDFIDYKGVDDLGDKLRVKAGTKWSEVLEKYKVEFWSNADFSIGGSVFFNDPIT
FT                   GFNEFGKINGRVEVDAYLDGKYYSGRYKGGIVIHVYLKKEEKEIVYKRLYGNLSELISI
FT                   IKSWYTSRIPVFREVSLVKKDKESYILVSYPKTREVLLQGLLSEFNEESSPIVEKIEYE
FT                   YWYLGYSPLNTIDSIINLAKESQLSVIRFRKDEIAYSIYSNKRLESIRNTLEYSTIEGE
FT                   GLFNGCILCGKCVSVCPYGKQTNDVFHTPLGFYSITYFEKENDLANCHMCGLCEQVCPV
FT                   RLDITNELRKATKINQISPKNLLRSINSDLSSVLIITSLSEELNDQIIKSLIYLIKKGK
FT                   RVGIFYLAEDFSKIVKNEFSLEGLLKFKEIYTITPEEYFYLQKLKKRTVIDIYNIQLLA
FT                   MNDLKMNKDNLHIPCLLGSELNESNFTCTNVFLNILNNKDNINRTIDKKVTLCPLTARE
FT                   LNIKTPLDLVEINLDENYISDFYKKLEIGTKDLGEDIEEDLGWYKDIEDRIVDEVYSTL
FT                   IDGIIKGENIENLVLLYFKLNSMDLTKNIKEILMDKLTKIIFS"
FT   gene            complement(19647..20195)
FT                   /gene="moaB"
FT                   /locus_tag="SSO0019"
FT   CDS_pept        complement(19647..20195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaB"
FT                   /locus_tag="SSO0019"
FT                   /product="Molybdenum cofactor biosynthesis protein B
FT                   (moaB)"
FT                   /note="Cofactor Biosynthesis, Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40386"
FT                   /db_xref="GOA:Q981C6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C6"
FT                   /protein_id="AAK40386.1"
FT                   /translation="MNNLMSAHKQHRQHAPTNINFYVITISTSRYEKLVRKEPLIDESG
FT                   DIIKQLIIQSNYNIIGYELVPDEKVKILKAFANALDNSQTDVIISTGGTGYTQSDVTVE
FT                   TIRRIFDREIEGFSDVFRLVSYNDPEVKSASYLTKATAGIINDKVIFLLPGSPDAVRLA
FT                   MKELILPEIGHLLYIVRRK"
FT   gene            complement(20199..21008)
FT                   /locus_tag="SSO0020"
FT   CDS_pept        complement(20199..21008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0020"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40387"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C5"
FT                   /protein_id="AAK40387.1"
FT                   /translation="MIVEGYFLKYRDVIWSIKGCYHPDGYAVAIPRLFNGVKIKRLNDA
FT                   LEVVRTKFSNLLKYVDEIGFNVPLVPLNESEILDPFNAKIFNNRVREFLRFFNGDVGIT
FT                   GSYLYLGKGNDMDFLSFKPEHYYVLEELRKKGITKPLSTVEESEIETLDYSSFKILKSK
FT                   RILEGIFEGRGYTFKIVQCEKFGPVREVKEFEGYVRILKSIKPFTIPVKYLVTDNHGNE
FT                   YILTSFRTRFTELLPNMEIFIKGKILVRDEFNDMDLDIAEIVKLKSF"
FT   gene            21513..22064
FT                   /gene="soxB-like"
FT                   /locus_tag="SSO0021"
FT   CDS_pept        21513..22064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB-like"
FT                   /locus_tag="SSO0021"
FT                   /product="Oxidoreductase, soxB-like, putative (soxB-like)"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40388"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C4"
FT                   /protein_id="AAK40388.1"
FT                   /translation="MIILSAGAWSKYLINVKLPVKTYYCWASLFLSKKKEVGSNIIYDY
FT                   VNNFYSRPVIGLGFPLAIMGDGKAIETTPLQQNICIEDKNEVSARISRRLGEVKELYTS
FT                   GSFCEATPDMRPAYGKIAENVYFIGGFNGYGAEVGPGLAHVLVEEILSKKEDTYFTEYR
FT                   LERLNGYDGNFEIGQEPHEL"
FT   gene            complement(22052..22492)
FT                   /locus_tag="SSO0022"
FT   CDS_pept        complement(22052..22492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0022"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40389"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C3"
FT                   /protein_id="AAK40389.1"
FT                   /translation="MISWLLGSQPSPWSFLEDLFQDYRNVAIYVDNNNIVQIVKVSDID
FT                   EFYTPFSVLIHAKYFKNYSPYYIKLEKMVAFPTTNEKVADSLLIKEGWRGIKYYYGDEF
FT                   LGAWILYDCIKCRDKQRSHLEISKLSISEDETIKAHLRIYNS"
FT   gene            22598..23215
FT                   /locus_tag="SSO0023"
FT   CDS_pept        22598..23215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0023"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to APE1113 (Aeoperum pernix)"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40390"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C2"
FT                   /protein_id="AAK40390.1"
FT                   /translation="MRSKLMFISDLEKLAKRLEELYGDIELDDIVQRLIDFYELGFTNI
FT                   NHSSLQLILSAYFKSLGYRVFVEYEKKGKLLDLYVSDEDMGIEVEYGYIPNSDAIDAEE
FT                   YLLSRISLKILRYSSLSSKFYIAVPSFYMPPIPEELTADVKDKAKLRRVIEIIRKFYKI
FT                   NDVTFNDVKLAKINGIISVDISNLSISVIDIRKYKQLKDSYK"
FT   gene            complement(23195..23842)
FT                   /locus_tag="SSO0024"
FT   CDS_pept        complement(23195..23842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0024"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40391"
FT                   /db_xref="GOA:Q981C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C1"
FT                   /protein_id="AAK40391.1"
FT                   /translation="MLITISDIAWGIALSIWVAIVVLYISKLISKKFGAYVTRKAIHML
FT                   GGGIVAVLSPFVFNSPLVPIITSYLIMAYLITIRVLRKEMSWFMDKENLGEVFFAFSFG
FT                   TVLLVMFILDPNYWTSTDLIYVAVLPLIFMSFGDGITGIIRNFVYKRRVKGLWGSMGML
FT                   IFCATVGYFVLNIPGLIAGILATVAELLPYIDDNISVPFLSFLFLYLFVRVL"
FT   gene            23895..24512
FT                   /locus_tag="SSO0025"
FT   CDS_pept        23895..24512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0025"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40392"
FT                   /db_xref="UniProtKB/TrEMBL:Q981C0"
FT                   /protein_id="AAK40392.1"
FT                   /translation="MQLYKYSLKDGYLVPNENGDVTVFVEGNFISITDKNGNKIEGARF
FT                   KYLGNEYLLLEKLRYLAKLVNVDVDEDVLLAHPTLRNRTLAINKLMGELFEVFIYNLLL
FT                   AKDYKVKRQFEIYPSLRKFTHTRWHNRPDFIVEDKLVIEAKIHKNDYLQTLEYSKYFKY
FT                   GMAVFPFTGECRVPKGWICIFNTTKDQSRFYSLLEDLLSRVK"
FT   gene            24484..25713
FT                   /gene="purT"
FT                   /locus_tag="SSO0026"
FT   CDS_pept        24484..25713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="SSO0026"
FT                   /product="Phosphoribosylglycinamide formyltransferase 2
FT                   (purT)"
FT                   /EC_number="2.1.2.-"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40393"
FT                   /db_xref="GOA:Q981B9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q981B9"
FT                   /protein_id="AAK40393.1"
FT                   /translation="MKIYYLELSNCHMEIGTPLFEGSKKILLLGSGELGKEMAIEAQRM
FT                   GLEVVALDRYDLAPAMHVAHRKYVVDMMNPNAIKAVVKRERPDAIIAEIEAINTDALIE
FT                   LESNGFRVVPNANAVKACMNRIELRRFAAEKLKLPTTKYAFAENEEEVKRACKDIGFPC
FT                   LIKPEMSSSGHGHVLVNKIENVEEAYRESISHARGKSRRVIVEEFVKIDTELTVLTYRY
FT                   HSNSDSIITKTIEPIEHKRPSYYYVESWHPSNVSQGVKETARGIAQKVAEELGGLGIYG
FT                   VEIIVSGNRILFSEVAPRPHDTGLVTLASSDINEFQIHVRSAIGLPTPEVKLVSPAASH
FT                   VILAQTENVWGPKFLNIEKAMEIPGVQVRLFGKPVTYEKRRMGVVLATGNSVEEALEKV
FT                   RKASSIILVK"
FT   gene            complement(25702..26757)
FT                   /locus_tag="SSO0028"
FT   CDS_pept        complement(25702..26757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0028"
FT                   /product="Acetylpolyamine aminohydrolase"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40394"
FT                   /db_xref="GOA:Q981B8"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B8"
FT                   /protein_id="AAK40394.1"
FT                   /translation="MHKTAFIWTDEYYNYSFPDYHPFKSLRESMTKRLLEERGAFHFIT
FT                   LVEPKSIPEEALQLVHSKEYIEFVKYKSKEGQGYLDDGDTPAFKGIYEAALIRVSGSVK
FT                   ALELIKSGEFNHTINIGGGFHHAKRNRAAGFCVFNDVALISKLGESFFSRIAIVDIDGH
FT                   HADGTQELLIDDNNILKISLHMFHPNFFPGTGDVNEIGLGKGEGYTINIPLPPGTGDDG
FT                   YLLAFDEIVVPAIERYKPELIILVAGGDSHFNDPLVELKLSTHGYLDVVTKIHRLVHEY
FT                   SNGRLIMLGGGGYNYDATARIWTISIAEIAGIYDLEYETLHDSFSTKSSQFVMEKIRNT
FT                   ISLIKKIHSLN"
FT   gene            26805..27947
FT                   /locus_tag="SSO0029"
FT   CDS_pept        26805..27947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0029"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40395"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B7"
FT                   /protein_id="AAK40395.1"
FT                   /translation="MIDNTLITKPSYVAHSMDKLSDIISKMKENKMWTVPVIKDRKLIG
FT                   LISYKDLLSRRVSLETKAINIMSPSVTVQIDEDINRLIAKFYTTKARVIPVINEKREFI
FT                   GLVTRESLLSYLLKANEIPENRTAREYMTSPATSIDENDSIARARWLMIRDNISRLPAT
FT                   KEYRLTGIISARDIVDALYSVSGRKRESIMKDEERVMAMPVKEIMKYPVITANGKDSLT
FT                   DVVEKLLKFRISGMPVMEGDRLSGVISGLDIIKAVAEKMQLSIPIEAKIPQELKSNLEF
FT                   KANIDDILERYLSKIERLTEVINFKVSFKEEMRSSTGNKKLYTAMVRVTTKIGDYVARD
FT                   TDWEPVVALKNAVEKIEERILRKLRKIEESNKKGIKAEEA"
FT   gene            27944..28660
FT                   /locus_tag="SSO0031"
FT   CDS_pept        27944..28660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0031"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40396"
FT                   /db_xref="GOA:Q981B6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B6"
FT                   /protein_id="AAK40396.1"
FT                   /translation="MKIGVVQPLEVKSAILLAEKALKEGAELVLLPEKWTRNIDDVPLL
FT                   EFQKLAKRYTAYILPGAFEDGVSVITPIIDDSGNLKGIAKKIHLFNEERVRLIPGNEAV
FT                   LFTYRGIRFGISICYDIDFPEVVRELFSKGAEIILVPSKIRSNGLDIWNEFLRIRVLEN
FT                   RIGIVNANVYNPPDFPGRSVAIVPEQRQDGIVIPKVVGELGSEESYMIVDIDPLKYMYL
FT                   RGDRLKEYVKFTVKEL"
FT   gene            complement(28655..29461)
FT                   /locus_tag="SSO0032"
FT   CDS_pept        complement(28655..29461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0032"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40397"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B5"
FT                   /protein_id="AAK40397.1"
FT                   /translation="MMMDSLKLLSKYDNLTKILELTKEYASKLSLVFAIHAYFENEIIS
FT                   NVVKSLESKVKNIYEDYKFDRTLFVKNASKTLGIKEDDFAYYPYYAIPISKETKVKFID
FT                   NSTIPPKALIMKGVVRFTFMAYRSFQELEDHVASREEEDIVIEFENGKIKSHNRKRNIF
FT                   TDANVVSKIISSNKEVLLNLTLPSSYYLIPSLVSMNVLPYENEVLVIREGESLDFRIIN
FT                   GKVSGDRVVMGDTLHPRFKLELYYDYKFKRILKEEIAEGLAYKIPL"
FT   gene            complement(29591..30088)
FT                   /locus_tag="SSO0033"
FT   CDS_pept        complement(29591..30088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0033"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40398"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B4"
FT                   /protein_id="AAK40398.1"
FT                   /translation="MFEKLYSAIIYSDEFKKILLGRGVDDLEIASAYIAFLYEDLPIIG
FT                   KNLCAAFLRMGLDAVYNVMPSGKVYSPRHKLYPISRYGIDGVCINCDGGKIILRISNKG
FT                   YDPEDLLESKGLESRIFVSKNFKKKSMEIIEKIWDVNKIRLIARKEILERISAGGILHM
FT                   IR"
FT   gene            30202..30864
FT                   /gene="soj"
FT                   /locus_tag="SSO0034"
FT   CDS_pept        30202..30864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="SSO0034"
FT                   /product="SOJ protein (soj)"
FT                   /note="Regulation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40399"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B3"
FT                   /protein_id="AAK40399.1"
FT                   /translation="MIVTVINQKGGVGKTTTSVNLSYYLSKEKKTGLLDLDPEGGATIS
FT                   YGMKRELKELPLGEKSVNIFNVEVFPAHIGLLKLELNGDVEEISNKIKEIGKQFDFLVI
FT                   DTPPNLGTLAISAMLVADRIVSPVTPQPLALEAIKNLDSRLKSIGKNAYSFTNFSKKVV
FT                   KLDNLSSVKFTEITIPPSRLFIEASRLGVPALRYEEVRIKKPKLANYYQQLAKVISE"
FT   gene            30861..31190
FT                   /locus_tag="SSO0035"
FT   CDS_pept        30861..31190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0035"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Homologous to MTH1457"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40400"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B2"
FT                   /protein_id="AAK40400.1"
FT                   /translation="MSELDFLLKKKRKSEDEEKIINNNENAKKEEITNEEEKIKNDMLK
FT                   YIEKDPKIGVWSYPAFLVLQYLYHTVPGFKMSRTAKEALEKGLKEMYPTLFTIAEKIAK
FT                   ERFKE"
FT   gene            31267..31734
FT                   /locus_tag="SSO0036"
FT   CDS_pept        31267..31734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0036"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40401"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B1"
FT                   /protein_id="AAK40401.1"
FT                   /translation="MIRMDICVKARNDEEATRALQLNYNCVVYSRPLNNILTFIPDQYI
FT                   SDININNERTVVITDSLELINTLKSRNLKIAYRVNKPYMNILIYDYFVLEFIPKNIRDL
FT                   RFYKGKVYIDNIDNLDIYSKLENLKISGVFTNNLDFIVNLKKLGLYKNRII"
FT   gene            32275..34002
FT                   /locus_tag="SSO0037"
FT   CDS_pept        32275..34002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0037"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40402"
FT                   /db_xref="GOA:Q981B0"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q981B0"
FT                   /protein_id="AAK40402.1"
FT                   /translation="MKKGISSILGAIILIQIVVSSVGLILYLTSLNAKMSNIAYSQIYE
FT                   ELQNAPISVIPTYQGPMIISTSSSHMAITYIIYPNGKIIHTNIPLTQNGVYINFDNNPW
FT                   SVIVLNDGNWYNISANDRLVSPNTTALGGIRLYEPYSYTINQGKINLSYLATPPIYGKN
FT                   LDPANWNLLSESPASYTPYGIQNSLILIPENGSIPIIANLSSGLQYFDIAIPYNNRVFV
FT                   GVAAGATPGIWYTTNSPQFSYYLPLEFSVSYQADYIVPVYNATFEYSTWIDGARYYVTL
FT                   SYVTYNMIYFMKQNNYTIKTRNGEIQLLSYKFIGYLMASKIDYGSVEFGIWSFPTGTSI
FT                   TDIPIPGYNNYTLYSGVMINASYTAFNESGVVPPSALILPLQGGNGYLNSTNITEESLV
FT                   NVEMMISGGNLDYNSNGTPIPNVMNYTYFWYFINPQIKKSNSVNLLISITPNSQVTVAL
FT                   RDSGGFIYPDYSYIAYSLAEKYSVTHNYVGLNGGPPLTVIIDDVSGTLINGSNQGYLPL
FT                   GYPVVNANYKYTIIPGDYVQYTETATYQYFKTINLQINYNLPFIIIVPEDVYYPYFAV"
FT   gene            34256..34702
FT                   /locus_tag="SSO0038"
FT   CDS_pept        34256..34702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0038"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40403"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A9"
FT                   /protein_id="AAK40403.1"
FT                   /translation="MISKFSFQRLKKGALKYLVLESLNERPMRTYEIIKTIEKKFEGSY
FT                   RPSTGSVYPVLKSLVEKNLVEVKVENNKKIYIITEKGKNELQEIKNKSLKLLGDNTKFS
FT                   RQILQELLQIAFYLYDNRSKIDENNIQKIIEYLRNCRNQLKNVL"
FT   gene            complement(34685..35257)
FT                   /locus_tag="SSO0039"
FT   CDS_pept        complement(34685..35257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0039"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40404"
FT                   /db_xref="GOA:Q981A8"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A8"
FT                   /protein_id="AAK40404.1"
FT                   /translation="MQDESEREYVLKRLKEAVDIFVSNERAYLLIPEVRTNIGYAVSNA
FT                   ADANDVAAIPGRLTTAFKKVIYCMLPAFGASDHVARVILTVMKHDRNIRSAINLKYYRE
FT                   VIEKLPSQDLCIFDRSSEPKEVKYREHSTMNFMVDSCIRKLSKVPNYIVDLGDYGKEPS
FT                   LFILDRDPVTVVNKSLELLKYISQDIL"
FT   gene            35370..35828
FT                   /locus_tag="SSO0040"
FT   CDS_pept        35370..35828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0040"
FT                   /product="First ORF in transposon ISC1078"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40405"
FT                   /db_xref="GOA:Q97TX2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q97TX2"
FT                   /protein_id="AAK40405.1"
FT                   /translation="MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIF
FT                   TVYKWLRKGDLSAKPRKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEF
FT                   GIKYNPRSLSPVLKKLGFKYKKGKRTYVRDDNAVERWVKEQGEKLLKK"
FT   gene            35789..36382
FT                   /locus_tag="SSO0041"
FT   CDS_pept        35789..36382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0041"
FT                   /product="Second ORF in transposon ISC1078"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40406"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q97TW3"
FT                   /protein_id="AAK40406.1"
FT                   /translation="MGEGTRGEAFKKIREGYKVHIFDESYVSYINKGKGWMKVGGGIKV
FT                   NPKRKRFAVVGGITISKEGITFSYSTYKKPSLNSKDIILYLRKVIKDEKTVIVMDNARI
FT                   HGNEVREFLEENGVEFVYLPPYSPDKSPAEGPWAVLKKRLYSKIYTDFETLMWDATRFL
FT                   RSISKRVNDLTYSVKRCGEPWTSILSEVFLPFKV"
FT   gene            complement(36667..37320)
FT                   /locus_tag="SSO0042"
FT   CDS_pept        complement(36667..37320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0042"
FT                   /product="Second ORF in transposon ISC1234"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40407"
FT                   /db_xref="GOA:Q981A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A7"
FT                   /protein_id="AAK40407.1"
FT                   /translation="MGRLYGVRKKLLEISFKLEEKCLPSYLPASAHLVDFMAWLVDSFL
FT                   LDLPPGKRSVETFREKAELERREGNLERAGKLLSLGRTKRRFEGRWTKKRGVSHYGLKA
FT                   VAVISVSLFMRSITVKPANFSDKRFKSPLKGIKIADRGFSPSPTQLIAREKPFTTLRAH
FT                   VEFFGTYLNAFWRPYGTTTWRNDVFLHVLGVIYNIKIFLAIQRRTPPERRAVQL"
FT   gene            complement(37479..37811)
FT                   /locus_tag="SSO0043"
FT   CDS_pept        complement(37479..37811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0043"
FT                   /product="First ORF in transposon ISC1234"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40408"
FT                   /db_xref="GOA:Q981A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A6"
FT                   /protein_id="AAK40408.1"
FT                   /translation="MGVEGSTMARTLRHIPNLMYYPLPPIEDMPWREKWLTEIKPVLDA
FT                   MDLERVLGEGALVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTTVSRNL
FT                   LYFIIH"
FT   gene            38481..40262
FT                   /gene="doxB"
FT                   /locus_tag="SSO0044"
FT   CDS_pept        38481..40262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="doxB"
FT                   /locus_tag="SSO0044"
FT                   /product="Heme bearing subunit I of the terminal oxidase
FT                   (doxB)"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40409"
FT                   /db_xref="GOA:Q981A5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A5"
FT                   /protein_id="AAK40409.1"
FT                   /translation="MSDMGLKDVIVDIFQLDKDWTTRIVMGMLVLGVIWGLLGVIDSLM
FT                   VRLVEASWGLSAVLPLTPQEYFAGITLHAERDLFGFAQQVIYAIFIYFTIKLLNIEPRA
FT                   KWMLNLGFIAVNISMMFMEGPILIIPAAGFDNYFSATIWYYLSPLGIPGYSQYVVSPLF
FT                   FWGWILLDAFTYIGGFWIVYHYYLASKNMKEKLPVPLVYFLMVTLMFMIGYSGVTAADV
FT                   WDVLAFYHIVGLDPIANQIAFWIFGHAIVYMAWVPAVGALYLLIPMLANKPLYSDRMGR
FT                   ISALLYLIFSNNVPIHHLYMVNLPIALKLLQEVLTYSVVIPSMMTFFNLWATAKGADVK
FT                   WNIITAWTVTSFAGAIAAGVTGISNATISFDAIVHNTDWVVGHFHAMILFSIVPAAWAV
FT                   LYIMITMMSGRIWFSKGMAWLHYIGYMIGTTFLIVGFELIGFYGVVRRAEIYPRVPGLI
FT                   DAEVIATVGAIIADLATLVWFLNLVLTLVKGRLVRLEGLSLPQVAGAVAMSLEWPSSIS
FT                   FTSPVLKFIKTHNTSKKGLASTIVLAIVGAILIVVSAVPLAFAGDAYTPQTWIWITILT
FT                   IGIIFSAIGSLKGMKSI"
FT   gene            40264..41331
FT                   /gene="doxC"
FT                   /locus_tag="SSO0045"
FT   CDS_pept        40264..41331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="doxC"
FT                   /locus_tag="SSO0045"
FT                   /product="Terminal oxidase, subunit (doxC)"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40410"
FT                   /db_xref="GOA:Q981A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A4"
FT                   /protein_id="AAK40410.1"
FT                   /translation="MIKVDRKEKFELYWVIYVIVLFAIVIGATAPAVYTVGGDLSSVQA
FT                   GIIIPNTAVNEGKVIQGTLYAYQYYFAIKENGGSITSNELGSPYYYNIMVAHPGQYINL
FT                   TMYAAPHMATANFYYPDYATHVDDVQIVPGLVQYAPVVVPNISGAFAFLNGEYNGPWFS
FT                   YQEGLLLVLPYQGYMSQTDVSKYITQTHLAQTSTLVGDPYNPPIVVYNTTMTPTVDLVA
FT                   DQYAIFNNSVPGPTAVVLANSNVTVNMYIPTPNSDHNFLYNYSTSGTPYPVRNVYIGIY
FT                   AVWWNGSITLVKQVPIPYDKTITFTFTANAPAYLYGLITPVYYNYNFMNMSNTLTGEQY
FT                   GYVMGLWGTILVEQG"
FT   gene            41328..41528
FT                   /gene="doxE"
FT                   /locus_tag="SSO5098"
FT   CDS_pept        41328..41528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="doxE"
FT                   /locus_tag="SSO5098"
FT                   /product="Terminal oxidase, small hydrophobic subunit
FT                   (doxE)"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40411"
FT                   /db_xref="GOA:Q981A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A3"
FT                   /protein_id="AAK40411.1"
FT                   /translation="MMNMVSFFKLLGIGYILAIALLVWELTEETLHAAATSYILPFTIG
FT                   AFIGFISFFLFVYFAPEEEHK"
FT   gene            complement(41790..42533)
FT                   /locus_tag="SSO0046"
FT   CDS_pept        complement(41790..42533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0046"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40412"
FT                   /db_xref="GOA:Q981A2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A2"
FT                   /protein_id="AAK40412.1"
FT                   /translation="MLVDSHAHIDVKEFDMDREFVINECQILIVNAGVDFQSNLHTLEL
FT                   AKKYKNIIPAIGFHPEFVKDKVNEIDKCLELTRYGKIISEVGLDYFWIKDEDLRKKQIE
FT                   VLEKFLQIAEKENKPVIIHIRGGMKDFLEIINSYRIRFVIHSFEGSVKIANKVIEYGGL
FT                   ISIPPIIVRDKVRQKVAKEIPLDFILTETDSPFMGPEKMSRNKPCNVKIVVKQISLLKR
FT                   IEEIEIEEKIYKNFVSLFTSSLTTS"
FT   gene            42978..43367
FT                   /locus_tag="SSO0048"
FT   CDS_pept        42978..43367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0048"
FT                   /product="Transcriptional regulator, putative"
FT                   /note="Similarity with SSO1108 transcriptional regulator
FT                   Lrs14; Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40413"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A1"
FT                   /protein_id="AAK40413.1"
FT                   /translation="MSETQLSEGTRIKLPSGKDAGLVDILSFCYGLSETDVTVLLALMK
FT                   GDARGTEELESDLKLSKASINRSLNKLLEMGLVMRIKEPGNKAGRPRYLYKARDYAELK
FT                   GKMLSDIKDCADKMAQLVEKEFKPL"
FT   gene            43434..43829
FT                   /locus_tag="SSO0049"
FT   CDS_pept        43434..43829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0049"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40414"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q981A0"
FT                   /protein_id="AAK40414.1"
FT                   /translation="MFWHRRRGLKWLILYVLSKGPMTGAQIMDEIEKTSHGMWRPSPGS
FT                   IYPALDALESEGLIRISRVDGWKKYYELTEEGRKAIGAMSEEDKIKEAIEQLEFSARYI
FT                   VENLEKLNDEDKRKVKNILDELSKVMR"
FT   gene            43863..44612
FT                   /gene="paaF-1"
FT                   /locus_tag="SSO0050"
FT   CDS_pept        43863..44612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaF-1"
FT                   /locus_tag="SSO0050"
FT                   /product="Enoyl CoA hydratase (paaF-1)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40415"
FT                   /db_xref="GOA:Q980Z9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z9"
FT                   /protein_id="AAK40415.1"
FT                   /translation="MPIEVYEYDKYILLKFYQADNRYNLFNVEFMTQMIDVLSAINENK
FT                   GKRFLVIRGEDNFGAGADIRELIKASNDSEFAVTFFTYMREVFHKMLDLNKIVISQVKK
FT                   IAYGASMELLLFSDYVISEKKAMFATPGVKIGVFPPVLSSVGHFILGYNNVKRIAMKGD
FT                   VIDTNEAKSIGLVHIIDDDLDKATLDLIEELSTLAPSATLYIKRNMLRTFRNYIDKAFD
FT                   DLIVQIQSEEAREGLLSFLNKTNPPWI"
FT   gene            complement(44609..45619)
FT                   /locus_tag="SSO0051"
FT   CDS_pept        complement(44609..45619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0051"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40416"
FT                   /db_xref="GOA:Q7LY08"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY08"
FT                   /protein_id="AAK40416.1"
FT                   /translation="MRTMNRILLTVSALVKDNLRNRFVIFWIIVFPIIITLLFGLVFGG
FT                   FSSYFHVTVAVEGNYGLAKYLNSTEIFQGVTNVSLKYAAEHDYIYVISNGSSFTIYTSK
FT                   QNQEFVPVLESVIEQYYQKVNNTYDFTVLQISNYTYYNYLISGIIGIISLSNGILSTIG
FT                   VSASYFRDRIIERLATSPLKSYEWVISLIIYVIIITLISTTAVIILGILFGFIPIIGIE
FT                   FLGFLVIATLLFGGLGAIIYGLTPKDKIFLSEIVANVLVFPLMFLSNAFFPPNVYPPIV
FT                   RIFVEYQPLSVIITIIRDLIVYGISPNPILVSIVFLFTIVFLYAGGRLLRLREIS"
FT   gene            complement(45603..46343)
FT                   /locus_tag="SSO0053"
FT   CDS_pept        complement(45603..46343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0053"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40417"
FT                   /db_xref="GOA:Q7LY07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY07"
FT                   /protein_id="AAK40417.1"
FT                   /translation="MTNVIVEVKDLYKEYKDKEVLRGISFTVYKGEIFSLLGPNGAGKT
FT                   TTVKILSCVLKPTRGEVKVIGYKVPNECGKIRERIGVMPQDYQGFLDLTVRENIEYFVK
FT                   LYNGKETQVDELISLLDLEKVKNQKLRYLSGGYVRRVGIASAFAGSQEILFLDEPTVGL
FT                   DPKARRGFWEIIKMMKNKGVTIFLTTHYLDEAQKLSDRVAILYGGKLIKVSTADEIMAE
FT                   FKATNLEDAYLELIKSLEDSENNE"
FT   gene            46297..47328
FT                   /gene="hypE"
FT                   /locus_tag="SSO0052"
FT   CDS_pept        46297..47328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="SSO0052"
FT                   /product="Hydrogenase expression/formation protein (hypE)"
FT                   /note="Translation, Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40418"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY06"
FT                   /protein_id="AAK40418.1"
FT                   /translation="MYSLYKSLTSTITLVIYANYFIIVNVNFGKVPINKFIYNLPIGDC
FT                   LTCPSIGEDAAVLEAKDKYLIVHSDPITEAKSDSGFLSIAVACNDINMKGAQCRWVNSI
FT                   ILLSDISHLNATISAISEACNLIGCKVVGGHTEVSDKVKQDIIITTAIGVSNKFLSYKN
FT                   VKEGMKVVLVGSPGIEGTWILAKDYDQLLLEKGISREIIEKAKEFKKDIVVQPKALSIL
FT                   DYVVAMHDATEGGIMQAMLEVAKASGYTVSINLDKIVLRRETKIITKALNIDPLRLISS
FT                   GSFIAVSNTPEKILERISEAYIIGEIKRGDPVLEIKGVGTFNQDFEEELVKFESNYLGW
FT                   GKG"
FT   gene            47249..47788
FT                   /locus_tag="SSO0054"
FT   CDS_pept        47249..47788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0054"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40419"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY05"
FT                   /protein_id="AAK40419.1"
FT                   /translation="MLEHLIKISRRNWSSLKVIILAGGRGKRITLFKPFLVVCGKPLIS
FT                   WAFDAVNKLSDKVYLGINQSHPLFTIFKHSIFKIFPTPDISYENDVKYVVESLGPPILV
FT                   LPVDIAFINNNIINNLIERCAVDMCTLKSYGSYLGVTYWTGLNFSNYTDIEVKEKLYNI
FT                   NTWEDYIKANKECNIL"
FT   gene            47785..48516
FT                   /locus_tag="SSO0055"
FT   CDS_pept        47785..48516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40420"
FT                   /db_xref="GOA:Q7LY04"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY04"
FT                   /protein_id="AAK40420.1"
FT                   /translation="MKRIIILSPFRGLFRSLLYFLLGLIMALISAGYFSQLFSIVGINR
FT                   DIAIIISITISFLSLFSSPFNLVLTEVKKEAIAIEEDVVFFFGFPIFIPRISRQNMNTL
FT                   IAVNLGGALIPLGVSLFLMYELQAYIVYFIINIIVVIIVSKLFSRVIRGVGVIMHPIIP
FT                   SIFSVISSYVLFYKLHILIPLSAYIGSVLGTLIGADLLNLRRIINEARPQVISIGGMGT
FT                   FDGIFVSGIISVFISELLVII"
FT   gene            48739..48814
FT                   /locus_tag="SSOt01"
FT                   /note="tRNA-Pro"
FT   tRNA            48739..48814
FT                   /locus_tag="SSOt01"
FT                   /product="tRNA-Pro"
FT   gene            48833..49279
FT                   /locus_tag="SSO0057"
FT   CDS_pept        48833..49279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0057"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY03"
FT                   /protein_id="AAK40421.1"
FT                   /translation="MTKDIVKKLVINSMKRVKIGIFYLENDMIEEARKEIQKSWRQIMS
FT                   ALLILNLYNAEEKQFTHYNVPRSKIFSVSKSLEDKGYRDLIKISSMYFSSLQELPKSEI
FT                   KILITVFIKEEIEHIKEWFKAIWDEKLDDELNEIKKEKQWLIQS"
FT   gene            49344..49430
FT                   /locus_tag="SSOt02"
FT                   /note="tRNA-Asn"
FT   tRNA            49344..49430
FT                   /locus_tag="SSOt02"
FT                   /product="tRNA-Asn"
FT                   /note="1 intron"
FT   gene            complement(49748..49832)
FT                   /locus_tag="SSOt03"
FT                   /note="tRNA-Ser"
FT   tRNA            complement(49748..49832)
FT                   /locus_tag="SSOt03"
FT                   /product="tRNA-Ser"
FT   gene            complement(49815..50180)
FT                   /locus_tag="SSOr01"
FT                   /note="7SRNA"
FT   rRNA            complement(49815..50180)
FT                   /locus_tag="SSOr01"
FT                   /product="7S ribosomal RNA"
FT   gene            complement(50238..51206)
FT                   /gene="gnptA"
FT                   /locus_tag="SSO0060"
FT   CDS_pept        complement(50238..51206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnptA"
FT                   /locus_tag="SSO0060"
FT                   /product="UDP-N-acetylglucosamine--dolichyl-phosphate
FT                   N-acetylglucosaminephosphotransferase (gnptA)"
FT                   /EC_number="2.7.8.15"
FT                   /note="Cell Envelope, Surface polysaccharides and
FT                   lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40422"
FT                   /db_xref="GOA:P96000"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96000"
FT                   /protein_id="AAK40422.1"
FT                   /translation="MRILAILLPILISFFISYITTVWVIRQAKKSRFVGKDINKPDKPE
FT                   IPLLGGIGIIAGFIAGSFSLLLTDVRSERVIPAVILSSLLIAFLGLLDDIFNVRQSVRA
FT                   FLPIFASVPLIVYSVGHSIISIPFLGPINFGIFYYIIIIPFALTITSNAFNMLEGLNGL
FT                   GVGMGIIMLSALAYIGLTHTGPTYQAGLIALSAIFSLSAFLIFNKYPAKIFPGNVGTYF
FT                   IGALIGAIGIAGFMYTALAILYIPYVVEFILKLRTNFKGVSFGKVDSSGRLYWDEKPHS
FT                   LTHIVMKMGRFKEYQVVIILWGMEAIFAVIAVILQTTTIVI"
FT   gene            complement(51207..52205)
FT                   /gene="gdS-1"
FT                   /locus_tag="SSO0061"
FT   CDS_pept        complement(51207..52205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdS-1"
FT                   /locus_tag="SSO0061"
FT                   /product="Geranylgeranyl pyrophosphate synthetase (gdS-1)"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.29"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40423"
FT                   /db_xref="GOA:P95999"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95999"
FT                   /protein_id="AAK40423.1"
FT                   /translation="MSSDDLSLYFNEIVNNVNFRIKNFVKSNFKTLEEASFHLFTAGGK
FT                   RLRPLVLVSSSDLIGGDRERAYKAAAAVEILHNFTLVHDDIMDNDGLRRGLPTVHVKWG
FT                   EPMAILAGDYLHAKAFEALNEALKGLDGNTFYKAFSIFITSIEIISEGQAMDMSFENRL
FT                   DVTEEEYIQMIKGKTAMLFSCSAALGGIINKANDDVVKKLTEYGLNLGISFQIVDDILG
FT                   IIGDEKELGKPIYSDIREGKKTILVIKTLSEATEDEKKILVSTLGNKEAKKEDLERASE
FT                   IIRKHSLQYAYDLAKKYSDLAIENLREIPVSNKTAEKALKYLAQFTIQRRK"
FT   gene            complement(52207..53313)
FT                   /locus_tag="SSO0063"
FT   CDS_pept        complement(52207..53313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0063"
FT                   /product="FMN-dependent dehydrogenase, conserved
FT                   hypothetical"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40424"
FT                   /db_xref="GOA:P95997"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95997"
FT                   /protein_id="AAK40424.1"
FT                   /translation="MPDIVNRKVEHVEIAAFENVDGLSSSTFLNDVILVHQGFPGISFS
FT                   EINTKTKFFRKEISAPIMVTGMTGGRNELGRINRIIAEVAEKFGIPMGVGSQRVAIEKA
FT                   EARESFTIVRKVAPTIPIIANLGMPQLVKGYGLKEFQDAIQMIEADAIAVHLNPAQEVF
FT                   QPEGEPEYQIYALERLRDISKELSVPIIVKESGNGISMETAKLLYSYGIKNFDTSGQGG
FT                   TNWIAIEMIRDIRRGNWKAESAKNFLDWGVPTAASIIEVRYSIPDAFLVGSGGIRSGLD
FT                   AAKAIALGADIAGMALPVLKSAIEGKESLEQFFRKIIFELKATMMLTGSKNVEALKRSS
FT                   IVILGKLKEWAEYRGINLSIYEKVRKRE"
FT   gene            complement(53306..54031)
FT                   /locus_tag="SSO0064"
FT   CDS_pept        complement(53306..54031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0064"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40425"
FT                   /db_xref="GOA:Q7LY02"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY02"
FT                   /protein_id="AAK40425.1"
FT                   /translation="MEMDMGSELGYDYRVLKLGGSLITCKDVPRCVKLEVLRRVSEEIR
FT                   KFVNENPDKKIILLHGGGSFGHYEASIFDDNRIVRTSEAMQELNYIVAKHLLKSGIKAI
FT                   SVPGKFYTFDAVLSALEKDLVPLIYGDVKFDGSIISADDMSIDIAKRLNARLLFAIDKA
FT                   GIIGRGGGVISELRGIDEVSILMQTNYYDITGGILSKIKKIFENNLNALIFDGSKTGNI
FT                   YLALRGYNIGTLVRGNPNA"
FT   gene            complement(53977..54699)
FT                   /locus_tag="SSO0065"
FT   CDS_pept        complement(53977..54699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0065"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY01"
FT                   /protein_id="AAK40426.1"
FT                   /translation="MQLLVILRDLKIQLWVILQRGLEVKVPFLGIPLKGVNNPILVLDG
FT                   IIEPLNIFVNTEAIRQFIMQFNEAVGFECIKEEVYWDSSIPFSSYYIYITDKLANDAIR
FT                   RCGIPISEDERFEILHLVDEAIFPPNFLVKALRTSLQLNSPILFRDGEEPITVQLEPIR
FT                   IKIISSYPFDNNPKYLDNSLVHLAGIIPVEYIESKSRNLIEVENGLWSAIYSLPYLQIN
FT                   NWKWIWDLNWVTIIEFSN"
FT   gene            complement(54626..55480)
FT                   /locus_tag="SSO0066"
FT   CDS_pept        complement(54626..55480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0066"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40427"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95994"
FT                   /protein_id="AAK40427.1"
FT                   /translation="MRRLPAVAGSFYESDPKKLKMQIEWSFRHNIGPRDIPKQSYEKKK
FT                   RDNLFFIVPHAGYIYSGPVAAHSYYYLASEGKPDVVIILGPNHTGLGSYVSAWPKGEWE
FT                   TPLGSVKVDEEVLMQLVMESEVIDLEEKSHLYEHSIEVQLPFLQYFFDDNFKIVPIVIM
FT                   MQTPEIAEFLADAIYKVIQKYSDKDIVVLASSDMNHYDPHEITMKKDEEAIEKIQQLDY
FT                   RGLYEVVEGKDVTLCGYGPIMVSLILAKKLGKKAYILKHATSGDTSGPKDSVVGYLAAR
FT                   FGS"
FT   gene            complement(55477..56172)
FT                   /gene="rps2AB"
FT                   /locus_tag="SSO0067"
FT   CDS_pept        complement(55477..56172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps2AB"
FT                   /locus_tag="SSO0067"
FT                   /product="SSU ribosomal protein S2AB (rps2AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40428"
FT                   /db_xref="GOA:P95993"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95993"
FT                   /protein_id="AAK40428.1"
FT                   /translation="MKVTNLSEKEERGGELTEAEKEELRKSEKGAIIELLVPVDTYLSA
FT                   GVHIGTHSCTKYMESFVYRVRAEGLYVLDVRKIDERLRIAAKFLSRYDPQDIIVVASRP
FT                   YAYRPVQKFAEVVGSRALVGRIIPGTFTNPYLSTYIEPKVLLVSDPRTDTQAIKEAAKV
FT                   GIPIVAFADTDAKIDYIDLIIPANNKGRKSLALLYWALARQILRERRVIPPDGDLAVPV
FT                   SEFEMRLVQ"
FT   gene            complement(56169..56369)
FT                   /gene="rpoN"
FT                   /locus_tag="SSO5140"
FT   CDS_pept        complement(56169..56369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SSO5140"
FT                   /product="DNA-directed RNA polymerase, subunit N (rpoN)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40429"
FT                   /db_xref="GOA:Q980Z8"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Z8"
FT                   /protein_id="AAK40429.1"
FT                   /translation="MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCC
FT                   RRMLLSHVDIINEVIHYTRPI"
FT   gene            complement(56376..56798)
FT                   /gene="rps9AB"
FT                   /locus_tag="SSO0068"
FT   CDS_pept        complement(56376..56798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps9AB"
FT                   /locus_tag="SSO0068"
FT                   /product="SSU ribosomal protein S9AB (rps9AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40430"
FT                   /db_xref="GOA:P95992"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95992"
FT                   /protein_id="AAK40430.1"
FT                   /translation="MEWMSEEQKLVISSARRKTARATCYIYAGKGRVFVNNVPIELIPI
FT                   EMVRLKIMEPLLLAGNDIRSKIDAKIITYGGGIMGQADAARMALARALVKFTGSKELEK
FT                   IYRAYDRTMLAGDPRQTESEKWMRYSARRWRQKSYR"
FT   gene            complement(56786..57235)
FT                   /gene="rpl13AB"
FT                   /locus_tag="SSO0069"
FT   CDS_pept        complement(56786..57235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl13AB"
FT                   /locus_tag="SSO0069"
FT                   /product="LSU ribosomal protein L13AB (rpl13AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40431"
FT                   /db_xref="GOA:P95991"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95991"
FT                   /protein_id="AAK40431.1"
FT                   /translation="MSTQVQEQVVIINAEGQILGRMASNVVRLLKEGKKVIIVNGEKAV
FT                   ISGEKNRVIESYKLLLTVKTLFNPYRNGIRRPRSPINIVKRTIRGMLPKSSKGRRMLKN
FT                   VKIYVGVPKEFEGRQFIKFPDSDVSRLKGKYVTVEVVSKELGWSG"
FT   gene            complement(57232..57591)
FT                   /gene="rpl18E"
FT                   /locus_tag="SSO0070"
FT   CDS_pept        complement(57232..57591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl18E"
FT                   /locus_tag="SSO0070"
FT                   /product="LSU ribosomal protein L18E (rpl18E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40432"
FT                   /db_xref="GOA:P95990"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95990"
FT                   /protein_id="AAK40432.1"
FT                   /translation="MKVTGSTNITVRKLIRNLEKSKKPLWRKVAEELSIPSRKRPYINL
FT                   YKINEHTKPNDIVVVPGKVLGIGKLDHEVTVIALDFSKSAIEKIRASGGQAMSIYKALE
FT                   TFKDFKGRSVRLMKQ"
FT   gene            complement(57588..58385)
FT                   /gene="rpoD"
FT                   /locus_tag="SSO0071"
FT   CDS_pept        complement(57588..58385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="SSO0071"
FT                   /product="DNA-directed RNA polymerase, subunit D (rpoD)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40433"
FT                   /db_xref="GOA:P95989"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR022842"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="PDB:2PA8"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95989"
FT                   /protein_id="AAK40433.1"
FT                   /translation="MSINLLHKDDTRIDLVFEGYPLEFVNAIRRASMLYVPIMAVDDVY
FT                   FIENNSPLYDEILAHRLALIPFMSEEALDTYRWPEECIECTENCEKCYTKIYIEAEAPN
FT                   EPRMIYSKDIKSEDPSVVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLSV
FT                   VRYYPKVEILANCEKAVNVCPEGVFELKDGKLSVKNELSCTLCEECLRYCNGSIRISFV
FT                   EDKYILEIESVGSLKPERILLEAGKSIIRKIEELEKKLVEVVK"
FT   gene            complement(58397..58795)
FT                   /gene="rps11AB"
FT                   /locus_tag="SSO0072"
FT   CDS_pept        complement(58397..58795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps11AB"
FT                   /locus_tag="SSO0072"
FT                   /product="SSU ribosomal protein S11AB (rps11AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40434"
FT                   /db_xref="GOA:P95988"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95988"
FT                   /protein_id="AAK40434.1"
FT                   /translation="MSSRREIRWGIAHIYASQNNTLLTISDLTGAEIISRASGGMVVKA
FT                   DREKSSPYAAMLAANKAASDALEKGIMALHIKVRAPGGYGSKTPGPGAQPAIRALARAG
FT                   FIIGRIEDVTPIPHDTIRRPGGRRGRRV"
FT   gene            complement(58779..59324)
FT                   /gene="rps4AB"
FT                   /locus_tag="SSO0073"
FT   CDS_pept        complement(58779..59324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps4AB"
FT                   /locus_tag="SSO0073"
FT                   /product="SSU ribosomal protein S4AB (rps4AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40435"
FT                   /db_xref="GOA:P95987"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95987"
FT                   /protein_id="AAK40435.1"
FT                   /translation="MGDPKKSRKKWETPGHPWIKERIGYEQELLGKYGLRNKREIWIAQ
FT                   SIIRKFRHQARSLLALPPAERAVREKQLVGKLLKMGLLKKETATVDDILSLTEQDLLER
FT                   RLQTIVYKKGLSNTIYQARQLITHGHIAVNGKRVTSPGYIVNVDEENLIDYYVTSSFKS
FT                   RPPVMSQQEGGEIGVKQA"
FT   gene            complement(59335..59832)
FT                   /gene="rps13AB"
FT                   /locus_tag="SSO0074"
FT   CDS_pept        complement(59335..59832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps13AB"
FT                   /locus_tag="SSO0074"
FT                   /product="SSU ribosomal protein S13AB (rps13AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40436"
FT                   /db_xref="GOA:P95986"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95986"
FT                   /protein_id="AAK40436.1"
FT                   /translation="MSQQFKYVVRIFGQDVDGTMKLPYALAMVKGIGYNTAKAIIRKLG
FT                   MDPNARLGELSDAEVKKVESVISDHTIKGLPSWLYNRRKDYESGLDLHLVTSDLIFYVR
FT                   NDIEREKKSRSWRGVRHSLGLKVRGQRTRTTGRTGMTIGVARKKAAQPQSQQSSSQQQK
FT                   SS"
FT   gene            complement(59853..61151)
FT                   /locus_tag="SSO0076"
FT   CDS_pept        complement(59853..61151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0076"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with AF2363, MJ1416, MTH1525. Weakly
FT                   related to hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40437"
FT                   /db_xref="GOA:Q7LY00"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR009186"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LY00"
FT                   /protein_id="AAK40437.1"
FT                   /translation="MALYFALMDLEGIVRRLYPDIEKAKTKLIEEIRFYKSDRYNAEEI
FT                   SNVILTEVINSMKADDKFGFPKTNIRAGEAGLGSRGIGDNLIHTKLFELAGKQIEEYDD
FT                   AGIRENVVVSIDGIHSRLSYFPFLAGFYATRATLRDIMVKGAYPLGLIVDIHLSDDSDI
FT                   GMLIDFEAGVTTISKALDIPILAGSTLRIGGDLVLGDRISGAVGSIGILKSKDFLRKRV
FT                   KKGLKILMTEGNGGGTIATTAIYNGMPDVISETLNIKDLLTCIIVRDYLSSDVYSMTDV
FT                   TNGGIRADALEVSKITNLSFVIDEEKFLSLINPKVRKMLNEINIDPFGISIDSILIFTD
FT                   NPDLVKKRLAQYNIRSEIVGYIDDFRQYPIITYDGKELKPQFRESPYTPIKKYFGNYSP
FT                   YSIEYISNRLDYAIAEAKTKMDNVLKNLKTSFT"
FT   gene            61275..61688
FT                   /locus_tag="SSO0077"
FT   CDS_pept        61275..61688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0077"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40438"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ9"
FT                   /protein_id="AAK40438.1"
FT                   /translation="MFIMKLRDNNSFFSSSGVINMGQKLPPTNKPSFEKLYDCETESCI
FT                   QKLVDDYIYNLITDNNNINNYTTFKLFKDEDDNEHKFVLNEKVMLNSYLFIKVLLRRIL
FT                   ETDLDFEYVVEDLEKKLGNTHPVVLFLKQFKDD"
FT   gene            61719..62819
FT                   /gene="tyrS"
FT                   /locus_tag="SSO0078"
FT   CDS_pept        61719..62819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SSO0078"
FT                   /product="Tyrosyl-tRNA synthetase (tyrS)"
FT                   /EC_number="6.1.1.1"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40439"
FT                   /db_xref="GOA:P95982"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023678"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95982"
FT                   /protein_id="AAK40439.1"
FT                   /translation="MGKLIMSIDQRLQLIMRNTAEVITIDELRKKLESDEKLKGYIGFE
FT                   PSGLFHIGWLIWTQKVKDLVEAGINMTLLRAAWHAWINDKLGGDMNLIKMAADYAVEVI
FT                   KNYGVDVGKLNIVDADDIVKEKDYWALVIKVAKNASLARIKRALTIMGRRAEEAEIDAS
FT                   KLIYPAMQVSDIFYLDLDIALGGTDQRKAHMLARDVAEKMGKKKIVSIHTPLLVGLQGG
FT                   QRMNITEGMEEDDIQAEIKMSKSKPESAIFVNDSREDVERKIMGAYCPKGVAENNPILQ
FT                   ILKYIIFPRYNFVKIERDIKYGGDVEFKDYEELERTYIEGKIHPMDLKKTTARKLNEIL
FT                   EPIRKSLEKKPEFEEMIQKISKSVTR"
FT   gene            62827..64047
FT                   /gene="dnaG"
FT                   /locus_tag="SSO0079"
FT   CDS_pept        62827..64047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="SSO0079"
FT                   /product="Bacterial-like DNA primase (dnaG)"
FT                   /EC_number="2.7.7.-"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40440"
FT                   /db_xref="GOA:P95980"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95980"
FT                   /protein_id="AAK40440.1"
FT                   /translation="MSFQMKYDIRLRFEVEGIVEKTDVIGAIFGQTENLFGDEFDLREL
FT                   QDKGRLGRIIVEVKTKGGKSEGEIIIPSNLDRIETALIAAMVESVDKVGPYNSKFELIE
FT                   IEDIRAEKLKKIIERAKGILSSWSKEKSLDIKEVINEISSAVKVGEITEYGPERLPAGP
FT                   DVDKDPNLIIVEGRADVINLLRYGYKNVIAVEGATSRIPETLINLSKMKKTVIAFLDGD
FT                   HGGDLILKELLSNNVKIDFVARAPIGREVEELTGKEIAKALSNMMPLTQYLKKVQEAEQ
FT                   AIAKNVIAKEEKPIQSETTQQVVQITLPQNILEEIKKLPGTLEGVLYDNNWNLIEKVQV
FT                   RDIIPKLEAYEDNKVAYIIFDGVITQRLLDLASQKNIKMIIGARIGGINKRPQNVDILT
FT                   FTDIISS"
FT   gene            complement(64034..66328)
FT                   /gene="dpo3"
FT                   /locus_tag="SSO0081"
FT   CDS_pept        complement(64034..66328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpo3"
FT                   /locus_tag="SSO0081"
FT                   /product="DNA polymerase III (DNA polymerase B3) (pfu
FT                   polymerase). (dpo3)"
FT                   /EC_number="2.7.7.7"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40441"
FT                   /db_xref="GOA:P95979"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95979"
FT                   /protein_id="AAK40441.1"
FT                   /translation="MIKDFFILDFSYEIKGNTPLVYIWSVDDEGNSSVVIDNNFRPYFY
FT                   IIYEGNENEIIENIKKNCEALQITKVKRKYLGNIVDALLIQTSTPTQIKKCREKISELN
FT                   NIKGIFDADIRYTMRYSLDFDLRPFTWFRAEVNEVKFDGFRTKKAYILDKILSHYEGNM
FT                   PELRTIGVDFQIYSKYGSLNPRKDPIVVMSLWSKEGPMQFSLDEGIDDLKIIRRFVDYI
FT                   LNYDPDIIFVYDSDLLPWKYITERASSLGVKIDIGRKIGSEVSVGTYGHYSISGRLNVD
FT                   LTGLLVNERSLGHVDLIDVSNYLGISPSRYSFKWYEISRYWDNEKNRRIIREYSIENAR
FT                   SIYLLGNYLLSTYSELVKIVGLPLDKLSVASWGNRIETSLIRTATKSGELIPIRMDNPN
FT                   RPSKIKKNIIIQPKVGIYTDVYVLDISSVYSLVIRKFNIAPDTLVKEQCDDCYSSPISN
FT                   YKFKREPSGLYKTFLDELSNVRDSNKIKVIEELISSFNDYVHWVNARWYSREIASAFDE
FT                   FSNEIIRFIIDLIKSSGLDVILANDLLIFVTGGSRDKVNELITKINSLYNLDVKVKIFY
FT                   KSLLVLDNNRYAGLSEGDKIDIARKGEEDMNLCELARNIKRKIIEEILISKDVKKAIKL
FT                   VKSTVIKLRRGEFDNEELITWAKIERDLNEYNNQLPFVTAARKAIQSGYLISKDSKIGY
FT                   VIVKGLGPLNDRAEPFFLVKEKNRIDIEYYVDQIFRETLKLLKPLGVNEESLKKTNITD
FT                   ILDLFGASKKK"
FT   gene            complement(66380..66835)
FT                   /locus_tag="SSO0082"
FT   CDS_pept        complement(66380..66835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0082"
FT                   /product="N-terminal acetyltransferase complex ard1
FT                   subunit"
FT                   /EC_number="2.3.1.128"
FT                   /note="Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40442"
FT                   /db_xref="GOA:Q7LXZ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ8"
FT                   /protein_id="AAK40442.1"
FT                   /translation="MVIITDATEADLDQIFQIETESFEDPYPYSLLRAYLFLANKLYLV
FT                   AKQREKVVGYIIGIIQYGYRGHIVSIAVEPIYRKQGIGAKLLNEIEERFKLNGARYSYL
FT                   EVNTNNLSAISFYRANGYLIMYVRKNYYGRDKHAFVMVKNLYYKYLD"
FT   gene            66854..67888
FT                   /gene="pelA"
FT                   /locus_tag="SSO0083"
FT   CDS_pept        66854..67888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pelA"
FT                   /locus_tag="SSO0083"
FT                   /product="Cell division protein pelota homolog (pelA)"
FT                   /note="M. jannaschii; Cellular processes, Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40443"
FT                   /db_xref="GOA:P96026"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="PDB:3OBW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96026"
FT                   /protein_id="AAK40443.1"
FT                   /translation="MRILEFDEKRQAVKLHIESEDDLWLLHLILEKDDKVVAKTTRDVG
FT                   LGKESRRIPMTIILKVDYTEFQEFTNRLRIHGIIEDAPERFGIKGAHHTINLDIGDEII
FT                   IIKQQWNKYVLDRLKRQANKRSRIIIALVDFDEYLIAIPFEQGIKILSEKSLRPLNEEE
FT                   GIIEQNALEIATELAEYVKQYDPDAILLAGPGFFKEEVSKKVNAILKNKKIYIDSVSSA
FT                   TRAGLHEVLKRDIIDKIMTDYEIAIGAKKMEKAMELLAKQPELVTYGLEQVKNAIEMGA
FT                   VETVLVIEDLLSSDEQERLTIERMLEDIENKRGEVILVPKESPIYFELKNLTGILAILR
FT                   FRIN"
FT   gene            complement(67859..68911)
FT                   /locus_tag="SSO0084"
FT   CDS_pept        complement(67859..68911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0084"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with MJ0021, PAB0713, PH1164, APE0644,
FT                   AF1217"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40444"
FT                   /db_xref="GOA:Q7LXZ6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ6"
FT                   /protein_id="AAK40444.1"
FT                   /translation="MTIIGNPEIGLYTGKLPKGCELCRLGGKLVLFITGECDDNCYYCP
FT                   VSDDRFGKNKIFANETEVNNSMDVIYEAYRMKALGAGITGGDPILEIGRVIEIIEELKN
FT                   EFGYDFHIHLYTTGRYVNDDIMRELVNAGLDEMRFHPVKELYLNAVKVALKYDIDIGLE
FT                   LPAIPNEKDKIVRLIKWAEENNVKFVNLNELELNSRNYLNLNSKGFHAKHGITGVEGSF
FT                   ETALDVLKKFEDNKKITVHYCSSIYKDLVETRTRFFRIIKYSSKPYEEYTNEATVVRAI
FT                   VKTKGEIPILENFGESTGSDEYSISPSIVGDLLNDYTNLINEIYIVEEHPDSRRLRVGE
FT                   KLIYSKSKNS"
FT   gene            complement(68859..69437)
FT                   /locus_tag="SSO0085"
FT   CDS_pept        complement(68859..69437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0085"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40445"
FT                   /db_xref="InterPro:IPR008304"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ5"
FT                   /protein_id="AAK40445.1"
FT                   /translation="MSELNGVNLSAFYKLEVRNLKNTHIKELVSFDLLLSNGRQIGKCN
FT                   YFKGRDYYTPWLEIDYYPILRNENLEVIFFKVVYNFLSPGGKLFVTYIRDNETRERLYI
FT                   GKHPVETPLGFSLLSAGFTWFKDWYFPEGGNEGFPKLQANKPINSDEGIRQLETIREEI
FT                   KNVNVIRKIDELIDHYRKSRDRTVYWEIT"
FT   gene            complement(69430..69993)
FT                   /locus_tag="SSO0086"
FT   CDS_pept        complement(69430..69993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0086"
FT                   /product="Conserved hypothetical protein"
FT                   /note="APE0213, AF1979, PAB0004, PH0007"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40446"
FT                   /db_xref="GOA:Q7LXZ4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ4"
FT                   /protein_id="AAK40446.1"
FT                   /translation="MEGYVYGSVARGDVNEKSDVDIIVFNPNQIVLDTLNVNHKYLIQA
FT                   TPNSVPKAYLSLDEEETIVISFPLGRLRRNEIEFYSFGGLVDLKGLSKNERVPGVNKKL
FT                   MLIIPTENGHMEIPLEGNEDYASKLLKISLETIMERKRLLARRMERGHTGVFLRYDLGG
FT                   NESIYDAFNKMYKSNKFFKRMVDV"
FT   gene            70054..71214
FT                   /locus_tag="SSO0087"
FT   CDS_pept        70054..71214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0087"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40447"
FT                   /db_xref="GOA:Q7LXZ3"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ3"
FT                   /protein_id="AAK40447.1"
FT                   /translation="MPMTITILYLDIFLISKYIIRFVDQIYLAVALFLSFWLIIYVFRR
FT                   RLEKYNLTVYPFFILWRKKSREYWFPKFSRSKGYRAYEKIALPIGFLLMIAGIVTILYI
FT                   IIEMLTIKPNQTPTIALKPIIPGVTISISQLPYILLAIGVSVAIHEIFHALSATSNNVK
FT                   VKNGGVLLLGIFPGAFVEPDEDDFNKSTSNAKLKIIAAGIVINLVLALIALPLSFELPY
FT                   LPSALSQGIIIEGVLNNTPAANASLHTGDIIYSINGYRLTTLSQLHELLYNYSTITITL
FT                   KHPNGSLSNVSVNIPNHFLGVYVTYYIPDYIAAILMFFTWLFIVNFSLAVFNAAPLIIT
FT                   DGGKLLTELLKRMLGESNGEKISYYLQSLFLLIFIFAIFLSNRPLG"
FT   gene            complement(71195..72679)
FT                   /gene="lysS"
FT                   /locus_tag="SSO0090"
FT   CDS_pept        complement(71195..72679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SSO0090"
FT                   /product="Lysyl-tRNA synthetase (lysS)"
FT                   /EC_number="6.1.1.6"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40448"
FT                   /db_xref="GOA:P95970"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95970"
FT                   /protein_id="AAK40448.1"
FT                   /translation="MLMNWDERRVKIVEELRKNGIEPYPHKYEVTHLIKDIKLIAKSQG
FT                   NKSHEPFMFNISTAGRVANIRRHGKASFVDIFDEGEKLQLYMRVDELKEKYDKFFIYVG
FT                   RGDIIGVKGDLFYTMKGELSLLVKDYQLLSKALIEPPDWSKLSPEFRYAHRYVDFLYND
FT                   NARKAMEIRYTIIREIREFLYSKGFIEVETPIVQPVYGGALAKPFKTHVNYLNEDWYLR
FT                   IALELYLKRYIIGGFNKVFEIGKVFRNEDIDVTHNPEFTLLELYWAYADYNDIMNLTED
FT                   LLKSVVKKVTNSTKIVYGKYEIDFEGPFKRISMYDSLSEILGKDVESMSDNELKELMKK
FT                   YNLTPRGNQYVRGLMIEKLFDKLVTPTLTNPTFITDYPIETTPLCKPHRNKPGLVERFE
FT                   MFIAGMEVANAYTELNDPILQDKLFREEQEMFRRGDEEAHPYDKDFVRALSYGMPPTGG
FT                   LGIGIDRIVMLVTNNYSIKEVIPFPMISSKVILEDD"
FT   gene            complement(72731..72869)
FT                   /locus_tag="SSOt04"
FT                   /note="tRNA-Trp"
FT   tRNA            complement(72731..72869)
FT                   /locus_tag="SSOt04"
FT                   /product="tRNA-Trp"
FT                   /note="1 intron"
FT   gene            complement(73708..74100)
FT                   /gene="rpl7AE"
FT                   /locus_tag="SSO0091"
FT   CDS_pept        complement(73708..74100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl7AE"
FT                   /locus_tag="SSO0091"
FT                   /product="LSU ribosomal protein L7AE (rpl7AE)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40449"
FT                   /db_xref="GOA:P55858"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:3ID5"
FT                   /db_xref="PDB:5GIN"
FT                   /db_xref="PDB:5GIO"
FT                   /db_xref="PDB:5GIP"
FT                   /db_xref="PDB:5JPQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55858"
FT                   /protein_id="AAK40449.1"
FT                   /translation="MNAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKA
FT                   VERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAI
FT                   LEPGEAKDLVDEIIKRVNEIKGKTSS"
FT   gene            complement(74314..76041)
FT                   /gene="gltX"
FT                   /locus_tag="SSO0093"
FT   CDS_pept        complement(74314..76041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SSO0093"
FT                   /product="Glutamyl-tRNA synthetase (gltX)"
FT                   /EC_number="6.1.1.17"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40450"
FT                   /db_xref="GOA:P95968"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95968"
FT                   /protein_id="AAK40450.1"
FT                   /translation="MMELNELRETIYKYALQNAVKHNGKAETGPVMSKIIAERPELRSN
FT                   AREIVKIIKEIIEQVNSLTLEQQLTEIKAKYPELLEEKKHEEKRKVLPPLPNVKGQVVT
FT                   RFAPNPDGPLHLGNARSAILSYEYAKMYNGKFILRFDDTDPKVKRPILDAYDWIKEDLK
FT                   WLGIKWEQELYASERLELYYKYARYLIEKGYAYVDTCDSSIFRKFRDSRGKMKEPECLH
FT                   RSSSPESNLELFEKMLGGKFKEGEAVVRLKTDLSDPDPSQIDWVMLRIIDTAKNPHPRV
FT                   GSKYWVWPTYNFASIIDDHELGITHVLRAKEHMSNTEKQRYISEYMGWEFPEVLQFGRL
FT                   RLEGFMMSKSKIRGMLEKGTNRDDPRLPTLAGLRRRGILPDTIKDVIIDVGVKVTDATI
FT                   SFENIAAINRKKLDPVAKRIMFVKDAEEFSVELPESLNAKIPLIPSKQEMNRTIIVNPG
FT                   DKILIESNDAEDNSILRLMELCNVKVDKHNRKLIFHSKTLDEAKKVNAKIVQWVKSNEK
FT                   VPVMVEKAERDEIKMINGYAEKIAADLEIDEIVQFYRFGFVRVDRKDENMLRVVFSHD"
FT   gene            complement(76025..76711)
FT                   /locus_tag="SSO0094"
FT   CDS_pept        complement(76025..76711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0094"
FT                   /product="Conserved hypothetical protein"
FT                   /note="May contain small ORF's"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40451"
FT                   /db_xref="GOA:P95967"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95967"
FT                   /protein_id="AAK40451.1"
FT                   /translation="MIKLVLVDLDGTLTEDRESTRIDLDAIYAIRLLQKSGIKVSLVSG
FT                   NSYPILRGLYTYLYLDGGFVAENGCIVFYKEKYRMCRQMEQSLVDEFKSLFKLRDTWQN
FT                   EYRECDFGFVPAKITDEMINWAKERNLYIKSSGYAVHIAYNPAGKRIGVEKLLQLLGLK
FT                   KEDVAAIGDSSTDIELFQQVGFKVAVGNADDELKDIADYITSNKSGKGVREFVDKLLKG
FT                   EFDGIK"
FT   gene            complement(76708..77907)
FT                   /locus_tag="SSO0095"
FT   CDS_pept        complement(76708..77907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0095"
FT                   /product="Conserved hypothetical protein"
FT                   /note="First part 5S rRNA second part probably unidentified
FT                   r protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40452"
FT                   /db_xref="GOA:Q7LXZ1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ1"
FT                   /protein_id="AAK40452.1"
FT                   /translation="MKKVYDEIHAYIELDDREAKIIDMPEFQRLRRIKQTSLAYLVYPG
FT                   ATHTRFSHSLGTFYLTTILGEKFRQLGIITDEESTYLKLSALLHDIGQFPFSHSLEPLY
FT                   LEKGLSNKDLRYMIISKSPNFREFFDNESIDYSKIIEILNGNSMMSSIVNSDVDVDRMD
FT                   YLVRDSRHTGVQLGNIDLYRLLDTIFYGNNNEIVVQDKGIYSLENFFISRLHMYQAVYY
FT                   HKTIIGYELMLREIFRTIYDCCDSSILSVENIRGLVYDSSISYWDDEWVFMILYTYLYS
FT                   SNSPLYLKQKIRNFLDRRGPKVVYEEISYDNEMKGGDIKIKEIVDRLERNQIPRSSIYP
FT                   IEEKIKILNKDKINIISKNNEMNIIRYKSTLINHIPETLTIRRIYVDHEYAKKARDVVP
FT                   "
FT   gene            complement(77945..78065)
FT                   /locus_tag="SSOr02"
FT                   /note="5SRNA"
FT   rRNA            complement(77945..78065)
FT                   /locus_tag="SSOr02"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(78293..79423)
FT                   /locus_tag="SSO0097"
FT   CDS_pept        complement(78293..79423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0097"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to APE1126, APE1126"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40453"
FT                   /db_xref="GOA:Q7LXZ0"
FT                   /db_xref="InterPro:IPR009995"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXZ0"
FT                   /protein_id="AAK40453.1"
FT                   /translation="MSLIALAQTSLNQANSLYYILTYVLFFVLLFLLYLPGVNTRLTVS
FT                   MLARGIEGQLSMIEKYLNESKSKMEQLLKERGVQDPKPFIERISEMFIIDPVNVEPTDI
FT                   ISRMRLLLRSGEDKIRDLITLMVPNIDNVNRSKLEVSAEVVNSLNLIYKVVRHYLILAK
FT                   KLNSAILLYQLQFVVPQLVKISEAYSKAMNTFIRGIPVGDSLGPLVAAYLFMKADKKWN
FT                   PSRDTVAGEVELEGRKLIVVKAEGPMATVGRPGEAVENVVEEYKGKVTRIITIDAALKL
FT                   EGENTGAIAEGTGVAMGDPGPEKISIERVAVKYNIPIDAVIVKMSMEEAITEMRKEIYQ
FT                   AAPKALELVKKIILERTKPGDIVVVVGVGNTAGVAQ"
FT   gene            complement(79467..80372)
FT                   /locus_tag="SSO0098"
FT   CDS_pept        complement(79467..80372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0098"
FT                   /product="Methionine aminopeptidase 2"
FT                   /EC_number="3.4.11.18"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40454"
FT                   /db_xref="GOA:P95963"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95963"
FT                   /protein_id="AAK40454.1"
FT                   /translation="MTEDELNKLLLAGKIAAKARDEVSLDVKASAKVLDICEEVESIII
FT                   ENKAFPSFPCNISINSEAAHYSPTINDEKRIPEGAVVKLDLGAHIDGFISDTAITISLD
FT                   SRYQRLLDASKTALEAAITNFKAGLSIGEIGRVIEKVIRAQGYKPIRNLGGHLIRRYEL
FT                   HAGVFIPNVYERGLGVIQSDSVYAIEPFATDGGGEVVEGKSITIYSLKNPNIKGLSSRE
FT                   NELIDFIYTRFNYLPFSERWLKEFSTNVDELRNNIKNLVKKGALRGYPILIEIKKGVVS
FT                   QFEHTVIVKGDSIIVSTKSL"
FT   gene            80426..81109
FT                   /locus_tag="SSO0099"
FT   CDS_pept        80426..81109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0099"
FT                   /product="Conserved hypothetical protein"
FT                   /note="M. jannaschii MJ1163"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40455"
FT                   /db_xref="GOA:P95962"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95962"
FT                   /protein_id="AAK40455.1"
FT                   /translation="MAQLRWLGHAATLLTFGNKNVIIDPMIKDNPLSPVKLDYFKNNLD
FT                   IIIVTHDHYDHLGDTVELLRMNPKAKLFATYDLEAHLAETYKISEESIIPANVGGFVEV
FT                   DGIKLALTKAVHSSTHSDPTGAIVSAEGITVYHAGDTGLFEDMKLIGEVFKPDYALLPI
FT                   GGRFTMDPYQASISVELIKPKKGAIPIHYNTWDLIKVDVNDFVKLVKNKGYNPIVLQPG
FT                   QTITL"
FT   gene            81106..82512
FT                   /gene="pheS"
FT                   /locus_tag="SSO0100"
FT   CDS_pept        81106..82512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SSO0100"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit
FT                   (pheS)"
FT                   /EC_number="6.1.1.20"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40456"
FT                   /db_xref="GOA:P95961"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95961"
FT                   /protein_id="AAK40456.1"
FT                   /translation="MISMLSENEAKILFFLKDLKKTNSVELAIKMGIPESSVLSLIELL
FT                   REKGYVKTEVKSEKHYVLTEEGRKRKESGLPEDILINTLNGQEKDLNEIKNILNKDFNI
FT                   AISWAKRKGLIDIKEGKVIPKVKTYMSSEYLALSNLERADSNTINLLKKRGLIEEKERK
FT                   IVSVELIKEPKESEIGISNLNRELIISGEWKKYKLKKYNVEAFPPYYTISKKHYFREFL
FT                   EKVKDIMISLGFKEINTGYIEMEFYNFDLLFQPQDHPAREIHDSFSVEGSGKIEDKDLL
FT                   NNVKEIHEKFWKYEWKQDITLRLMLRSQTTATTARVLASRPKAPQKVFTLGKVFRPDAI
FT                   DATHLIEFHQLDGVIIDNNFTFKELLGVLKEIFYRLGIKEVKFKPAYFPFTEPSVEAYG
FT                   YLEKLGWVEMCGAGLLRPEILSSVGIDSTAGAWGIGIERLAMSFLNISDIRLLYSNNIE
FT                   YIRDTKVKIE"
FT   gene            82518..84152
FT                   /gene="pheT"
FT                   /locus_tag="SSO0101"
FT   CDS_pept        82518..84152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SSO0101"
FT                   /product="Phenylalanyl-tRNA synthetase beta subunit (pheT)"
FT                   /EC_number="6.1.1.20"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40457"
FT                   /db_xref="GOA:P95960"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95960"
FT                   /protein_id="AAK40457.1"
FT                   /translation="MVTIVLNKYKLLNKIGIGQQKLEDLLFNLKSEIKPVDESNIEIEI
FT                   NADRLDLLSSDGIARAIKGLLEKELGEAKYDITDTEYKLIVDNVRTRPYALAAVIYNAK
FT                   IDLQELIQFQEKLHSTIGRKRKKVAIGIHDLKKIDSKRIEYREVPLSYKFIPLYEKEEL
FT                   TISEVLEKTEQGKLYGNISISNGVSPAIVQEDGEVLSIPPIINSDKTKLDESTKDLFID
FT                   VTGTSFEAVAQTLDIIVSNLAEAGGTIGRVKVIKTDNSFQQSSPLLIHKIQNVREEYAN
FT                   KILGIKISEEEICKHITRMRMNCNVENGIIRVTVPQYRVDIINEIDIVEDIAMSIGYNN
FT                   LEPSKYISTNYGSYDYLTLLERKMRELSIGAGFVEVFNFVLIKNEKILDSKYVKILNPI
FT                   SEEYNAVRNSLIPILLDFLSKNQHAKFPIRIFETGDVVIYDSSTDTGFRNDKRAAYAIM
FT                   DNKVSYEDVQAPIHYILKTLGIEVNYKEENNDIFIEGRSASIVYENEKIGVIGEINPDV
FT                   LIRFGIEYPTVIAELYITEIAKKLNKR"
FT   gene            84240..84935
FT                   /locus_tag="SSO0102"
FT   CDS_pept        84240..84935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0102"
FT                   /product="Esterase, tropinesterase related protein"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40458"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY9"
FT                   /protein_id="AAK40458.1"
FT                   /translation="MLIHHLAGSYKSWKFVIPKLSLDNTVVAYDLRGHGRSSTPNSPYN
FT                   IEDHSNDLRRLLVQLGIEKPVLIGHSIGSLIAIDYALKYPIEKLVLIGALYRAPSSEVY
FT                   EKYVRIAVNFGMRALAEYRRFHKEFTETLASNYQAWNSLLEVYEETTPIGYKNAVEGLL
FT                   KAKDYSDELMGINAKTLIVYGTYDGLIVNLNVFKNNMKNVEIKTIDGYGHFLNFENPLL
FT                   LSEIIKNFL"
FT   gene            complement(84916..85734)
FT                   /gene="cinA"
FT                   /locus_tag="SSO0103"
FT   CDS_pept        complement(84916..85734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="SSO0103"
FT                   /product="Competence damage protein (cinA)"
FT                   /note="Regulation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40459"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR023055"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95958"
FT                   /protein_id="AAK40459.1"
FT                   /translation="MVSIVNIFMDYWFAEIITIGNEVLSGKTVNTNASHIGRRLTSLGF
FT                   TVRRITAVMDEVDEIASAFREAIDRKPRVIVSSGGLGPTWDDKTAEGLAKALGVNLELN
FT                   KTAFDMILEKYMTRKIPITEERKKMAYMPYGAIPVENNEGIAPGIYVYHNNIDILATPG
FT                   VPREMENVLENFINKMLRNRSNLKYLEDFIYVENVMESSLAPYVKELVKKYDIYIKTHP
FT                   KSYEMSHPILEIQIAGSGKQEEEIKVKIEKVKFELLDAIKKLNGIIRNSL"
FT   gene            85752..86957
FT                   /gene="aspB-1"
FT                   /locus_tag="SSO0104"
FT   CDS_pept        85752..86957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB-1"
FT                   /locus_tag="SSO0104"
FT                   /product="Aspartate aminotransferase (aspB-1)"
FT                   /EC_number="2.6.1.1"
FT                   /note="Amino Acid Biosynthesis, Aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40460"
FT                   /db_xref="GOA:P95957"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95957"
FT                   /protein_id="AAK40460.1"
FT                   /translation="MFERFLSTETKYLRTSEIRDLLKLTEGKNVISLAGGLPDPQTFPV
FT                   EEIKKIADDILLNSADKALQYTATAGISEFRRELVNLSRLRGISGIDERNVFVTVGSQE
FT                   ALFMIFNILLDPGDNVVVEAPTYLAALNAMRTRKPNFISITVTEMGPDLDELERKIKDA
FT                   HSNGKKVKLMYVIPTAQNPAGTTMNTEDRKRLLEIASKYDFLIFEDDAYGFLVFEGESP
FT                   PPIKAFDKEGRVIYTSTFSKILAPGLRLGWVIAHEDFIKEMELYKQNVDLHTPSLSQYI
FT                   AMEAIRRGIIQNNLPKIRRVYKEKRDVMLEAIETYFPNDARWTKPVGGMFVFAWLPQKI
FT                   DTTKMLEKALQRGVAYVPGSSFYADYSGKNTMRINFSFPKKEELIEGIKRLGDTIKHEL
FT                   ST"
FT   gene            complement(86950..87813)
FT                   /locus_tag="SSO0106"
FT   CDS_pept        complement(86950..87813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0106"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40461"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY8"
FT                   /protein_id="AAK40461.1"
FT                   /translation="MKAVVFNLGITISDVPEKQVNRDYVLLKPKRVLVNGLENSIYVGL
FT                   LWVDPTRILGSTGIGRIEGVGLDIDKSLEGKLVLVLPYSQTYGGIGTEIDGILAEKASV
FT                   PLDSIVILPQYGFNEKYILYPYVSFALQLPKYIHSGNTLIIGSGLYGIISALYLKDMVS
FT                   KVAVYREDGINPKIVGVEEIRHFSQEWDNIIITTFRSWIRAFIDDISKSNTKIVMPKLM
FT                   NTWPVVSSTKTVFIPPKEVDGVLEFIDKKINDKLFNELVSFSNDLLVSFPSPKAGVVIN
FT                   AEEIFK"
FT   gene            87870..88241
FT                   /locus_tag="SSO0107"
FT   CDS_pept        87870..88241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0107"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40462"
FT                   /db_xref="GOA:Q7LXY7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY7"
FT                   /protein_id="AAK40462.1"
FT                   /translation="MEKAIHNLGKDARLHIIHILLQNRSKKELADELGITPAAITKYLK
FT                   GITHPSDEIIEKCIEIASEDEEYHEIIKVIVSDITEALMELLREIGIEKMIDNEDIQKL
FT                   KKLLDKAFDKMLSTSPSFV"
FT   gene            complement(88218..88610)
FT                   /locus_tag="SSO0108"
FT   CDS_pept        complement(88218..88610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0108"
FT                   /product="Hypothetical protein"
FT                   /note="Possible CAP protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY6"
FT                   /protein_id="AAK40463.1"
FT                   /translation="MSSVTEDNLKPNIVLLSTSDLEQEIRQLTEELKNVKDNNNEEHKK
FT                   LYALVDNITRTLNWINIAKSQGIWKSKTCKHAINFVCQAWNISDESKLGIPSDVIVIND
FT                   DGTKRVVVSKFSEICIVCPLYEARRS"
FT   gene            88678..89373
FT                   /locus_tag="SSO0109"
FT   CDS_pept        88678..89373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0109"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to APE0975"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40464"
FT                   /db_xref="InterPro:IPR018693"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY5"
FT                   /protein_id="AAK40464.1"
FT                   /translation="MVKEIYRERIKVLTDIWSLLIESWESLSREDVIEIMKNAYVKKNI
FT                   KPFRGFNADGLYEKELVSLFVVGKYGLGLFEDNKEIFDKLLSKEEYYDEISKLIISGNV
FT                   NEAFEESGSNKEVLARALRTIFTKTVFSFESEDKLYKSLKNLNISDKDEIKHTSRSFSR
FT                   FYTAFKLAESIAEGIVRDRLTYIATKKAIAISIGIEYPLPKADYVALIAKEVFNVNKKV
FT                   LNKVLGVKV"
FT   gene            89415..90317
FT                   /locus_tag="SSO0110"
FT   CDS_pept        89415..90317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0110"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Contains CBS domain. Similarity with APE0974,
FT                   MTH126, MJ1232, AF0111"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40465"
FT                   /db_xref="GOA:Q7LXY4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR016436"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY4"
FT                   /protein_id="AAK40465.1"
FT                   /translation="MQNLSPTQREILLALTDLYNRQKRMIKSKEVADIIGKDEGTVRNI
FT                   ILSLKVLGLVESKPGPNGGYMPTLKAYEIINNPTLTPILDKLNLYKGMIETDIKVENIE
FT                   IIDITNPSANRVLLKVEGDLRKLKIGDAVRLGPTPYSRLVIEGLILHLDENSKEIVVDV
FT                   KRMISIPKEKVKNLISKKLIALKPETSLREASMIFYKEAIRGAPVINQDEKVVGILTTA
FT                   DIIKAFFEGNYTAKVSDYMKTNVISINENEDLLDAIRKMIIYNVGRLLVLDSNNKAVGI
FT                   VTRTDILRSIAGLEGLWTT"
FT   gene            90305..90655
FT                   /locus_tag="SSO0111"
FT   CDS_pept        90305..90655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40466"
FT                   /db_xref="GOA:Q7LXY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY3"
FT                   /protein_id="AAK40466.1"
FT                   /translation="MDNLKEKCGIICNNTFYELKNISRTEYEFICDPSDFYTTVKGKCS
FT                   DDIQAIVHTHEESCEPSYKDIMSMKIWNIPWIIISKKCIKSILYLNGSILELDIHSLLS
FT                   QELYHSLMKLLQ"
FT   gene            complement(90572..93199)
FT                   /locus_tag="SSO0112"
FT   CDS_pept        complement(90572..93199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0112"
FT                   /product="ATP-dependent helicase"
FT                   /note="Lhr-like protein; Helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40467"
FT                   /db_xref="GOA:P95949"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P95949"
FT                   /protein_id="AAK40467.1"
FT                   /translation="MSNTYFYSDEEIYNLLRPYVAKWFRQKYTTFTPPQRAAIPLIKQN
FT                   YNVLVSSPTGSGKTLAAFLGILDSLFELGDNNELEDKVYAIYISPLRALNNDMQRNLLE
FT                   PLNELRQVNSKLPDVRVGIRTSDTTPYEKQKMLKKPPHILITTPESFGISITSPKFSQK
FT                   LTDVKWIIVDEIHELANSKRGAYLSAMLELFRNLITKKEFVRIGLSATVSPLEEVAQFL
FT                   VGKDREYRIVDARFVKPVDIKVISPVKDLVHSSESEVDKGIYKTILNEVKKHRTTLIFT
FT                   NTRHATERVAYKLRKLAENEKVFDVDAIEAHHSSLSRDVRLDVEEKLKKGILKVVVSST
FT                   SLELGIDIGYIDLVILLSSPKSVSRLLQRIGRAGHHIRSISKGRVIVVDRDDLVECSVL
FT                   AKLARDRKIDSIHIPKNPLDVLSQIIVSASLISPIDRDDLFKILRRSYNFSDLSESDYS
FT                   LVLRYLSGDFFGVELKNVYAKIRIKEEKIIYPKKGSRLIFYTNSGTIPDEAMISVVTEN
FT                   NRYVGNLEEEFVEILSPGDIFVLSGRTYEFIGSKGSKVIVKEAMGQRPTVPSWFSEMLP
FT                   LAYESALEIGKFRREIAEMIKKGVTHNEIIESISKEYEIDKHASMSIYTYILEQYLFTN
FT                   GKVPSDNLILIEIYDDEEGIRNYIFHALYGRRALDALSRAFAYVVSEELDTDVRVSVTD
FT                   NGFALSVKRDVPFDYNIKSLFEKITPDNVYDIVTRAVMRTEMLKRRFRHCAERSFMILR
FT                   RYKGRETNLERRELNSEILLKAIREIGNFPVMKETIREILEDHMDILRAKEILKKIASQ
FT                   EIKVDVFGPTNIPSPFSHSIILKGHSDVVLAEDRRELLKKLHERVVEFLRQKGVNIELE
FT                   YTSV"
FT   gene            complement(93241..94617)
FT                   /locus_tag="SSO0114"
FT   CDS_pept        complement(93241..94617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0114"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40468"
FT                   /db_xref="GOA:Q7LXY2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY2"
FT                   /protein_id="AAK40468.1"
FT                   /translation="MILNILLNLAIFIIPSLAVWNQIILYIFGKSGDIANLILLNNESN
FT                   LPKLSIIVPTKGERIEVIQGLIDNIHEAIWDRNKLEIIIVSDDEQEYFDKLLSTLIIPP
FT                   DLDVRIFRREKKLGYKSGALAFGLQKSTGDLILTLDVDARIEKDSLIKAYNHMVNLGCD
FT                   AITMEWHGYSNISTSLAKALMVSTVLTSKSILRGRDKLGLKVLPIGCGTIYKRSALEAV
FT                   NGWDYKMIQDDYELGARLINKGFKVCASSSPVYVEVPDNLIAFYVQQTRWAMGTMEVLY
FT                   WRFKYIISSDIKLWQKLEIIAYLSQYIPIILTFISAIIFAIAGFVGIRLSMNLPMFIIW
FT                   AITLSIYASIFVNSAKKSGIDTVTAIKALGRLSAYTVGISPFLLIGTINAFKKTRTYIV
FT                   TPKGKKAKSNIGYPILAFGVFFILSAFLYMFRGDFLTFIWLAYYSIAFLYTFIAYIKGL
FT                   "
FT   gene            complement(94607..95191)
FT                   /locus_tag="SSO0115"
FT   CDS_pept        complement(94607..95191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0115"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40469"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR023098"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY1"
FT                   /protein_id="AAK40469.1"
FT                   /translation="MSTIRIEMEKLGDLIPHEDILIDKVVNISFEVQKIRAIKPIIVDE
FT                   NTHVILDGHHRFTAALRLSLPKIPVIYVNYNSTSISVNVWYRRFSKPYIVKSVLSAIYS
FT                   NGKICAKFDSIRICDDDLYRLYWKLEKVESFLHSIGINVEKDIVGHLEPPSIYKEDVIS
FT                   IANRGLRFPPKTTRHVYEFIIPQKAISIDDT"
FT   gene            complement(95139..95849)
FT                   /gene="ntH-1"
FT                   /locus_tag="SSO0116"
FT   CDS_pept        complement(95139..95849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntH-1"
FT                   /locus_tag="SSO0116"
FT                   /product="DNA endonuclease III, probable (ntH-1)"
FT                   /EC_number="4.2.99.18"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40470"
FT                   /db_xref="GOA:Q7LXY0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXY0"
FT                   /protein_id="AAK40470.1"
FT                   /translation="MKCTAETIFHKLSATYIIKEEDFIAYYVWLKTKDCFKVLVATILS
FT                   QNSTDKSAIKAYLELERKVGVTPEKLSNANLADIESALKISGLYRTKAKRLKEISRIIL
FT                   ERYNGLIDSLLNTSNARDELLKLEGIGEKTADVVLLTCYGYYGYKVFPVDTHITRVSKR
FT                   LGIVPTNAKYSLISSTLKELFSAYDLLHLHHMLIAHGRQTCKARKPLCNSCIIKECCEY
FT                   YSHRDGEAWRSNTS"
FT   gene            95902..96168
FT                   /locus_tag="SSO5209"
FT   CDS_pept        95902..96168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5209"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z7"
FT                   /protein_id="AAK40471.1"
FT                   /translation="MMYEIEMVLNAIKEGAVNPGDAVIKTGLPRYEVLALFHILEELGL
FT                   IEPIYSKGSHKAFRLTKKGEEILEGLKKGYELYIFVKPNPVQS"
FT   gene            complement(96149..96562)
FT                   /locus_tag="SSO0117"
FT   CDS_pept        complement(96149..96562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0117"
FT                   /product="Hypothetical protein"
FT                   /note="Some similarity with MJ0897"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40472"
FT                   /db_xref="GOA:Q7LXX9"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX9"
FT                   /protein_id="AAK40472.1"
FT                   /translation="MMWLKAISSIFSTLIVVMITLSLIVPLYLFFTQTYTNSSIQANSA
FT                   YDNYLTNVNVKVSLIYLGNSVNETFVYNYGSVPITIEKVIINNISYNVKYEMLPDSLVP
FT                   LSSIINNNIFIEGNSVIILQINGNYYYFNSGPD"
FT   gene            complement(96568..97032)
FT                   /locus_tag="SSO0118"
FT   CDS_pept        complement(96568..97032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0118"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40473"
FT                   /db_xref="GOA:Q7LXX8"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX8"
FT                   /protein_id="AAK40473.1"
FT                   /translation="MLQLMMKGGYKLKKRKGLSSILGTVIVLAITLVLGGLLYAYSNGL
FT                   FSSLTQNASLQTQVSIYVNPNTGQAYIQYYISNTGSTQIYLSSIQILNGTRNIIIPLNN
FT                   NLLQPGQTVQNITSINGKITAGQYYTVEIAGNLPNGKPYSVVQNVLASIA"
FT   gene            complement(97075..98595)
FT                   /locus_tag="SSO0119"
FT   CDS_pept        complement(97075..98595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0119"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some similarity with MJ1286"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40474"
FT                   /db_xref="GOA:Q7LXX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX7"
FT                   /protein_id="AAK40474.1"
FT                   /translation="MIKLKLKLFKKMNLFELMNTRINENIKYYGDDMERLRKEYIVMLF
FT                   LMPLISSISIILYLKISPYFLLLNIMNVFIYFFPILITQIRKDEQRKLIENEMPVFLLF
FT                   AYVNSLLGRNLYKTFEEIRNSKVFKGLRREAMLLVKEVEVLGKSSFSAMESRAKAHRGD
FT                   FLGKIYTVYTSGESIGISMPERLKDLLNETIDGLNSNFQGYVEKVNELVEILFMLFLIT
FT                   PMILLAFQYISSSINIFELIFPLLLFPIIFFYISLIQPNIGYDIKIDIKEVKNSLYILP
FT                   IPFILVFLFHLSLEYEILVFYSIFIMFSFFIYRKISVADAILNNLPYILSDIADYLKIG
FT                   YSIKSAILKLNVDNTHFRMFLGELAAKIRKNEAISNVRTNIWIVNAILELIENIDKKGF
FT                   ADTYTFKDLSLILYNYTSLRKKVLQNLRLFSILATITPIVFYFALGIMSKIRAVGNLDL
FT                   IIVLYTMALSIIYAKVSRFTVFNFPLLVLALMNLIIVLLFGNVILTFI"
FT   gene            complement(98567..100018)
FT                   /gene="gspE-1"
FT                   /locus_tag="SSO0120"
FT   CDS_pept        complement(98567..100018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE-1"
FT                   /locus_tag="SSO0120"
FT                   /product="Type II secretion system protein, virB homolog
FT                   (gspE-1)"
FT                   /note="Transport, Cell membrane transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40475"
FT                   /db_xref="GOA:Q7LXX6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX6"
FT                   /protein_id="AAK40475.1"
FT                   /translation="MSIFFLNNGIMNILQEYSVLNAKVIIYEENGIGYYKVNEPNLDQN
FT                   EIEILNSILEYIYSTPSVPNIEETVVKILKNKGISDQGIIEKIIYYLRKRIGYDELTVP
FT                   LADPYVEEIECKGFSYPVTVVHRIVTRFPRLYTNIILEQEDHVLKVIEKLANKADKPVS
FT                   IAKPYLEFSLPEGHRVAATVSREVSLPGSTFDIRKFPLKPISPISLIKNESISSLMLAY
FT                   IWFLLDYKPFFLIIGSTGSGKTTLLNSILSMINPFFKVITIEDTPEINIIHDNWIRFFA
FT                   RQSISSQFEVSLMDLAKLSLRYRPDYLVIGEIRGKEIEALVHASASGHGSLATFHAGNP
FT                   HEALTRLLSLLNKDVAKLFLQNLWGIIVLGTLRDRNGNIRRIIRSIYEIVYTRGKLRFR
FT                   PVLRWSFSSNTFMPNNIDDLIKRSYRISYISKTYEIPISEITKEISNRVKTLNNFVSNN
FT                   ILDLEEFSVYLKKISQGDKVETKAI"
FT   gene            complement(100015..102102)
FT                   /locus_tag="SSO0121"
FT   CDS_pept        complement(100015..102102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40476"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z6"
FT                   /protein_id="AAK40476.1"
FT                   /translation="MIKECMTIPDFILYQKLGLNFIPNLNCWLESKNENSVQLKCNVLR
FT                   QPSVNISEFGIKISDDKWIFRKGNIVVMIEDGKETIIRKDEDEYVVDYIMYNDSEIYPI
FT                   YLKGRKYNLNGEEYEKYLSYLDRKILVGKRNLIIILGNKQLNIDRGERIYLSRSFISVI
FT                   YDSGTKVIDREGNISYFNFKGDYLGFIQSYGIIYRSSDGLIVSSKKGNIGICVDESYLI
FT                   GEFSGGLLILCGESLKQYYNTGWREIERNIDSELFVNSNRNFFGVLKKGKLYIFDSNFS
FT                   KLSTFDDVNSFNFDSKRIYLFSNDGTVGLAKLEENYRPIKIINVNNSVQSPIILQVDEN
FT                   YFHNFSIKNGKMIDIKVVEDKKKIVIIEPFEYRKNSLEISAGNIFFSFLDAIPYTSQLP
FT                   KIEFSSAKILAADEGGNLITSPDKNALLIFNIKYSIPTRSQITFTIEALNQTFKFLARE
FT                   NSGKKLLKIPLSINNLKLLDVPVNVYAHVDDRLIASLEFLAPIKIVRKETTLNQNKITI
FT                   INNSVKKEIVVIKNGIFEWKQLFEYPLEYKGILFGKEGEKIEVDGEKIVVREGYNLVRI
FT                   VKDNANYAREYLVIGIKNPIKSVNAELKENQITVKLDMETNIPFEIFYGPHSFRGISKE
FT                   ETQITFPIEPIYNSIKIRAYTHGFTYESQYEFVDTIKLSILMALSEAKAIKEVLSNFGI
FT                   V"
FT   gene            complement(102132..103238)
FT                   /gene="sun-2"
FT                   /locus_tag="SSO0122"
FT   CDS_pept        complement(102132..103238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun-2"
FT                   /locus_tag="SSO0122"
FT                   /product="Sun (fmu) protein (sun-2)"
FT                   /note="NOL1/NOP2/sun family protein. Related to eucaryotic
FT                   proliferating-cell nucleolar protein p120; Cellular
FT                   Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40477"
FT                   /db_xref="GOA:Q980Z5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z5"
FT                   /protein_id="AAK40477.1"
FT                   /translation="MKDIVKFLSTVLYYVEQKNYPLAIAFKRAYLHNKPRKIDSNLLYE
FT                   YSKRLILSYYALPQSKRSAKVRYWLKNRENIEIKFPKWMEDKLFTLLDVNALKRKLTER
FT                   WIWARINLLKTDIDKVYRMLESQNIEFEPDKDFYYMIKINRSSVRLSSLSIVKDFKLIL
FT                   HDKASSIVVEALKPEISEKLVDLSSAPGIKASLYMMLTENRAETFLADVDLKRLSKEYN
FT                   LLKRCGVDLRKVHIIYQDSTKNSIIKSDKILLDAPCSSSGMINNDPSILLKLRNGEKIE
FT                   KFTKLQKSLLNEALKIKSNKLVYAVCSLFPEEGEKVIEDYYEIAEKPFSNYQSGYSLFK
FT                   SGKRSNRTFPHIDSTEGFFISTLNLTKL"
FT   gene            complement(103509..104171)
FT                   /locus_tag="SSO0123"
FT   CDS_pept        complement(103509..104171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0123"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40478"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z4"
FT                   /protein_id="AAK40478.1"
FT                   /translation="MRLSLGYVKEKELEIIAPLLNNETNRNIEFNLIRVKEDELKFKLK
FT                   ELDLAFIPLPLTLFYENIRFISNGAFVANKIGLKIINSRFSKLCINSSNSTEYYLFKTL
FT                   TNYKNPLEIVRSEVCNDADVLISYEDYDISLDELWRKNCGDLPLVISLIGSLRLDEQTL
FT                   SKVKVVIREAASLQESRGRISHYSKELGLKGRQAIECFFQLCLKRGLCRSSISPQIL"
FT   gene            104246..105148
FT                   /locus_tag="SSO0124"
FT   CDS_pept        104246..105148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0124"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40479"
FT                   /db_xref="GOA:Q980Z3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z3"
FT                   /protein_id="AAK40479.1"
FT                   /translation="MEAKKILIVGAGYAGLNAYYELGKHLDKTLIADKAQFIFYTAYLQ
FT                   KLIFNKSIQYATNIKPTIINKVKEIDLERKIVKIENGTEIQGHKLILALGCKRESQLDI
FT                   IRKIIEKDRVSISVENYLDEYLGIQLAFYLRKLNKEVSYYGPVLKWLGEKVSSKVLEFL
FT                   EKNGIRLSEKSDDIIPACEPNEVIGDFLPVNDKLEYKNGVFVIGDMIKNYPKLGELAMR
FT                   EGVYVGRLLSKKINESFRPIFINIIDTGKGEAIHIRSNILWNGNFESVKVSKIRVIMKR
FT                   FIERYYIIRKGKMGVLYKL"
FT   gene            complement(105256..106164)
FT                   /gene="ubiA-1"
FT                   /locus_tag="SSO0125"
FT   CDS_pept        complement(105256..106164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA-1"
FT                   /locus_tag="SSO0125"
FT                   /product="4-hydroxybenzoate octaprenyltransferase (ubiA-1)"
FT                   /EC_number="2.5.1.-"
FT                   /note="Cofactor Biosynthesis, Quinones"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40480"
FT                   /db_xref="GOA:Q980Z2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z2"
FT                   /protein_id="AAK40480.1"
FT                   /translation="MSWDPGGLNKNTRNKLYIILRFLRIEQTFFSLPMAYLGAFVAIKG
FT                   IPPIPTLILIFLALFFLRTAGMTNDNLADIEIDAKNPRTKNRPLVTGAIKIREARTMIV
FT                   ASLILFFITSYFVNIWAFILAPIVALIIMSYPYMKRYTAFANYHLASIQGLAVFSGAVA
FT                   VLGLYYNSLDQILLRVPWFFVIGTILWAVGFDLYNHIPDAEFDKKMGLHSFAVVLGRWA
FT                   LTFAGLNQLFSVVLDLLGDFYYGLGPIAIFATVLHGLIMAYAYYLASQKNDFGRAFYYN
FT                   IYSSIVLGLGVDIDVILGIPF"
FT   gene            complement(106161..107822)
FT                   /gene="leuA-1"
FT                   /locus_tag="SSO0127"
FT   CDS_pept        complement(106161..107822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA-1"
FT                   /locus_tag="SSO0127"
FT                   /product="2-isopropylmalate synthase, putative (leuA-1)"
FT                   /EC_number="4.1.3.-"
FT                   /note="Amino Acid Biosynthesis, Pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40481"
FT                   /db_xref="GOA:Q980Z1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z1"
FT                   /protein_id="AAK40481.1"
FT                   /translation="MALKMKYDFLLLSLKLLNLPIIFHLCSVSKKSVEVLDTTLRDGSQ
FT                   GANISFTLNDKIKIALLLDELGVDYIEGGWPGSNPKDEEFFREIKKYRLSKAKIAAFGS
FT                   TKRKDVSVKEDISLNSIVKADVDVAVIFGKSWSLHATEVLKVTKQDNLDIVYDSINYLK
FT                   SHGLKVIFDAEHFYQGFKEDPEYALEVVKTAESAGADVIALADTNGGTPPFEVYEITKK
FT                   VREVLQVKLGIHAHNDIGCAVANSLMAIKAGARHVQGTINGIGERTGNADLIQIIPTLI
FT                   LKMGLNALNGQESLRKLREVSRIVYEILGLPPNPYQPYVGDNAFAHKAGVHVDAVMKVP
FT                   RAYEHVDPSLVGNDRKFVISELSGTANLVSYLQGLGIAVDKKDERLKKALNKIKELEAR
FT                   GYSFDVGPASAILITLKELNIYKNYINLEYWKVINENNGLSIGIVKVNSQLEVAEGVGP
FT                   VNAIDRALRMALQRVYPEIGEVKLIDYRVILPSEIKNTESVVRVTIEFTDNKMNWRTEG
FT                   VSKSVVEASVMALVDGLDYYLQLKKTLKTAVDNYIV"
FT   gene            complement(108316..109137)
FT                   /locus_tag="SSO0128"
FT   CDS_pept        complement(108316..109137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0128"
FT                   /product="Iron (III) ABC transporter, periplasmic-binding
FT                   protein, putative"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40482"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Z0"
FT                   /protein_id="AAK40482.1"
FT                   /translation="MSVRVYNPLQDDYIKIQRPITKIVSLDPASTEIIFLLGLGEKVKA
FT                   TDAFSYRPEDARRTLKIGSYTHVNVDILKQINPDIIFTTAGAQKELTRKLIGLGFNVYP
FT                   LPVPTNIASILNNVLLIGNVLGVYEKARELYYSLYNVIDGLRARCYKKKIKVYIELDLG
FT                   GPITVGFPTHISDGISLLGSTNIFDDISEAYFTPKDEEILKRDPDIIIYEPKRLTDYEK
FT                   ERFYSILRKRDLFQLLNKRLIFTKGDYLAHMGPSFITDVLIWLKSVLFSQP"
FT   gene            complement(109171..110052)
FT                   /gene="cbiG"
FT                   /locus_tag="SSO0129"
FT   CDS_pept        complement(109171..110052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="SSO0129"
FT                   /product="Cobalamin biosynthesis protein G (cbiG)"
FT                   /note="Similar to MTH1408 (Methanobacterium
FT                   thermoautotrophicum); Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40483"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y9"
FT                   /protein_id="AAK40483.1"
FT                   /translation="MYVSRILVNGVNKDLVKQIKGLFSELGYWIVYNDPDIIISVNSIN
FT                   NTIRKYFAKFHNKIIINVVPDGSSVIPLTKEHSGGSLISSFLADSLGANLVLTTSTGVK
FT                   GLYSVEEFSWLNGFSIYGYDRKIVNSLNKKLVTEGKVNVYVDSYKGNYILYDGYSLVDH
FT                   KTKADLIISENVDSMEDKSSNRLYLIPSGIYIGIRYLESTPLDVLVYSLRMTLKSLYIL
FT                   NDRIDYIVVPSSLKNDKKLHQITKYYYSNIIYGSDVDERSSCEALLKELKVKVLLKDVR
FT                   RAFGVITCLGVK"
FT   gene            complement(110094..110804)
FT                   /locus_tag="SSO0131"
FT   CDS_pept        complement(110094..110804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0131"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Low similarity with mj1282.1"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40484"
FT                   /db_xref="GOA:Q980Y8"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR009655"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y8"
FT                   /protein_id="AAK40484.1"
FT                   /translation="MIVIYYIQIFLSIIMLIHTSILDLKYREVDPKIWIYYSPLCLFII
FT                   FSFHNLFLPIYLYSFIITNLLFLILYKLSLLGGADLFLNVILSLANASVISLVPSRFLV
FT                   IGLEPLVIVLYSSIIILIFSLINFVKQYKYVRNLPFSKKILLALSAKRIKIRDFINSKF
FT                   LFPLTEVKEDGSIMLRDYFSVEEDDKYWRELYSKLVNEGKISADTYIWVAWGIPVIPFM
FT                   LAGYIMSLIIGFPI"
FT   gene            complement(111001..111396)
FT                   /locus_tag="SSO0132"
FT   CDS_pept        complement(111001..111396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0132"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40485"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y7"
FT                   /protein_id="AAK40485.1"
FT                   /translation="MGDLPPGSYLADLIMGDHTITVKLLVLEYKDSRLNFYTTDLNMED
FT                   EMIEVTWKIRWEIEKLHRDVKALDMQDSSFLKRQRFHGYLLLFVMVVNAVRDLIGSLKL
FT                   KSVEELLKFIENHLGGAPGLMKMFKLR"
FT   gene            111846..112274
FT                   /locus_tag="SSO0133"
FT   CDS_pept        111846..112274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0133"
FT                   /product="First ORF in transposon ISC1212"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40486"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y6"
FT                   /protein_id="AAK40486.1"
FT                   /translation="MVKAISTEKDLLLKVDKSFPWETFRSKLKSLYSKKPKWNVISLLK
FT                   VLLIKLIFDISWNNLEGEIRDSKRFMDFLGGKIPPKSTVFSFYKKLQQTVIQEGETMRT
FT                   TLMDELNKALDKVISEYREKGFELEVGREKTIGSRTTT"
FT   gene            112358..112801
FT                   /locus_tag="SSO0134"
FT   CDS_pept        112358..112801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0134"
FT                   /product="Second ORF in transposon ISC1212"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40487"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y5"
FT                   /protein_id="AAK40487.1"
FT                   /translation="MGFNDVFLLMGYTTSKLKNFTAFRKYKGSWGRKHGKSYFGFKVCN
FT                   LVERRTNFVRGFKVGLANLSDLAFSFDNVKLMADRAWISRKDVLVKGVGSARLPVEGSG
FT                   VKIREGKASSTTLRGVVMEVFFLNLYRDLEILSTRIRTKVLVN"
FT   gene            complement(112903..113859)
FT                   /locus_tag="SSO0137"
FT   CDS_pept        complement(112903..113859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0137"
FT                   /product="Partial transposase ISC1359"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40488"
FT                   /db_xref="GOA:Q980Y4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y4"
FT                   /protein_id="AAK40488.1"
FT                   /translation="MKHENTTKPAKFNRDFARSALKIIYSVLTKILFPEELLSALLKAS
FT                   GSYLSRLGKDGRRALRKLNAVQVEDVRDALRKMGRMTLRGVRDRRVAVDFHAIPQYHAD
FT                   KSFLSRIKPTKGTSWGLVQAAIFLLGRTRSFLDVIPVTVKNVAEGFKAVMEVIVKELEE
FT                   DKLRLVIVFADREFAVNEVIRYLLELGLDFVISAKAQMYKKYKGMLQDVDVSFGGVRYT
FT                   GFLCVRHGSGAYLIILRKEDGKIIAFLVRKEMDLYDAIVLAEMYRERWGIENAFRSLEE
FT                   FRVRTRTCDVTLSDLSKIKSHYNYNVSYYTILHYIQV"
FT   gene            complement(114650..115024)
FT                   /locus_tag="SSO0138"
FT   CDS_pept        complement(114650..115024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0138"
FT                   /product="Hypothetical protein"
FT                   /note="Similarity with orf D-335 from SSV1 Amino-end.
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40489"
FT                   /db_xref="InterPro:IPR012922"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y3"
FT                   /protein_id="AAK40489.1"
FT                   /translation="MILWQKLRSCQSLKRNPENHNTGEKVNGKKSGRSMGLTRAFKCEN
FT                   IILRERKGRYYVYKLETINGEVKETYVGPLADVVETYEKLKDSSGGVGVSPTWARWDLN
FT                   PGSSPCEGDVLTKLDDGPFY"
FT   gene            114659..114733
FT                   /locus_tag="SSOt05"
FT                   /note="tRNA-Val"
FT   tRNA            114659..114733
FT                   /locus_tag="SSOt05"
FT                   /product="tRNA-Val"
FT   gene            complement(115476..117074)
FT                   /locus_tag="SSO0140"
FT   CDS_pept        complement(115476..117074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0140"
FT                   /product="Primase (Carboxy-end fragment)"
FT                   /EC_number="2.7.7.-"
FT                   /note="Encoded by Sulfolobus plasmids; Replication and
FT                   Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40490"
FT                   /db_xref="GOA:Q980Y2"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y2"
FT                   /protein_id="AAK40490.1"
FT                   /translation="MSKIGETPLDMGLKDAIIGIFIWNKEKGIFEPFENRLRKKARALL
FT                   EYYTDLANDELKPYVISKTIIDNVVDEIKDKTLIPLPNEPLRVAFPNCTLEWKISHGRY
FT                   VPSFVLAEERTPEHFAFHYIPHKIHLEELVKINEEVLSARDIPIDLIEDLARRLCPKSL
FT                   EVFKQWANEKWVTLFEIIGYTLFPKIEFRKAFMILGPRGTGKSTFINLIKKLLGRGNVV
FT                   NIPLHILFGDKNRFVLAELYHKLVNAVSETKEYNLDDMDTLKVLTGGDRITADVKFKDP
FT                   ITFTPYAKLVIASNKPPTIRDKNDMAFWHRWLIIEFPNQFEDNTAWGDKTFTEDELEGI
FT                   LTVSILAFSRVLLHGKFDFEQTEEEVRGIWLSTIDYVYKFVKEKLKHGEIMITKNADDY
FT                   VRVKELYRMYLEYCSTNGYNATTYKGFVRRLRDYFNLTVVMKNVEGKRFRAVVGIKINT
FT                   VQTNETTGGDYGEFLNYILKNNHMIKEFADLVRDFGSTEKANVFIDFCTKKNMCFSRGI
FT                   DAWEISIQPRGFSFL"
FT   gene            117302..118267
FT                   /locus_tag="SSO0141"
FT   CDS_pept        117302..118267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0141"
FT                   /product="Transposase ISC1439"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40491"
FT                   /db_xref="GOA:Q980Y1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y1"
FT                   /protein_id="AAK40491.1"
FT                   /translation="MQTMILPKTELKSLAITLATNNINVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGETNVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLEFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            complement(118421..119638)
FT                   /locus_tag="SSO0142"
FT   CDS_pept        complement(118421..119638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0142"
FT                   /product="Primase (Amino-end Fragment)"
FT                   /EC_number="2.7.7.-"
FT                   /note="Encoded by Sulfolobus plasmids, interrupted by
FT                   ISC1439. Carboxy-end is SSO0140; Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40492"
FT                   /db_xref="GOA:Q980Y0"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="InterPro:IPR024966"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Y0"
FT                   /protein_id="AAK40492.1"
FT                   /translation="MDKIEWAKWFIDTLGFAVIPIDRDTKKPTIPNWQQYSTRALTDEE
FT                   KEKFPKMIEEGYNYGIPGQMLDKNRALVILDFEDKELLKAWIGESELNKLCQNTLCVTT
FT                   PHNGLHIYAITEEFPEYKFNPAFLRENKNVMDLQSLKSYVVAPGSCINHKFCDSAKCPW
FT                   KGQDYVTCYYADITPERAKINEIHLKGFLKYLVEKGKKLGITPASGLLEWLGGNKKSDT
FT                   EEDFEKLKEEMRKYDRYRGKTLDAIRDELCKAIKKKIEHAEEKAKETLNIAKGVLCDKK
FT                   TYADIGIDRSRGDWHLLNFLLSHGATDLDVVMQLLPEDSKVFEPKWDKYTFHTVAKIWE
FT                   RVKPWLTEFRNGDKKTELKLRGALIISNLLRKKYVIRTFYQDMGQWCFTKLFHLKDIIL
FT                   VLSKRD"
FT   gene            complement(121317..122189)
FT                   /locus_tag="SSO0143"
FT   CDS_pept        complement(121317..122189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0143"
FT                   /product="SSV1 integrase fragment homolog (orf D-335)"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40493"
FT                   /db_xref="GOA:Q980X9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X9"
FT                   /protein_id="AAK40493.1"
FT                   /translation="MNPGSSPCEGSKKGVERCKMTLVAILRQYSADYAQEFYDYLLNER
FT                   KIGNKTAKEYVSAVNRPYKETDKSQKAYRIFAKFLESRGVISSEEMEKILRVIKVKRSN
FT                   ADLYIPTEEGIRKTLKLAKEYSENVYFVYRIALESGARLNEILKVLKKPEKDVCDSADD
FT                   SNGRIRSNGSADGGISLCYYPLSWIRGSKGSFYVFHFSPLRKVTIGEGAIAGFERRRDG
FT                   AVAIKYVRKFVASKMAELGIPLDVIDFIQGRKPTRVLTQHYISLFGIAKEHYRKYAEWL
FT                   SKSGVLSDD"
FT   gene            complement(122559..122655)
FT                   /locus_tag="SSOt06"
FT   tRNA            complement(122559..122655)
FT                   /locus_tag="SSOt06"
FT                   /product="tRNA-Lys"
FT                   /note="1 intron"
FT   gene            122786..124021
FT                   /gene="arsB"
FT                   /locus_tag="SSO0144"
FT   CDS_pept        122786..124021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="SSO0144"
FT                   /product="Arsenite transport protein (arsB)"
FT                   /note="Transport, Cell membrane transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40494"
FT                   /db_xref="GOA:Q980X8"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X8"
FT                   /protein_id="AAK40494.1"
FT                   /translation="MLISALIVMVITYCLIISRSITKIPPWASMFFGGILMVILGIISP
FT                   EEALQSINLDVILFLITLFTFASALEVSGFLKFLAYKIIEKFKEPRKVLFYILLYSGLL
FT                   SNLVTNDGVSASWTPVILELSRMIGVSEVPFLYALAVGVTIGSVIMPTGNPQNLLIALE
FT                   SGIKNPFITFTIYLTLPSIISLIIAYFILFRLFRKSLSLPSGINIKKEEEEKVDFDRRL
FT                   GYLTLTLLVVTIILFFSLSFFKIDILLGSLVTSSILLLLTEKRRDIVRRMDWPTILFFI
FT                   GLFIFTDGVLKSGIIQYLSNFLPPPDSVASIMIVSILLSQVLSNVPLVAIYIPIMISHS
FT                   GITVVDWLALAAGSTIAGNFTILGAASNVIISEASESRGGKGFNFVEFMKYTIPILIPN
FT                   AIIIYLFLVLFR"
FT   gene            124663..125556
FT                   /locus_tag="SSO0147"
FT   CDS_pept        124663..125556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0147"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40495"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X7"
FT                   /protein_id="AAK40495.1"
FT                   /translation="MIVVIGAGISGLLLSKRVKADLILEEQPVIGGVFASDNVFGKDLP
FT                   YVLPIINDPAKLPNIEFNYLEYDLKLSHRKYDYFEDKICKYCDKLPTWLNFGLMRKLYV
FT                   IENITAFIDNLSKNVRIIKEYPIRIDDKKIITNKGNMYKYTRVYNTASLKKMYKLLGVD
FT                   SSNLKHKAALTLLILTRKTNNKNWNVYLSGDTADSFSVVIKLDNIIKDLDLYYVYSFMD
FT                   ITQKSIDIDRVMLDLKRRQIISLDEIIAFRSKLISEALLFGEINHKITLNMVNCGRLGE
FT                   WKNYDVIETISRIQNC"
FT   gene            complement(125531..126319)
FT                   /locus_tag="SSO0149"
FT   CDS_pept        complement(125531..126319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0149"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Archaeal ORF"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40496"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X6"
FT                   /protein_id="AAK40496.1"
FT                   /translation="MVKKKVKRSKILIVGGFTIDEIQGKIRPGGPLIYSSLGVMRGGGI
FT                   PKLYGLIGRDFDFEIDFISDLEKQLIYDEYTIRFKIDLTNEGRKLILLKKPKNRIKVIS
FT                   DNTVDGILVNPVCKEVDNMSIQSPIPIAVDIQGFVRNCIEYEEIRYEMGFRFPFNSNYM
FT                   VMHGNREELESSKLELSDLFKVGFKEIIVSDGHNGFNVYTNMLAKYTYRPSKIGKNEIG
FT                   TGDFLLGAYFALRLGGLEIIEAATIAGKLTEEFSNSEFLI"
FT   gene            complement(126291..126647)
FT                   /locus_tag="SSO0150"
FT   CDS_pept        complement(126291..126647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0150"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40497"
FT                   /db_xref="GOA:Q980X5"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X5"
FT                   /protein_id="AAK40497.1"
FT                   /translation="MVVRKEWVLNIIYLIYITILSMSTRWLPKWKAIEIDYNNKKVTVC
FT                   YDEVTRLYVCPICSPNCAKGVSTDYSTYFFNLEDLKRHLDAHKYGLWLQKKTRTEEEEE
FT                   EPKLSIGEEESEEE"
FT   gene            127134..127763
FT                   /gene="hpS-1"
FT                   /locus_tag="SSO0151"
FT   CDS_pept        127134..127763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpS-1"
FT                   /locus_tag="SSO0151"
FT                   /product="D-arabino 3-hexulose 6-phosphate formaldehyde
FT                   lyase (hpS-1)"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40498"
FT                   /db_xref="GOA:Q980X4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X4"
FT                   /protein_id="AAK40498.1"
FT                   /translation="MSSSLDDYPLSLKTMYDIAEFILRAAKAIKPEQTIKMVNELENFY
FT                   KNNRNGKVLVMGAGRSGLVGRAFAMRLLHLGFNSYVLGETIVPAIGKNDIVVAISGSGR
FT                   TKLILTAAEAAKEAGAKLISITSYFDSPLAKISDVVIEIPGRTKYSKNEDYFARQILGI
FT                   TEPLAPLGTLFEDTTQIFLDGIVAELMIRLKKTEEDLRLIHANIEL"
FT   gene            127806..129608
FT                   /locus_tag="SSO0152"
FT   CDS_pept        127806..129608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0152"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40499"
FT                   /db_xref="GOA:Q980X3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X3"
FT                   /protein_id="AAK40499.1"
FT                   /translation="MGIENFTAKIVGLSIVSLLVVLMFLYKLIYIIPLIFIVLLVFQSE
FT                   KKIFAFLSKNTKQIQPYSIEDGVFYNEKNASAVLIIDDIQMDYKDFTNSNLRSFISSFH
FT                   KILDIAKDINIVLKRESLDKNVYIESLSQKIQALRIMIDSDPSNEKAKRKLELMETIIS
FT                   RIESGENPFRYEMYIIINSRDKNSALSTASMIRQGLEGLGIKTRLATLHEIQKLVRDFF
FT                   HSKLNLNKIALPTQIPYLTPISVEKKPKSSIIIDGVLLGKDINNNGLVFWNITKSQNSH
FT                   LLIVGPTGSGKTEFLIWLSTILNLIYGGTVILFDVKGDIKYRLSMYKVPFQLINPLFYR
FT                   LGLLDEYDIPIRIKLLQIEKILLNSFRLSKFNSSILYNYLNRLIDISYLKYRIKWKDLE
FT                   KYLSEIDDVQLKYYLSKLINILSSMEDSELPPLLHGVNENEINLIDLTLIKSEEIKRLI
FT                   IYTLIQELYNKFSLEKIYDKPRVFLVLDEAWTILKNESEDYPIVADLIKRGRGYGISII
FT                   MATQNLEDLGDLANIYLDNIGVSVFMNNGDKKFWEEIRRFVNVDNDTLSNNLIFMNRGE
FT                   ALVRFLGDPRPVIIKLNTLAGSSF"
FT   gene            complement(129588..130016)
FT                   /locus_tag="SSO0154"
FT   CDS_pept        complement(129588..130016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0154"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40500"
FT                   /db_xref="UniProtKB/TrEMBL:Q980X2"
FT                   /protein_id="AAK40500.1"
FT                   /translation="MMSVNTDELKKFLESKITSLRKELEFYEFLLSIIESGYIPTIKGN
FT                   KGSIEYIKNKKGEILAEIYFTPPVAKFVIKNKITLSKSYFSALSKILESEKELNKIDYT
FT                   IEMDKNDIREIVLKNVNSDIIYNKIKTGIQAILERATG"
FT   gene            130070..131128
FT                   /gene="argC"
FT                   /locus_tag="SSO0155"
FT   CDS_pept        130070..131128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="SSO0155"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   (argC)"
FT                   /EC_number="1.2.1.38"
FT                   /note="Similar to (AP000061)[Aeropyrum pernix]; Amino Acid
FT                   Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40501"
FT                   /db_xref="GOA:Q980X1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980X1"
FT                   /protein_id="AAK40501.1"
FT                   /translation="MKDKVRVAVVGGSGYTGGELLRILVTHPKTEISVITSREYAGKPV
FT                   SLIHPNLRGLISLNFTNFSIDKISDKADAIFLALPHGVSLNYAPKLLDLGLTVVDLSAD
FT                   FRLKNPELYKIWYNYEHPYPDLLDKAVYGLPELHYEELKNAKLIASPGCNATATILALA
FT                   PIVATKITDEKKFISDVKVGSSEGGAKPSEGSHHPERQNAIRPYEAEGHRHAAEAEQEL
FT                   SRIAKANISVSIVPHAVSSIRGALASAHTWLTNELEEIEIWKKIAEFYRGKRFIRIIRG
FT                   NIHPYPDPKFVIGSNFADIGFAVEKRISRLTTFSAIDNLMKGAAGQAVQAFNISMGFNE
FT                   DDGLKLVPLRPA"
FT   gene            131130..131924
FT                   /gene="argB"
FT                   /locus_tag="SSO0156"
FT   CDS_pept        131130..131924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SSO0156"
FT                   /product="Acetylglutamate kinase (argB)"
FT                   /EC_number="2.7.2.8"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40502"
FT                   /db_xref="GOA:Q980X0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980X0"
FT                   /protein_id="AAK40502.1"
FT                   /translation="MIVVKIGGRVVKNSLDKIILDILNINDKVILVHGGGDIVTDYTKR
FT                   LGIEPVFVTSPEGIRSRYTTKEELEVYIMAMSLINKSITSKLCSLGKNAIGITGVDGGL
FT                   LLAERKKRIVVIDERGKKRIIEGGYTGKVKEVRSEIINHLVKLFDIIVVSPIALDVEER
FT                   TPLNIDGDQAAFAISKALRANVLILLSDVEGVLVEGKVINRLTPSEAKELSKKIGPGMN
FT                   RKLLMAAESVENGVNKVIIGSGVKDRPIINALELNGTVIANG"
FT   gene            131917..132345
FT                   /locus_tag="SSO0157"
FT   CDS_pept        131917..132345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0157"
FT                   /product="Transcriptional regulator"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40503"
FT                   /db_xref="GOA:Q980W9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W9"
FT                   /protein_id="AAK40503.1"
FT                   /translation="MGNANIDESDLKILEILKKNARTPYTLIAKELKVSEAAIRKRIEK
FT                   LIRQGIIKRFTIEYELENEIRAIVMVQSTPQIPTPEISKKIAKIPGVEVVYETTGDYDI
FT                   LVIVRGTNITSINRTIDEIRSIQGVVGTNSTIILRTWF"
FT   gene            132412..132582
FT                   /locus_tag="SSO5317"
FT   CDS_pept        132412..132582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5317"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Conserved link to gene encoding 54aa rimk-homolog
FT                   (thermus thermophilus)"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40504"
FT                   /db_xref="GOA:Q980W8"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W8"
FT                   /protein_id="AAK40504.1"
FT                   /translation="MVNLKCPICGGEITVEDDALPGELVEHECGAQLEVVKQNGKLSLR
FT                   LAEQIGEDWGE"
FT   gene            132570..133430
FT                   /gene="rimK-1"
FT                   /locus_tag="SSO0159"
FT   CDS_pept        132570..133430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK-1"
FT                   /locus_tag="SSO0159"
FT                   /product="Ribosomal protein S6 modification protein
FT                   (rimK-1)"
FT                   /note="Translation, Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40505"
FT                   /db_xref="GOA:Q7SI95"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7SI95"
FT                   /protein_id="AAK40505.1"
FT                   /translation="MGRVKIGILYDMPRWEEKNLIEEGKKLGYQVATIYSKDFVLFSND
FT                   FTIDNDTDLFIQRNVSHNRALITSFLVEQVGYPVINDHTTLIRCENKIFTTYILARHNI
FT                   PTPKTFIAFDKTNAIEYSKKLGYPVVIKPVEGSWGRMVAKADNLDVLYSYLEYQEFSTQ
FT                   KYKDIYYIQEFVNKPNRDIRIFVIGDETPVGIYRVNENNWRTNTALGAKAYPLKIDEEL
FT                   RELALKVKDIIGGFFLGIDIFEDKDRGYLVDEVNGVPEYKNTVRVNNFNVSKFLLEKAA
FT                   EWVKK"
FT   gene            133415..134593
FT                   /gene="argD"
FT                   /locus_tag="SSO0160"
FT   CDS_pept        133415..134593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="SSO0160"
FT                   /product="Acetylornithine aminotransferase (argD)"
FT                   /EC_number="2.6.1.11"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40506"
FT                   /db_xref="GOA:Q7SI94"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7SI94"
FT                   /protein_id="AAK40506.1"
FT                   /translation="MGEKMIKLLKFYQDRGIKIIKGEGQYVWDEKNNKYLDMHAGHGVA
FT                   FLGHRNKVIIDHLKKQMEEISTLSLAFDTPIREEMIKELDELKPEDLDNLFLLNSGSEA
FT                   VELALKIARKITKRRKIVAFKNSFHGRSMGALSVTWNKKYREPFEPLIGPVEFLEYNNV
FT                   DSLKSITEDTAAVIVEPVQGEGGVIPAKKEFVKSLREVTEKVNALLIIDEVQTGFGRTG
FT                   KIWAYQHFDIKPDILTAGKAIGGGFPVSAVFLPNWISEKIEEGDHGSTYGGNPLAAAAV
FT                   TAACKVAKSEKIAEQAQKKGELFMRILKEKLEDFKIVREIRGLGLMIGIDLKVNPSIAI
FT                   KVLQDEKVLSLKAGLTTIRFLPPYLITQSDMEWASDATRKGISETESKRVAS"
FT   gene            134541..135581
FT                   /locus_tag="SSO0162"
FT   CDS_pept        134541..135581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0162"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40507"
FT                   /db_xref="GOA:Q980W5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W5"
FT                   /protein_id="AAK40507.1"
FT                   /translation="MLQEKELVKQKAKELLLDLLSIYTPSKSEANATKFFEKISKDLNL
FT                   KLEILPDSNSFILGEGDILLASHVDTVYGYIEPKIENELIYGRGAVDAKGPLISMIIAT
FT                   WLLNEKGIKVRVSGLADEESTSIGAKELIAKNYNFKYIIVGEPSNATDIVVEYRGSIQL
FT                   DIMCEGTPEHSSSAKNNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKL
FT                   YLHLDIRYAINNKREDLIKEITDKFPECNLKIVDETPPVKVSINNPVVKSLARALLKQN
FT                   IKPRLVKKAGTSDMNILQRITTNIATYGPGNSMLEHTTQEKISLDEIYIGVKTYMLAIE
FT                   ELWQKI"
FT   gene            135566..136354
FT                   /locus_tag="SSO0163"
FT   CDS_pept        135566..136354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0163"
FT                   /product="Undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40508"
FT                   /db_xref="GOA:Q980W4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W4"
FT                   /protein_id="AAK40508.1"
FT                   /translation="MAKDLTRGLLFKPIYKLYELVLWNQIRNGPLPDHVGIIPDGNRRW
FT                   ARDNNLSLNDAYFYGYKKLKEVLIWLLELGIKNITVFVLSTENCDKRKQNELSIITTYI
FT                   KRGIQDLLEDPIVDKYEVKVSAIGKLDKLPKDLIDYLNRVVEKTSNYDKRKLTLAICYG
FT                   GRQEILDAVVRLLDDYRNGKIVKSEINEETFRKYFYDSELQDIDLVIRTSGEVRISNFL
FT                   LWHVAYSELFFCEAYWPEFRKIDLWRAIRSFQKRKRNFGA"
FT   gene            136398..136799
FT                   /gene="rps8E"
FT                   /locus_tag="SSO0164"
FT   CDS_pept        136398..136799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8E"
FT                   /locus_tag="SSO0164"
FT                   /product="LSU ribosomal protein S8E (rps8E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40509"
FT                   /db_xref="GOA:Q980W3"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="PDB:2KCO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W3"
FT                   /protein_id="AAK40509.1"
FT                   /translation="MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIK
FT                   DRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGAKIRT
FT                   EAGLAVVTSRPGQDGVINAVLLKNESQRS"
FT   gene            136780..137088
FT                   /locus_tag="SSO0165"
FT   CDS_pept        136780..137088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0165"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40510"
FT                   /db_xref="GOA:Q980W2"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="PDB:3KTW"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980W2"
FT                   /protein_id="AAK40510.1"
FT                   /translation="MSLRDLKEENRIVIWPSYFFSPTRSKGRRLARIPYKIKTEELVST
FT                   LRELGLDPIVIENKKYPRDRKINFLIAVKKVKSKNYTLKIIHNALMGTRQTNPNKSN"
FT   gene            137128..138063
FT                   /gene="galE-2"
FT                   /locus_tag="SSO0166"
FT   CDS_pept        137128..138063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE-2"
FT                   /locus_tag="SSO0166"
FT                   /product="UDP-glucose 4-epimerase (galE-2)"
FT                   /EC_number="5.1.3.2"
FT                   /note="Energy Metabolism, Sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40511"
FT                   /db_xref="GOA:Q980W1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q980W1"
FT                   /protein_id="AAK40511.1"
FT                   /translation="MYIVTGGAGYIGGHLVDYLISKNLEVIVIDDLSYGKYRNEKAKFV
FT                   MFDLRQNMGELVEKLEKNPIIYHLAANPDVRTSMINVEEHFERDVKVTLNVMELARRVD
FT                   AEKVIFTSSSTVYGETSKIPTPESEELKPISNYGLFKLLCENIVKYYAEQYGIKSISTR
FT                   LANITGGRVSHGVVIDFIKKLKDNPNLLEILGNGKQRKSYLYIDDLIEAFVMLEKKVNR
FT                   IYDVFNIGNNDSITVDEIAKIVIDEMKLSPRITYKNPTADGRGWPGDVRLMLLDISKIS
FT                   REVGWSPKMSSREVIRQAVKDLLYGYKSVY"
FT   gene            complement(138351..138445)
FT                   /locus_tag="SSOt07"
FT   tRNA            complement(138351..138445)
FT                   /locus_tag="SSOt07"
FT                   /product="tRNA-Lys"
FT                   /note="1 intron"
FT   gene            complement(138497..139618)
FT                   /locus_tag="SSO0167"
FT   CDS_pept        complement(138497..139618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0167"
FT                   /product="Methyl coenzyme M reductase system, component A2
FT                   homolog"
FT                   /note="Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40512"
FT                   /db_xref="GOA:Q980W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980W0"
FT                   /protein_id="AAK40512.1"
FT                   /translation="MLIISPKYLNGKIEIEKGERVGLVGKNGSGKTTLILSALCLDQTT
FT                   SNVTVDDLDFCKEKDYSKISAVLQDVSSQILASTLKDEIELMKRFHSVDDKIARNLMGH
FT                   YYEVEFNKLSDGYKKRYAIASVLASNPEYILLDEPFANLDDKGVKSVSTIVPKNSLIAE
FT                   HRIEELRKLVDRVYMIRNNKEINEISKEKLFDIEFLRKEGLRGFSLPKINSELGNEILN
FT                   VNIDNFTIKIREGEILCLLGRNGSGKTTILRKLSKKIFVIFQEVDLQFFYFTVREIVRS
FT                   KRVLSLFKLENLADKSPYALSFGQKMRILIASAFSSDSRVIGLDEPSVGMDGEALLSFY
FT                   EMVKMLKEQKRGLILATHDKDIISLCDTRIVID"
FT   gene            complement(139591..140172)
FT                   /locus_tag="SSO0168"
FT   CDS_pept        complement(139591..140172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0168"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40513"
FT                   /db_xref="GOA:Q980V9"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V9"
FT                   /protein_id="AAK40513.1"
FT                   /translation="MKVKFLYILLFSVIMYINSIFFNFFVPFLVTLAILYRRIWIIVIE
FT                   VLIGILSFLILSFLGKIFVYEYTLRAFSIINVFLISSEYTDKSSIIDLFGSKGVPLVIA
FT                   LTYYPRFYEMIQKVVFYARIRNINLLNLNRLLLPIIVETVKIADNLYVAYTVKLFGKYN
FT                   YKRNLKPSSGDLILLLIGVVTLCLSLVLNI"
FT   gene            complement(140169..140723)
FT                   /locus_tag="SSO0169"
FT   CDS_pept        complement(140169..140723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0169"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40514"
FT                   /db_xref="GOA:Q980V8"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V8"
FT                   /protein_id="AAK40514.1"
FT                   /translation="MNDKSSSQISIRRAVIYAAVFSIASYAVAAGLALSTGLFAVNIFA
FT                   DPILNLTVPLILLSIGIQVINRKLGPIFIGLISAGLYAVSFLPFIAIPLIIIALIVEGV
FT                   TRVMGYRSLKAVITYTAIAGGLEGVLSTLLALYMVKVPAPVITSAYIWTGVAVGMFAES
FT                   ALMGLISFYIVSYLIRAGVIK"
FT   gene            complement(140783..142498)
FT                   /gene="ilvB-1"
FT                   /locus_tag="SSO0170"
FT   CDS_pept        complement(140783..142498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB-1"
FT                   /locus_tag="SSO0170"
FT                   /product="Acetolactate synthase large subunit homolog
FT                   (ilvB-1)"
FT                   /EC_number="2.2.1.6"
FT                   /note="Amino Acid Biosynthesis, Pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40515"
FT                   /db_xref="GOA:Q980V7"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V7"
FT                   /protein_id="AAK40515.1"
FT                   /translation="MTPVISRVRIPPPAFRRDLKSSSNYNVSMSQPKRKEETVGVEMKG
FT                   EEALAYVLNDIGLTKVFTTYSLPNIVKEMLKKYNIEVDFSISVKDASWLAYAYAMENNS
FT                   VGTIIQIPGSKLTDAVDVIAQAYMESVPLLIISSVRSHKDTGRARIGEFRTIDDLSNIL
FT                   SPIIKTKERVISIEEITVTIEKAYKEAVSNRPRPSYVEISEDLFRAKAYPLSTAGQKPE
FT                   KRTPDKNSVAKVAELLTNAKLPVIIAGYGVVLSDAEDMLVELAELIDSPVVTTFKAKGS
FT                   IPSNHKLFAGEGLGAFSTSAANYLIENADVILALGTRFTQLSTAGWSLKYKGILVHNNV
FT                   DGEDIGKVFMPHVPIVADTGLFLRELLTQLKAKIKEKINRGASDIIYKTQRQAYPITSH
FT                   NDIWPIDVVKMLSSIGGFEKVYVDISATTIDLVRLPINAKKTWYTAESLLERGIAVGGI
FT                   IASKYVAYGITDIEGILPHLSLLKYKMDKIKGKLIILNDGGANYIEVSNSDLPTIARSQ
FT                   TSFNANFDEIAEKALGGVTVNTLTELEEALKSVDKKIINVKIDPNFESVILSRI"
FT   gene            complement(142457..142570)
FT                   /locus_tag="SSOt08"
FT   tRNA            complement(142457..142570)
FT                   /locus_tag="SSOt08"
FT                   /product="tRNA-Cys"
FT                   /note="2 introns"
FT   gene            142612..143181
FT                   /locus_tag="SSO0171"
FT   CDS_pept        142612..143181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0171"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40516"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V6"
FT                   /protein_id="AAK40516.1"
FT                   /translation="MHMLIPFSKVGEVLHELQDLTKFIIIGDTIVDITLKRKGTESDVD
FT                   LFALDISVLVDDDKIRNFAYERGWDYGRTPIDTPRLLAPIDDDQLQIDLYENIQDFFVP
FT                   KEILESAINIKIGGYEFKSIRLEDYILLKANAFREEDEDELKTLLYLLGEGKISIDKEY
FT                   LKEHIQAFEENSESIKERLSSIGIKI"
FT   gene            complement(143195..143365)
FT                   /gene="rpl40E"
FT                   /locus_tag="SSO5336"
FT   CDS_pept        complement(143195..143365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl40E"
FT                   /locus_tag="SSO5336"
FT                   /product="LSU ribosomal protein L40E (rpl40E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40517"
FT                   /db_xref="GOA:Q980V5"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="PDB:2AYJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980V5"
FT                   /protein_id="AAK40517.1"
FT                   /translation="MPLTDPAKLQIVQQRVFLKKVCRKCGALNPIRATKCRRCHSTNLR
FT                   LKKKELPTKKG"
FT   gene            143428..143940
FT                   /locus_tag="SSO0172"
FT   CDS_pept        143428..143940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0172"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40518"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V4"
FT                   /protein_id="AAK40518.1"
FT                   /translation="MKMKIPLDYVCVRSGLLCNRCQSLIDSGEVFEYEVEIIKILLDLE
FT                   ETQFKELKDSTYHKAYKVDDLLILLVTSGQEMTQQKWIKIARILQEKLNIKVRVLEKTN
FT                   SIKNSAVQLLSPARVLGVNTVWMPDGSVQYVIRVSRSERRLLPAEAQLLESALTKIHST
FT                   PVRIRVE"
FT   gene            143942..145231
FT                   /gene="aspS"
FT                   /locus_tag="SSO0173"
FT   CDS_pept        143942..145231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="SSO0173"
FT                   /product="Aspartyl-tRNA synthetase (aspS)"
FT                   /EC_number="6.1.1.12"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40519"
FT                   /db_xref="GOA:Q980V3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980V3"
FT                   /protein_id="AAK40519.1"
FT                   /translation="MFRTHLVSELNPKLDGSEVKVAGWVHNVRNLGGKIFILLRDKSGI
FT                   GQIVVEKGNNAYDKVINIGLESTIVVNGVVKADARAPNGVEVHAKDIEILSYARSPLPL
FT                   DVTGKVKADIDTRLRERLLDLRRLEMQAVLKIQSVAVKSFRETLYKHGFVEVFTPKIIA
FT                   SATEGGAQLFPVLYFGKEAFLAQSPQLYKELLAGAIERVFEIAPAWRAEESDTPYHLSE
FT                   FISMDVEMAFADYNDIMALIEQIIYNMINDVKRECENELKILNYTPPNVRIPIKKVSYS
FT                   DAIELLKSKGVNIKFGDDIGTPELRVLYNELKEDLYFVTDWPWLSRPFYTKQKKDNPQL
FT                   SESFDLIFRWLEIVSGSSRNHVKEVLENSLKVRGLNPESFEFFLKWFDYGMPPHAGFGM
FT                   GLARVMLMLTGLQSVKEVVPFPRDKKRLTP"
FT   gene            complement(145235..146368)
FT                   /locus_tag="SSO0174"
FT   CDS_pept        complement(145235..146368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0174"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40520"
FT                   /db_xref="GOA:Q980V2"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980V2"
FT                   /protein_id="AAK40520.1"
FT                   /translation="MTPHEIDIALGMEKYYYEDWNELDGTIERPNGFKVIEEIDFKPAQ
FT                   DWKGETKGKYAVFLLTKWGIDHFSAISEVQKVLHSKVNYIGIKDANAITSQLVYIPLNE
FT                   KQELIEKYQSRSFILKFLGFSSKKLNHTGNIFEISLSISDFDIVIERIEQIKKNPYLPA
FT                   FIGYQRFGTRRPITHLIGKYLLRRDWEKAFYLILTYPFLSESKETIDIRKLIMEGDFKE
FT                   AVRSIPSKFKQEKLLLKNYMRFNSYYLALKSSFIPISLYLDAYQSYLFNLYLSRKLDEY
FT                   KNLNDKVNLLIRIPIYFNNCDDVCKEIYLDEGIERNFFKLQEFKISLRDLVRKAFMNIR
FT                   DLKVNEETKTISFVLERGMYATILLREILRGDPRKFT"
FT   gene            complement(146365..146727)
FT                   /locus_tag="SSO0175"
FT   CDS_pept        complement(146365..146727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0175"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40521"
FT                   /db_xref="GOA:Q980V1"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="PDB:1XTY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980V1"
FT                   /protein_id="AAK40521.1"
FT                   /translation="MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINSNNLRWKEW
FT                   LNEWLHQGQPKIIVKVNSLDEIISRAKKAETMNLPFSIIEDAGKTQLEPGTITCLGIGP
FT                   APENLVDSITGDLKLL"
FT   gene            146792..146989
FT                   /locus_tag="SSO5343"
FT   CDS_pept        146792..146989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5343"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to MJ0458.1, Ta0567, AF0573"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40522"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:Q980V0"
FT                   /protein_id="AAK40522.1"
FT                   /translation="MSVKLSIREEVEPPICSSCGKIIHPREKGVEFYCPNCGEVLIRRD
FT                   HMCRKQGAEYICPNCGFKGP"
FT   gene            147003..147278
FT                   /gene="EF1B"
FT                   /locus_tag="SSO5345"
FT   CDS_pept        147003..147278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EF1B"
FT                   /locus_tag="SSO5345"
FT                   /product="Translation elongation factor EF-1, beta subunit
FT                   (EF1B)"
FT                   /note="Translation, Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40523"
FT                   /db_xref="GOA:Q64214"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64214"
FT                   /protein_id="AAK40523.1"
FT                   /translation="MTDVLVVLKVFPDSDEVNLDNLYTDISSKLPKEYKIIRKETEPIA
FT                   FGLNALILYVQMPEQTEGGTDNLEEVVNNIQGVSHAEVVGITRLGF"
FT   gene            147343..149652
FT                   /locus_tag="SSO0176"
FT   CDS_pept        147343..149652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0176"
FT                   /product="AAA family ATPase"
FT                   /note="Similar to confirmed SAV protein (S.
FT                   acidocaldarius); Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40524"
FT                   /db_xref="GOA:Q980U9"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U9"
FT                   /protein_id="AAK40524.1"
FT                   /translation="MSASSGEEQKPQRKELILRVMEARQKDVGRGKVRIDIDLLSQIDV
FT                   SPGDVVEIEGTRKTAALAWPLSPEDTTTGEKDIIRMDGITRKNAGVSIGDKVIVRKAIV
FT                   KPASTVKLAPSNFSITVDPGFISYVKKRLKEFPLVEGDTVLIPVLGQAIPFTVVQVKPA
FT                   GIVLVNDDTIISISDKPVEPSRYPRVTYEDIGGMKNIIEKVRELVELPLRHPELFKRLG
FT                   IEPPKGILLYGPPGVGKTLLAKAIANETDAYFTSINGPEIMSKFYGESEQRLREIFEDA
FT                   KKHAPAIIFVDEIDAIAPKRDEVIGEVERRVVAQLLTLMDGLENRGNVIVIAATNRPSA
FT                   VDPALRRPGRFDREIEIPLPDKQGRLEILQIHTRNMPLSKDVDLEKLADMTHGYTGADL
FT                   SALVREAAMNSLRRYLPKIDLNQDKIPPEILESMEVKMEDFINAFKEIVPSGLREIYIE
FT                   VPEVKWTDIGGLEEIKEELKEVVEYPLKYSELYQNSGIEPPKGILLFGPPGTGKTMLAK
FT                   AVATESGANFIAVRGPEILSKWVGESEKAVREIFRKARMYAPAVIFFDEIDSIAPIRGI
FT                   SYDSGVTERIVNQLLAEMDGIEKLENVVVIAATNRPDILDPALLRPGRFEKLIYVPPPD
FT                   KRARTEILKVHTRNIALGEDISLEDVAEKTEGYTGADLAALVREATMRAIRESMKICID
FT                   KTNENCKPTDAECRDKTMKECMKVNGVKVSLRHFEEAMRKVKPSVTQDMLQFYQNWVEK
FT                   ARQQLPKTTVKPSTYA"
FT   gene            150044..150952
FT                   /gene="rad2"
FT                   /locus_tag="SSO0179"
FT   CDS_pept        150044..150952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rad2"
FT                   /locus_tag="SSO0179"
FT                   /product="DNA repair endo/exonuclease FEN-1 (RAD2) (rad2)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40525"
FT                   /db_xref="GOA:Q980U8"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="PDB:2IZO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980U8"
FT                   /protein_id="AAK40525.1"
FT                   /translation="MDSQGRVTSHLSGLFYRTINILEEGVIPIYVFDGKPPEQKSEELE
FT                   RRRKAKEEAERKLERAKSEGKIEELRKYSQAILRLSNIMVEESKKLLRAMGIPIVQAPS
FT                   EGEAEAAYLNKLGLSWAAASQDYDAILFGAKRLVRNLTITGKRKLPNKDVYVEIKPELI
FT                   ETEILLKKLGITREQLIDIGILIGTDYNPDGIRGIGPERALKIIKKYGKIEKAMEYGEI
FT                   SKKDINFNIDEIRGLFLNPQVVKPEEALDLNEPNGEDIINILVYEHNFSEERVKNGIER
FT                   LTKAIKEAKGASRQTGLDRWF"
FT   gene            151633..152913
FT                   /locus_tag="SSO0180"
FT   CDS_pept        151633..152913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0180"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40526"
FT                   /db_xref="GOA:Q980U7"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980U7"
FT                   /protein_id="AAK40526.1"
FT                   /translation="MSKDEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLKQLINA
FT                   EFAILQTCNRVEIYLYSDTNTLKEVNKIIQYLNNIHNEPIGNQARVLCGKDAAKHLFLV
FT                   ASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQIFFERAIKVGRKVREETSISKGK
FT                   VGIYSLAIDEAKKRFNDFYDRRILVIGAGEMAQKITSMLHNEGAKDVTIMNRTIEKAKQ
FT                   LALKFGYNYEKLDLDKLGNFDVAFISIYHENLRLENKWNTLIVDITVPPLFTGNNVITL
FT                   EELERISNLNFKAREEELAKINKLVEDGINELLYDYKKEIYTEFMSKIMKRIETIRENE
FT                   ILRAYKELEKLGINDQQAKEILDLMTRSIIKKSFQPLFDNIRSLIFNGENSINYINFLI
FT                   DIFKDGNISGFETEKIKEKQVSERSSI"
FT   gene            152828..153853
FT                   /locus_tag="SSO0181"
FT   CDS_pept        152828..153853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0181"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40527"
FT                   /db_xref="GOA:Q980U6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U6"
FT                   /protein_id="AAK40527.1"
FT                   /translation="MIFLKMVTFPVLRPRRLRKSKLVRDLVSETSISQNDLVLPVFIKE
FT                   NINEPEQIASMPGIYRYPPNDKLINYLQDSYENGIRSVILFGIPSYKDDIASSAYDKNG
FT                   IIQRAVRIIKDSFKDKIIVITDECTDEYMANGHCGLVKYTNGCYVVDNDESLKIHAKIA
FT                   LSQAEAGADVIAPSSMMDGVVRAIRDALDSAGYIDTLILSYSVKYASVMYGPFRDAAYS
FT                   KPAFGDRRGYQMDPRNAFEAIKEARLDIEEGADILMVKPAHTYLDVIRLVKDHFPEYPL
FT                   AAYHVSGEYSMIKAAAINGWIDEKTAVLEITTAIKRAGADLIITYYANDIARWIKDGVP
FT                   F"
FT   gene            153826..155106
FT                   /gene="hemL"
FT                   /locus_tag="SSO0182"
FT   CDS_pept        153826..155106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="SSO0182"
FT                   /product="Glutamate-1-semialdehyde aminotransferase (hemL)"
FT                   /EC_number="5.4.3.8"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40528"
FT                   /db_xref="GOA:Q980U5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980U5"
FT                   /protein_id="AAK40528.1"
FT                   /translation="MDKGRCTILNSEELWAQAKQLFAGGVNSPVRAAVKPFPFYVERGK
FT                   GAYIYTVDGKKFIDYVLGYGPLILGHSPESVKRRIVEQLERGWLFGTPSELEIELARKI
FT                   RSHIPSAQKIRFVNSGTEATMAAIRLARGYTKRSKILKFSGNYHGAHDYALVEAGSAAT
FT                   EYNVATSDGVPMEIMKTVEICEFNDLDCVDKKLRNEDIATVILEPVMGNAGVILPEKDF
FT                   LFGLRELTKTYNSLLIFDEVITGFRISIGGAQSYYQIYPDITTLGKIIGGGFPIGAVAG
FT                   KAEIIDNFTPAGKVFNAGTFNANPISMIAGIATIEELEKEYPYIIANQAAKTLVEELER
FT                   LLKTKHTINHVGSMFQIFFGIDEVRNYSDAKRADKEYYIKFHERLLKEGVFIPPSQYET
FT                   IFTSAAHKDDVIADTIDKLMKVIGELN"
FT   gene            155103..155984
FT                   /locus_tag="SSO0183"
FT   CDS_pept        155103..155984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0183"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40529"
FT                   /db_xref="GOA:Q980U4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980U4"
FT                   /protein_id="AAK40529.1"
FT                   /translation="MKILIAARGSKLSRVQVDMVGEKLRKIGIEYDVIDIKTKADLFST
FT                   EPLSKLGKGVFEKEVNEAVLEGKADVAVHSMKDILSEINPELEIFAVIERDPPYDILIA
FT                   EKNLHKLDPNTTIGTSSIRRKNFIKYIRPEINTKDIRGNVDTRIRKYLSKEYDGLILAE
FT                   ASIKRLNISISYHRLNVYDFTPEANQGIIVVLGRKKDEKVKEVFKEITHKDTLDEALAE
FT                   RATISVVGGGCHSPIGVLFRKEGKEFYGIASYSDGKKKITVSISKAGDPYTIGSELGLL
FT                   LKKEMKNEGIIP"
FT   gene            155965..156678
FT                   /locus_tag="SSO0184"
FT   CDS_pept        155965..156678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0184"
FT                   /product="Uroporphyrinogen III synthase, putative"
FT                   /EC_number="4.2.1.75"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40530"
FT                   /db_xref="GOA:Q980U3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U3"
FT                   /protein_id="AAK40530.1"
FT                   /translation="MRVLFLRPDNEDNELNEKLMILRKNGIEVLNIPIFKIKCVSYSLP
FT                   TYDYEALAFTSRNSVICFKDRTLIKNVHKIYAIGEETAELLMKMYNVNPITPERFTSIE
FT                   LAKRILEDKVNSILSIRSRKASEDMRNILNGKIKYDEIYVYDSEIIRDNINEISKILTE
FT                   CEVDAIAFTSSLMAKLIGPFIRGKCNIIIFSIGPMTTETLKRVNNKVKIIESKTHSIKG
FT                   IIETILVEMKRNGRD"
FT   gene            156923..158560
FT                   /locus_tag="SSO0185"
FT   CDS_pept        156923..158560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0185"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40531"
FT                   /db_xref="GOA:Q980U2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U2"
FT                   /protein_id="AAK40531.1"
FT                   /translation="MRDLKTLLIVIDGVSYSVFNQFRYNLDTMNNLIENGSFGKLESVF
FT                   PTITPVALASLFTGYLPLNHGITSTKIFIKGNSLSKPLSAHSSTPLKVDPIWYLLAKKG
FT                   YKVVVASAPQALPDKWKLKNLTLFDPYKSKIKECSDGALLNIGNTTINEVNFDIESNNN
FT                   EYTIKITDIENNTLSLKLRQNEWTSPLEVIMGCKGKEMKGTFRLKGLSNGVYLTPVSFL
FT                   IPSWSNNQELQNEIWENVVKKYGMLLDGDYISLKSNIIGFSEYYETLKFAYEFFYNYSL
FT                   YLLKREEWDFAITYLPIVDNIQHLLFGVDDSQSLDYVFQVYKMADNFVKAHIELADNII
FT                   ICSDHGINKVKKRLYLNKFLEELNVLKTVDDKKIDWKRTKAYYGGGGIIRINLREREKF
FT                   GIVGKKEFNKLIKYLTINLERLEDPDTGERIFTVIYSNETPASDRQGDIMIDGVNPKYS
FT                   ISSNIEKDTIFENVIPYRTTTADHGYYRNDDINGIIIFYGKNFTKKQVNMKIVDVTPTI
FT                   LKLYGINCKSDGKIVNEVFKNGHADSTK"
FT   gene            158520..159971
FT                   /gene="soxA-like"
FT                   /locus_tag="SSO0186"
FT   CDS_pept        158520..159971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA-like"
FT                   /locus_tag="SSO0186"
FT                   /product="Sarcosine oxidase, subunit alpha related (soxA),
FT                   putative (soxA-like)"
FT                   /EC_number="1.5.3.1"
FT                   /note="Amino Acid Biosynthesis, Serine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40532"
FT                   /db_xref="GOA:Q980U1"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U1"
FT                   /protein_id="AAK40532.1"
FT                   /translation="MRSSKMDMPIVLSKRHRRLRSMKDCEPGLPYNEIVENGKRIDLCY
FT                   SKQYKKYTKKIEIRVGTSILHNKLLRIFPNIVKIYSKHFINLPDLITENTEKRELIFIE
FT                   LENLIIGGGTSGLGVLSEISKEEKTLLISSNIESNTDIPYPLPQINKDEFSKLLRDTIN
FT                   ENKDRILEGILLGKFDEGIGFLTKDKILMVRAKRVFLATGGRYIPPIFDGNDIPGIISK
FT                   NLYLRYGNRITKAIALGNSDDIIKVLFKVEKRVIINNGVLFLSKYYKELIDELGVEIIN
FT                   TNNLKVKREKGGMLKIITNERSFDSNILVYAIVKQPKIDHSYNIGIPYNFSEYFHIYMP
FT                   IHSIEGKTNDNIYIVGGMRGISDEYTSFLSGKTAVNEKYLDEFINNLKDYTYIYDYYYQ
FT                   KNPKENPSPYIYGNKGYVCECEDITLSEVNRQVGRGFSKVEEIKRTIGLGTGECQGKLC
FT                   TYSLGSFLGDRQLITFRTPLYRMVI"
FT   gene            159972..161090
FT                   /gene="soxB-like"
FT                   /locus_tag="SSO0187"
FT   CDS_pept        159972..161090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB-like"
FT                   /locus_tag="SSO0187"
FT                   /product="Sarcosine oxidase, subunit beta (soxB-like)"
FT                   /EC_number="1.5.3.1"
FT                   /note="Amino Acid Biosynthesis, Serine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40533"
FT                   /db_xref="GOA:Q980U0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q980U0"
FT                   /protein_id="AAK40533.1"
FT                   /translation="MIIIVGAGSHGLSLAYHLVKKGYSKKDITLVEWKRIGYGSSSRNA
FT                   ARYRYHFYSKENVEYAINAISYLKKQSKELEYNSLLLRTGYLWVINGEQEYSLFKKLDS
FT                   FWSSYNIGGKFIECKDNYAYIKFEGQCYLAPQDGAFHHDYILYSYYYSIKDKVSTIYDK
FT                   VVSLIKDDSKIKGVKLSSGKELYGDKVIVTAGAWSGEVLSSIGIEVPIFPEKKEIYITE
FT                   PLRYFLEPLIIDSKLQIYFSQTLKGEIIGGIEDKREYKFEEFTISISNAIKFLKGIREL
FT                   IKGIDGIGILRGWSGYYEMTPDSSQIMGYSNDWPEGLFIDAGYSGHGMMFAPYSGKIMA
FT                   DLIADNYKNKFIDIFSPSRFKLNKLINETLVI"
FT   gene            complement(161092..162078)
FT                   /locus_tag="SSO0188"
FT   CDS_pept        complement(161092..162078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0188"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE2295 and ORF2 in 3' LIG region
FT                   from Acidianus ambivalens"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40534"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T9"
FT                   /protein_id="AAK40534.1"
FT                   /translation="MQSLVKILPNGAILIGKRFTIDGHHERPFRVVTHFHADHITGLEK
FT                   SISISDGIIATPITLDILSLDYAIPPRKAFGLNYDIKMTFEDENIVLKKSDHVIGSAQV
FT                   LITLENGLEIGYTGDFKNPGKGTPILHPDILIIEATYGRPDFRRPFKDDVESLFADYVR
FT                   DALMYGPVRIYGYHGKLQEVMISLRKMGVDAPFIVGGKISKMTNIAIKYGYNISQVFDE
FT                   SQSEAKEIMRDSWYISFSHYNEFKRRNGKYYNFLLSGWEFKNVVKKIDEKSYTVSFSDH
FT                   ADFDDLIYYVERTSAKYIITDGGRRSYGKELAEYISKKLGKIAISMP"
FT   gene            complement(162109..163914)
FT                   /gene="lig"
FT                   /locus_tag="SSO0189"
FT   CDS_pept        complement(162109..163914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="SSO0189"
FT                   /product="DNA ligase (polydeoxyribonucleotide synthase
FT                   (ATP)) (lig)"
FT                   /EC_number="6.5.1.1"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40535"
FT                   /db_xref="GOA:Q980T8"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="PDB:2HIV"
FT                   /db_xref="PDB:2HIX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980T8"
FT                   /protein_id="AAK40535.1"
FT                   /translation="MEFKVIAEYFDKLEKISSRLQLTALLADLLSKSDKTIIDKVVYII
FT                   QGKLWPDFLGYPELGIGEKFLIKAISIATNTDENSVENLYKTIGDLGEVARRLKSKQQS
FT                   TGILGFLGTTSKESLTVDEVYSTLSKVALTTGEGSRDLKIRLLAGLLKKADPLEAKFLV
FT                   RFVEGRLRVGIGDATVLDAMAIAFGGGQSASEIIERAYNLRADLGNIAKIIVEKGIEAL
FT                   KTLKPQVGIPIRPMLAERLSNPEEILKKMGGNAIVDYKYDGERAQIHKKEDKIFIFSRR
FT                   LENITSQYPDVVDYVSKYIEGKEFIIEGEIVAIDPESGEMRPFQELMHRKRKSDIYEAI
FT                   KEYPVNVFLFDLMYYEDVDYTTKPLEARRKLLESIVKPNDYVKIAHHIQANNVEDLKSF
FT                   FYRAISEGGEGVMVKAIGKDAIYQAGARGWLWIKLKRDYQSEMADTVDLVVVGGFYGKG
FT                   KRGGKISSLLMAAYNPKTDSFESVCKVASGFSDEQLDELQKKLMEIKRDVKHPRVNSKM
FT                   EPDIWVEPVYVAEIIGSEITISPLHTCCQDVVEKDAGLSIRFPRFIRWRDDKSPEDATT
FT                   TDEILEMYNKQPKKKIESPAVDESV"
FT   gene            164314..164934
FT                   /gene="dcD-1"
FT                   /locus_tag="SSO0190"
FT   CDS_pept        164314..164934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcD-1"
FT                   /locus_tag="SSO0190"
FT                   /product="Deoxycytidine triphosphate deaminase (dcD-1)"
FT                   /EC_number="3.5.4.13"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40536"
FT                   /db_xref="GOA:Q980T7"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980T7"
FT                   /protein_id="AAK40536.1"
FT                   /translation="MLDSPIHVGNVVLTLFNYNILDMILSDRDLKYYLEKSWIKIQPLR
FT                   EDTIRENGVDLRVGNEIARFKKTDKIFDPDNPDPSFFQTEKGEEFIIQPYEHVLLTTEE
FT                   YIELNNDVMAFVNLRSTFARLGLFIPPTIVDAGFKGQVTIEVVGSSFPVKLKRSTRFIH
FT                   LIFARTLTPVEYPYQGKYQGQKGVTLPKFNSQISSFYYQHQSI"
FT   gene            complement(164888..165574)
FT                   /locus_tag="SSO0191"
FT   CDS_pept        complement(164888..165574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0191"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE1364"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40537"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T6"
FT                   /protein_id="AAK40537.1"
FT                   /translation="MRIISIKLTDEEYKELEERARREGFVLLSDFVKSLLFSSSYPHGT
FT                   QVDNAQVVSRIEKKMQDMINPFTSQIDEIKQKVAMLTERIEILEEKLGESKDNMKDINK
FT                   KQKKSFESKSINVKSEPQHKKTAIDILREQGVIYESELKLNNPDAFFDKLETQGAIVIT
FT                   TDPERIAIDSNFYEEFKKKIANISTSDEIEVQKYLTKQEYKLFQKLRQYSVIYFDADSK
FT                   SWKFVS"
FT   gene            complement(165619..166320)
FT                   /locus_tag="SSO0192"
FT   CDS_pept        complement(165619..166320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0192"
FT                   /product="Glutaredoxin related protein"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40538"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T5"
FT                   /protein_id="AAK40538.1"
FT                   /translation="MEQEYAELFSDEVKNALQDALKDMKNPVDVYVFVDNTDSNCQYCG
FT                   VTTKFLEFMASAAPKDSNGSLLKVHIVDRANENSRKIFEEFNVERVPTVAFYNGYIRWT
FT                   GAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPSCPYCPYAAL
FT                   MAHMVAFEACRAGKCNVISEVIEAYENQDIAEKYQVMSVPAIAINESIEFIGVPYEENF
FT                   INAILEKQKIS"
FT   gene            complement(166515..167198)
FT                   /locus_tag="SSO0193"
FT   CDS_pept        complement(166515..167198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0193"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to PH0010, PAB0006, MTH857, MJ0810, AF1969,
FT                   APE1056, aq_1444, Ta0236"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40539"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980T4"
FT                   /protein_id="AAK40539.1"
FT                   /translation="MIQEELVQIQELNEEIGRLLIEIARKSIKEEFKLDKLDLSKYDNP
FT                   ILDKKGLAFVTLEKIAYNTSSLRGCIGYVEAVAPLKQIAASAAKAAAFSDPRFNPLQED
FT                   ELANIIIEVTVLTKPEEIKVKDRWDLPKIIKVGEDGLIVEKGILHSGLLLPQVPMEYCW
FT                   DEETFLAETCIKASLEPDCWLDSSVRIKRFHGIIFKETKPNGSDIIVIKPSDIKCKLNE
FT                   LINNL"
FT   gene            complement(167125..167655)
FT                   /locus_tag="SSO0194"
FT   CDS_pept        complement(167125..167655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0194"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE2177"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40540"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T3"
FT                   /protein_id="AAK40540.1"
FT                   /translation="MRTMLTQKFVVDSMLGKIARWLRIMGYDTLYSNDFEDWKILKIAE
FT                   TQKRIIITRDRGIYYRSLKRGLNCILLSPDSNIIQDLAFIALRSKIDLSVNINATRCPQ
FT                   CNSVLSKLSESMWLCPKCKKEYWKGRHWRTIEEIIIKANSELVKLETKNDSRGTGTDTG
FT                   VKRRDRTVTNRNS"
FT   gene            167915..169744
FT                   /locus_tag="SSO0195"
FT   CDS_pept        167915..169744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0195"
FT                   /product="Membrane conserved hypothetical protein"
FT                   /note="Putative fibronectin-binding protein. Similarity
FT                   with PAB1903, PH1465, APE1611, MTH1907, Ta1418, MJ1625,
FT                   AF2038; Cell Envelope, Membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40541"
FT                   /db_xref="GOA:Q980T2"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T2"
FT                   /protein_id="AAK40541.1"
FT                   /translation="MSSQNIKLQRKNSMTYFDLIAWITENKKAIEGCIIDNVFLIQNTQ
FT                   NTYILKLHCSGRDQELIIEPSKRINITKYNYPKISSTKITELRRLIRGDIITNMYVLNK
FT                   ERILILKLKRDDKKVIVELLPRGVLVIADKDGKILFASEYKEFKDRLIRIGEIYKPPPS
FT                   IEPNIDEIEKLIKKGNIAKGLGIPQEVANYLSLQDSTPDINVIREKIRNLEISIINGEI
FT                   KPCLVEDTTVVPFYLDGCKEYQRFNDAIDDYFYTITQKELSEKTSKKISEEKQKIIATI
FT                   KQIEDSIKDYEDKENNYRQLGNFILSKAYEIDQLLLNNRAKSKKVKLNVDGVEIELDTS
FT                   LSATKNAMRFFDEAKEYKRKIERALKSLEELKEKLAKIEKQEIEKQNEIKLTLRKKEWY
FT                   EKYRWSISRSGYLIILGRDASQNESIVKKYLRDKDIFLHADIIGAPATIIITQDNKTIS
FT                   EEDIYDAAVMAASYSKAWKVGLASVDIFWVLGNQVSKSPPSGEYLNKGSFMIYGKKNFI
FT                   KNVKLQLAIGLILSENGVSVIVGSEETISAKTKYYVVIAPGDDDKERITQKIIKVFSRA
FT                   LPEINGLNALKTEIEDKIPGKSKIVKTSITYNS"
FT   gene            169763..170626
FT                   /locus_tag="SSO0197"
FT   CDS_pept        169763..170626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0197"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE1602,AF2426, MJ1073, PAB1013,
FT                   PH0512"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40542"
FT                   /db_xref="GOA:Q980T1"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T1"
FT                   /protein_id="AAK40542.1"
FT                   /translation="MRLSLAEKASLVRPFDYILLKTIYGLRDKSEFVSFNALKKRLDIK
FT                   DDEELKISLKKLSELKLISKKPTDLSFKLTFSGLDILGIKLLYVNKILNRLAEIIGIGK
FT                   ESLVYYGYDFNDNKIIVKFHRVGTDSYKKVKFRKSQEKKSWLSITVENAKREFEALTCL
FT                   SNEGGYVPKPLGVEYNAVAMEYIDGIELYKIPVTNMDLNLDEILEKILQTMRIAYTICH
FT                   ITHGDLSPYNVLIDKNGNPYLIDWPQATKSEERLEKDLSNLIIFFRKKGIDVDTRKIFD
FT                   YVRGVS"
FT   gene            170623..172464
FT                   /locus_tag="SSO0198"
FT   CDS_pept        170623..172464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0198"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE1599, PH0620, PAB1429, AF2427"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40543"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:Q980T0"
FT                   /protein_id="AAK40543.1"
FT                   /translation="MKIMGIDIEAMESPSSKSQPLYSVIIIDENEKIVYKAENVSLSRV
FT                   IRLCWEYSIDILATDNIYELGESDKEIINIVKLLPPNTNIVQVTYHNGEFKQIKELARE
FT                   IGYEVQGKLSPQKTAYLDALLALKGFGTSIKIEEKRTKIVVSRGRALGPGGMSQNRYKR
FT                   YIRGTLLRVAKEIKEKLDMKGFDYDMIVRRSRAGIEGAVFIVYTPRERLYGIIRKMKGH
FT                   DVVVDIKPIYKNRIEFKDKRTERRLIVGIDPGIEVGLSIIDIYGKPILLLSRRNIDRDE
FT                   IVTLISKEGKAIIVATDVNPLPDTVKKIASKFNAKIFIPEKSLSIDEKQRLIDEYSKLH
FT                   KLKIDNPHIRDSLAAALKAYNEIENKLRQIESFISRLDIDIMDENRIYDCVIFGNTVSE
FT                   CVEKEIEKIIGKDDYRKIEEIQKENDTTKNTNKLTKLEEENRELKSELIRYKRIIYNLI
FT                   NERDSLIRKIDDIKLQINKEIERDRKIYELNLNLQNAYKVISQLENKLNYNEKQIEKLR
FT                   EVLYKLLNGKAIVVKKDSRVGDIAFDGNNIYIGEEKVNNEIAEYADKEIIILDKQLLND
FT                   LEVLRKELQIERSKNIDIKRIIDEYRNKRLKESSFPF"
FT   gene            complement(172438..173670)
FT                   /gene="maT"
FT                   /locus_tag="SSO0199"
FT   CDS_pept        complement(172438..173670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maT"
FT                   /locus_tag="SSO0199"
FT                   /product="S-adenosylmethionine synthetase (maT)"
FT                   /EC_number="2.5.1.6"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40544"
FT                   /db_xref="GOA:Q980S9"
FT                   /db_xref="InterPro:IPR002795"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="PDB:4HPV"
FT                   /db_xref="PDB:4K0B"
FT                   /db_xref="PDB:4L2Z"
FT                   /db_xref="PDB:4L7I"
FT                   /db_xref="PDB:4WS9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980S9"
FT                   /protein_id="AAK40544.1"
FT                   /translation="MFEEPIMRNINVQLNPLSDIEKLQVELVERKGLGHPDYIADAVAE
FT                   EASRKLSLYYLKKYGVILHHNLDKTLVVGGQATPRFKGGDIIQPIYIIVAGRATTEVKT
FT                   ESGIDQIPVGTIIIESVKEWIRNNFRYLDAERHVIVDYKIGKGSSDLVGIFEASKRVPL
FT                   SNDTSFGVGFAPLTKLEKLVYETERHLNSKQFKAKLPEVGEDIKVMGLRRGNEVDLTIA
FT                   MATISELIEDVNHYINVKEQVRNQILDLASKIAPGYNVRVYVNTGDKIDKNILYLTVTG
FT                   TSAEHGDDGMTGRGNRGVGLITPMRPMSLEATAGKNPVNHVGKLYNVLANLIANKIAQE
FT                   VKDVKFSQVQVLGQIGRPIDDPLIANVDVITYDGKLTDETKNEISGIVDEMLSSFNKLT
FT                   ELILEGKATLF"
FT   gene            complement(173686..173949)
FT                   /gene="snRNP-1"
FT                   /locus_tag="SSO5410"
FT   CDS_pept        complement(173686..173949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snRNP-1"
FT                   /locus_tag="SSO5410"
FT                   /product="Small nuclear riboprotein protein (snRNP-1)"
FT                   /note="Transcription, RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40545"
FT                   /db_xref="GOA:Q980S8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S8"
FT                   /protein_id="AAK40545.1"
FT                   /translation="MQAKVENPLKSLRTAINRIVLVKLKDGSEYIGKLEQTDGTMNLVL
FT                   RDCTEIREGTSEPVAKYGRVLIRGSNILFISVDYETVMNSEK"
FT   gene            174056..174355
FT                   /locus_tag="SSO0200"
FT   CDS_pept        174056..174355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0200"
FT                   /product="Hypothetical protein"
FT                   /note="Similarity with PAB2328. Possibly a transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40546"
FT                   /db_xref="GOA:Q980S7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S7"
FT                   /protein_id="AAK40546.1"
FT                   /translation="MELIIDDPEKIYEISKALSTMTRINILQLVSITPMSISELTEKLN
FT                   MSKGNISSHISELENLGLVEVEYQNGIKGIKKIIKAKYDKIIIVLKTSNSSNEP"
FT   gene            complement(174323..175930)
FT                   /gene="pyrG"
FT                   /locus_tag="SSO0201"
FT   CDS_pept        complement(174323..175930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SSO0201"
FT                   /product="CTP synthetase (UTP-ammonia lyase) (pyrG)"
FT                   /EC_number="6.3.4.2"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40547"
FT                   /db_xref="GOA:Q980S6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="PDB:3NVA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980S6"
FT                   /protein_id="AAK40547.1"
FT                   /translation="MPNKYIVVTGGVLSSVGKGTLVASIGMLLKRRGYNVTAVKIDPYI
FT                   NVDAGTMNPYMHGEVFVTEDGAETDLDLGHYERFMDVNMTKYNNITAGKVYFEVIKKER
FT                   EGKYLGQTVQIIPHVTDQIKDMIRYASKINNAEITLVEIGGTVGDIESLPFLEAVRQLK
FT                   LEEGEDNVIFVHIALVEYLSVTGELKTKPLQHSVQELRRIGIQPDFIVGRATLPLDDET
FT                   RRKIALFTNVKVDHIVSSYDVETSYEVPIILESQKLVSKILSRLKLEDRQVDLTDWISF
FT                   VNNIKGINSKKTINIALVGKYTKLKDSYISIKEAIYHASAYIGVRPKLIWIESTDLESD
FT                   TKNLNEILGNVNGIIVLPGFGSRGAEGKIKAIKYAREHNIPFLGICFGFQLSIVEFARD
FT                   VLGLSEANSTEINPNTKDPVITLLDEQKNVTQLGGTMRLGAQKIILKEGTIAYQLYGKK
FT                   VVYERHRHRYEVNPKYVDILEDAGLVVSGISENGLVEIIELPSNKFFVATQAHPEFKSR
FT                   PTNPSPIYLGFIRAVASL"
FT   gene            176021..176698
FT                   /gene="hpS-2"
FT                   /locus_tag="SSO0202"
FT   CDS_pept        176021..176698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpS-2"
FT                   /locus_tag="SSO0202"
FT                   /product="D-arabino 3-hexulose 6-phosphate formaldehyde
FT                   lyase (hpS-2)"
FT                   /note="Similar to amino-end of most thermophilic homologues
FT                   but same size as bacterial homologues. Carboxy-end seems to
FT                   be upstream in distal SSO0151 orf; Energy Metabolism, Sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40548"
FT                   /db_xref="GOA:Q980S5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S5"
FT                   /protein_id="AAK40548.1"
FT                   /translation="MREVLLEKLRTEKFLQIALDFIDINDAIKVVNEVKDLENEIIEIG
FT                   TPLLKSFGIEGIRKIKSLVPDKIIVADTKTADAGDVEVEIAKLGGAHIMTVLGIMDDST
FT                   IYSAVKKARELDILVQADLINVKNVYERSKELKQLGVDIIGFHVGLDVQKSRGISVADL
FT                   KNEIRKVSELNLIISIAGGLNKDRILELIDLPVSIYVVGGAITRSKEPKNVSKEIVNIL
FT                   KGR"
FT   gene            176721..177188
FT                   /locus_tag="SSO0203"
FT   CDS_pept        176721..177188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0203"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0429"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40549"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S4"
FT                   /protein_id="AAK40549.1"
FT                   /translation="MSQPGQQKSKDVKMVSKQVISTNIINEDKRKLQLLYIIRQIGKLT
FT                   EKSIIMLLYELKQKGIDLGYQFNVIGNNVFSLMAKEDLTSLLYLGLVENDPVTKKISIS
FT                   NNGIEILDKTQIDDDFKNKLAQALNEIKTKILAYDEEYNLKIKNEMKLRRR"
FT   gene            complement(177200..177619)
FT                   /locus_tag="SSO0205"
FT   CDS_pept        complement(177200..177619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0205"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0503"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40550"
FT                   /db_xref="InterPro:IPR014450"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S3"
FT                   /protein_id="AAK40550.1"
FT                   /translation="MESSFIGNLDEWIKLQKNLLTTLKDMEKKEKTEDMDRLDLILASR
FT                   TAFQHMMRTLKAFDQWLQDPMVIKHMPREMLEDVKNTSWELLQRLLELDIRHTSQFREM
FT                   ISKMSKEGKLDPLIWTRPVTEEHPERERRGPLSTI"
FT   gene            complement(177662..178051)
FT                   /locus_tag="SSO0206"
FT   CDS_pept        complement(177662..178051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0206"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0505"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40551"
FT                   /db_xref="GOA:Q980S2"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S2"
FT                   /protein_id="AAK40551.1"
FT                   /translation="MKYRLMDLLACPMCKHFPLKLLVFSEREIDRKLSQEDKKPLCELY
FT                   CTYKSAFTKDLDSLPPCEECIRHEIEEGMLYCESCNRWYPIIDEIPRMLPDKLRKEEDD
FT                   IKFLEKYKDKIPKSILTNGVPFRLK"
FT   gene            complement(178048..179415)
FT                   /gene="pmM"
FT                   /locus_tag="SSO0207"
FT   CDS_pept        complement(178048..179415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmM"
FT                   /locus_tag="SSO0207"
FT                   /product="Phosphomannomutase (pmM)"
FT                   /EC_number="5.4.2.8"
FT                   /note="Cell Envelope, Surface polysaccharides and
FT                   lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40552"
FT                   /db_xref="GOA:Q980S1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S1"
FT                   /protein_id="AAK40552.1"
FT                   /translation="MGKLFGTDGIRGVTNTELQPEFALKIGKAIGTYFGKGARILIGRD
FT                   VRAGGDMLLKAVESGLLSSGVLVYEAGMAPTPAFQYGVKALGYDGGVIITASHNPAEYN
FT                   GIKVLSPHGIEISREDEDKIEDIYFNSRFHVVEWNGLVNDVKREDKVIETYLRGILSHV
FT                   DTEKIKSKKYKVLIDPANSVGTLVTPIVARELGCKVFTINGNLDPLFSARTPEPTFESL
FT                   TESAKVAKQLGVDLAVAHDGDADRAIFIDSMGRVQWGDRSGTLLSYWASVKAPNLPRRI
FT                   FTAVSSSSLVEEYLKKYNIEVKWTKVGSIDIAHMLFKEKGVAGFEENGGFMYPPHQTVR
FT                   DGAMSFALMLDMMASENESSAELFNRLPVYYLVKTKVRVTEKSDIKKIYDEVMNKYGNY
FT                   GNTVTIDGVKIIGSDFWLLVRKSGTEPIIRILVEAKDENKSKELAKELEKLVSELV"
FT   gene            complement(179480..179553)
FT                   /locus_tag="SSOt09"
FT   tRNA            complement(179480..179553)
FT                   /locus_tag="SSOt09"
FT                   /product="tRNA-His"
FT   gene            complement(179604..180845)
FT                   /gene="dfp"
FT                   /locus_tag="SSO0210"
FT   CDS_pept        complement(179604..180845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="SSO0210"
FT                   /product="DNA/pantothenate metabolism flavoprotein (dfp)"
FT                   /note="Cofactor Biosynthesis, Panthenate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40553"
FT                   /db_xref="GOA:Q980S0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q980S0"
FT                   /protein_id="AAK40553.1"
FT                   /translation="MHTYMTHPSKKIIGSISNELADKKILLAVTGSVAIYKSLDLARSL
FT                   MRNGAEVSVIISKDAAKLISPEMFKWATGNNVVTKLTGDLEHVSLAEDNDVMIVAPSTA
FT                   NTMVKIAYGIADTPITATALNFVGMKKPLIIVPSMHLQMYISPQVADAADRLKRIGVEV
FT                   IEPEIVGDLAHYPKLEYLTSRITSYVLRGKDLSGFNILATAGPTREYLDSVRFISNPSS
FT                   GTMGISIANEAYFRGAKVRVICGPISSKIEPYVKDIVYVETTEEMLNEVVKSIENGKFN
FT                   VVILAGAPADYKFKNKSDTKIDSHTEIPKVELERTPKISEYIRKYNVLLVGFSAETVNS
FT                   DEELIEKAKIKMRRHGFDLIVANNVRRKDIGFSSEYNEVIVIDKNGDVRKIPKNFKTVI
FT                   ARKILDIVKEQLRR"
FT   gene            180731..181381
FT                   /locus_tag="SSO0209"
FT   CDS_pept        180731..181381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0209"
FT                   /product="Acetyltransferase, putative"
FT                   /note="Similarity with N-terminal acetyltransferase complex
FT                   subunit; Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40554"
FT                   /db_xref="GOA:Q980R9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2X7B"
FT                   /db_xref="PDB:4LX9"
FT                   /db_xref="PDB:4R3K"
FT                   /db_xref="PDB:4R3L"
FT                   /db_xref="PDB:5C88"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980R9"
FT                   /protein_id="AAK40554.1"
FT                   /translation="MTYILRRSQLLLIVSSYQLVHYLCSQLSSLKDASCMCAYILTTLY
FT                   KDIDMELAEKDKGRDFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFV
FT                   AIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKS
FT                   MKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL"
FT   gene            complement(181819..182715)
FT                   /locus_tag="SSO0212"
FT   CDS_pept        complement(181819..182715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0212"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with MJ0227, MTH743, PAB0313,APE1715,
FT                   PH1702"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40555"
FT                   /db_xref="GOA:Q980R8"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R8"
FT                   /protein_id="AAK40555.1"
FT                   /translation="MTKMLEGLLDLCNDVSYILSQASIIESYIFKPGNASRSQDLVNVK
FT                   YIDIVKSALISSTYYKELCIRGFRGISRIYDTLVELVTRSNKFGFEYQLFGTYLLIAPF
FT                   AYEAAKINNVFELRKKAAKLLRSLGALETRWFLDALKELNLKYLGKLSSMDYREIENID
FT                   FFTLMEFSSKYDIVALNMVNDYSITFAAYKVIKEGLCGLERDVQRAFLYILSNYPDTLI
FT                   YKKYGAHAALEASKVARLVFSGDCPSSNELEWLNKYLINNNFNPGSTADLIASALAIYY
FT                   LDEWYGKKGNPHSGFSV"
FT   gene            complement(182678..183577)
FT                   /locus_tag="SSO0213"
FT   CDS_pept        complement(182678..183577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0213"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with MJ1086"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40556"
FT                   /db_xref="GOA:Q980R7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R7"
FT                   /protein_id="AAK40556.1"
FT                   /translation="MGRDYFLDRDIIIDKEGNVYTVLTNYNPPGYVFAYLKYVYTGKGI
FT                   WNGYERIFKKYGVHNLIKINQRFNFESCYDASFPIVLLSNISRHLKPEERLREILKKSV
FT                   SDSIIYALISFIEEYVRVNDIGVTGSILLGNYHSNSDIDIIIYGRKSALDFIESFDGFE
FT                   KDSEWIIEANENYGINFSSLLYDNRRRGIYRGIKISVLFADDKPWRYCNDICKKIGKVK
FT                   FKAHISGDYEALIYPSVAYVLDNNEYNVSKIVSYEGIFSSALFGKRQVEVEGLLMSCEK
FT                   ENVVIIGDKDVRGFIRPL"
FT   gene            complement(183541..184449)
FT                   /locus_tag="SSO0214"
FT   CDS_pept        complement(183541..184449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0214"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with AF0850"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40557"
FT                   /db_xref="InterPro:IPR009927"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R6"
FT                   /protein_id="AAK40557.1"
FT                   /translation="MARQPLMIYVGIDPGSETYAFAFVDELGNLIKYFEICTDLVEKSS
FT                   IFLAKLIADYRPMAVALPSGHGLPFYNIRNINNREIFILTLKDPLSHGPLRDFLLASKQ
FT                   YLSFYNSFTIPSVIELNSLPNDRKVNVIDKGTADKVASTFFYRVYLKLDNFILVEMGRR
FT                   FTAIVIVINGKIVDGYGGTYLSGLDGEIAYLLHKYSRIDKSTVYNVGRNLELTRIIVEW
FT                   YSDKYKLPIIVSGYNKNYLEIGKKYDFKFKEAAVGAAFIANAYSGGLLRHYISMLDSSG
FT                   TPISFVRLKEWDEIISWIETL"
FT   gene            complement(184612..184684)
FT                   /locus_tag="SSOt10"
FT   tRNA            complement(184612..184684)
FT                   /locus_tag="SSOt10"
FT                   /product="tRNA-Asp"
FT   gene            complement(184778..184880)
FT                   /locus_tag="SSOt11"
FT   tRNA            complement(184778..184880)
FT                   /locus_tag="SSOt11"
FT                   /product="tRNA-Met"
FT                   /note="1 intron"
FT   gene            complement(185144..185227)
FT                   /locus_tag="SSOt12"
FT   tRNA            complement(185144..185227)
FT                   /locus_tag="SSOt12"
FT                   /product="tRNA-Ser"
FT   gene            complement(185259..185567)
FT                   /gene="rps10AB"
FT                   /locus_tag="SSO0215"
FT   CDS_pept        complement(185259..185567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps10AB"
FT                   /locus_tag="SSO0215"
FT                   /product="SSU ribosomal protein S10AB (rps10AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40558"
FT                   /db_xref="GOA:P35027"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35027"
FT                   /protein_id="AAK40558.1"
FT                   /translation="MPTKARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSK
FT                   LEVPIMRLPHGEGRKKWEKWEMRVHKRLIDIAADERVMRQLMRVRVPEDVYIEIQLI"
FT   gene            complement(185592..186899)
FT                   /gene="tuF-1"
FT                   /locus_tag="SSO0216"
FT   CDS_pept        complement(185592..186899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuF-1"
FT                   /locus_tag="SSO0216"
FT                   /product="Elongation factor 1-alpha (elongation factor tu)
FT                   (EF-tu) (tuF-1)"
FT                   /note="Translation, Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40559"
FT                   /db_xref="GOA:P35021"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="PDB:1JNY"
FT                   /db_xref="PDB:1SKQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35021"
FT                   /protein_id="AAK40559.1"
FT                   /translation="MSQKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAA
FT                   KKLGKESEKFAFLLDRLKEERERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITG
FT                   ASQADAAILVVSAKKGEYEAGMSVEGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDE
FT                   KRYKEIVDQVSKFMRSYGFNTNKVRFVPVVAPAGDNITHRSENMKWYNGPTLEEYLDQL
FT                   ELPPKPVDKPLRIPIQDVYSISGVGTVPVGRVESGVLKVGDKIVFMPAGKVGEVRSIET
FT                   HHTKMDKAEPGDNIGFNVRGVEKKDIKRGDVVGHPNNPPTVADEFTARIIVVWHPTALA
FT                   NGYTPVIHVHTASVACRVSELVSKLDPRTGQEAEKNPQFLKQGDVAIVKFKPIKPLCVE
FT                   KYNEFPPLGRFAMRDMGKTVGVGIIVDVKPAKVEIK"
FT   gene            complement(186945..187526)
FT                   /gene="rpS7AB"
FT                   /locus_tag="SSO0217"
FT   CDS_pept        complement(186945..187526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpS7AB"
FT                   /locus_tag="SSO0217"
FT                   /product="SSU ribosomal protein S7AB (rpS7AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40560"
FT                   /db_xref="GOA:P35026"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35026"
FT                   /protein_id="AAK40560.1"
FT                   /translation="MSLENLQLDIKVFGKWDTKVEIRDPSLKKYISLMPVYLPHTGGRH
FT                   EHRRFGKAKVPIVERLINQIMRPGRNKGKKHLAYNIVKLAFDIIYLKTGQNPIQVLVRA
FT                   IENSAPREEVTRIMYGGIVYYVAVDVSPQRRIDLALRHIATGAKDASFNNPKPIEEVLA
FT                   EEIIAAANNDSKSFAIKRKEEIERIALSSR"
FT   gene            187602..188081
FT                   /locus_tag="SSO0218"
FT   CDS_pept        187602..188081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0218"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some similarity with APE1848"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40561"
FT                   /db_xref="GOA:Q980R5"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R5"
FT                   /protein_id="AAK40561.1"
FT                   /translation="MMSLQPIKDEDYIKVNSVDAFFMPLHGIPTIVCYLEDGRQFYLFS
FT                   VPAEIVIAINKTKGNKEEEFGDKRENIYDIISFIPEITEEFSKHIEKVIIDDMIRDTGV
FT                   YVATVEFKFDGVIIQKRMIPSHAIFLAIISNKPIFVKKGLVDEQEKESREGQQKF"
FT   gene            complement(188153..188605)
FT                   /gene="rpS12AB"
FT                   /locus_tag="SSO0219"
FT   CDS_pept        complement(188153..188605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpS12AB"
FT                   /locus_tag="SSO0219"
FT                   /product="SSU ribosomal protein S12AB (rpS12AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40562"
FT                   /db_xref="GOA:P39573"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39573"
FT                   /protein_id="AAK40562.1"
FT                   /translation="MEKVVKSKSPKGIYAARKLRLKRLKFRRSQRKYKTKILKLKEKYD
FT                   PLGGAPMARGIVLEKVGIESRQPNSAVRKCVRVQLVRNGRVVTAFVPGDGGVNFIDEHD
FT                   EVIITGIGGTLGRSMGDLPGVRYKVIMVNGVSLDALYKGKKQKPVR"
FT   gene            complement(188611..188985)
FT                   /gene="nusA"
FT                   /locus_tag="SSO0220"
FT   CDS_pept        complement(188611..188985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SSO0220"
FT                   /product="Transcription termination factor nusA homolog,
FT                   putative (nusA)"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40563"
FT                   /db_xref="GOA:Q980R4"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R4"
FT                   /protein_id="AAK40563.1"
FT                   /translation="MTRANVRDCIIDNENNRIIFLVDSKDMGVAIGKSGINVKKLKKII
FT                   GKDIELVAYSDNLEELVKNLMSPARVRSVKVVNTSSKKSVYINIDPQDKGLAIGKNGRN
FT                   VARAKLILKRYMDIDNVVIV"
FT   gene            complement(189049..189375)
FT                   /gene="rpl30E"
FT                   /locus_tag="SSO0221"
FT   CDS_pept        complement(189049..189375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl30E"
FT                   /locus_tag="SSO0221"
FT                   /product="LSU ribosomal protein L30E (rpl30E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40564"
FT                   /db_xref="GOA:Q980R3"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980R3"
FT                   /protein_id="AAK40564.1"
FT                   /translation="MIKVSEQQVSFEGELKSLLKTGKVIFGAKRAIKYIKLSKVKMVIV
FT                   ASTLRGDLKQDIMHYAKLSNIPVYEYKGSGWDLGTLCGKPFMISTISIIDEGDSKILDI
FT                   IKER"
FT   gene            complement(189372..190559)
FT                   /gene="rpoA2"
FT                   /locus_tag="SSO0223"
FT   CDS_pept        complement(189372..190559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA2"
FT                   /locus_tag="SSO0223"
FT                   /product="DNA-directed RNA polymerase, subunit A'' (rpoA2)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40565"
FT                   /db_xref="GOA:P58192"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58192"
FT                   /protein_id="AAK40565.1"
FT                   /translation="MEGMIDEKDKPYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTR
FT                   DEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLRTFHFAGIRELNVTLGL
FT                   PRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYTKIENVVSSTSIDIASM
FT                   SIILQLDNEMLKDKGVTVDDVKKAIGRLKLGDFMIEESEDSTLNINFANIDSIAALFKL
FT                   RDKILNTKIKGIKGIKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIE
FT                   EVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNS
FT                   VLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR"
FT   gene            complement(190547..193189)
FT                   /gene="rpoA1"
FT                   /locus_tag="SSO0225"
FT   CDS_pept        complement(190547..193189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA1"
FT                   /locus_tag="SSO0225"
FT                   /product="DNA-directed RNA polymerase, subunit A' (rpoA1)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40566"
FT                   /db_xref="GOA:Q980R2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980R2"
FT                   /protein_id="AAK40566.1"
FT                   /translation="MSEKNIKGIKFGILSPDEIRKMSVTAIITPDVYDEDGTPIEGSVM
FT                   DPRLGVIEPGQKCPTCGNTLGNCPGHFGHIELVRPVIHVGLVKHIYEFLKATCRRCGRV
FT                   KISEDEIEKYSRIYNAIKKRWPSAARRLTEYVKKTAMKAQVCPHCNEKQYKIKLEKPYN
FT                   FYEERKEGVAKLTPSDIRERLEKIPDSDVEILGYDPTTSRPEWMILTVLPVPPITIRPS
FT                   IMIESGIRAEDDLTHKLVDIVRINERLKESIDAGAPQLIIEDLWDLLQYHVATYFDNEI
FT                   PGLPPSKHRSGRPLRTLAQRLKGKEGRFRGNLSGKRVDFSSRTVISPDPNISIDEVGVP
FT                   EIIAKTLTVPERITPWNIEKLRQFVINGPDKWPGANYVIRPDGRRIDLRYVKDRKELAS
FT                   TLAPGYIIERHLIDGDIVLFNRQPSLHRISMMAHRVRVLKGLTFRLNLLVCPPYNADFD
FT                   GDEMNLHVPQSEEAIAEAKEIMLVHKNIITPRYGGPIIGAAQDYISGAYLLTVKTTLLT
FT                   KEEAQQILGVADVKIDLGEPAILAPREYYTGKQVISAFLPKDFNFHGQANVSSGPRLCK
FT                   NEDCPHDSYVVIKNGILLEGVFDKKAIGNQQPESILHWLIKEYSDEYGKWLMDNLFRVF
FT                   IRFVELQGFTMRLEDVSLGDDVKKEIYNEIDRAKVEVDNLIQKYKNGELEPIPGRTLEE
FT                   SLENYILDTLDKLRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMLGQQSVR
FT                   GERIKRGYMTRTLPHFKPYDISPEARGFIYSSFRTGLKPTELFFHAAGGREGLVDTAVR
FT                   TSQSGYMQRRLINALSDLRAEYDGTVRSLYGEVVQVAYGDDGVFPMYSAHGKTVDVNRI
FT                   FERVVGWKA"
FT   gene            complement(193195..195144)
FT                   /gene="rpoB1"
FT                   /locus_tag="SSO0227"
FT   CDS_pept        complement(193195..195144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB1"
FT                   /locus_tag="SSO0227"
FT                   /product="DNA-directed RNA polymerase, subunit B' (rpoB1)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40567"
FT                   /db_xref="GOA:Q980R1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R1"
FT                   /protein_id="AAK40567.1"
FT                   /translation="MLYGINERIVEKTLYEMGVVPVEEVIRRVTEGGEDQNEYLKWSKV
FT                   ILNGRLIGYYQDGGELANKIRERRRKGEISDEVNVGHIVTDFINEVHVNCDSGRVRRPL
FT                   IIVSNGNPLVTIEDIEKLESGAITFDDLVRQGKIEYLDAEEEENAYVALEPNDLTPDHT
FT                   HLEIWSPAILGITASIIPYPEHNQSPRNTYQSAMAKQALGLYAANYQLRTDTRAHLLHY
FT                   PQRPLVQTRALDIIGYTNRPAGNNAILAVMSFTGYNMEDSIIMNRSSVERGMYRSTFFR
FT                   LYSTEEVKYPGGQEDKIVMPEAGVRGYKGKEYYRLLEDNGVVSPEVEVKGGDVLIGKVS
FT                   PPRFLQEFKELSPEQAKRDTSIVTRHGEMGIVDLVLITETAEGNKLVKVRVRDLRIPTI
FT                   GDKFASRHGQKGVIGMLIPQVDMPYTVKGVVPDIILNPHALPSRMTLGQIMEGIAGKYA
FT                   ALSGNIVDATPFYKTPIEQLQNEILRYGYLPDATEVVYDGRTGQKIKSRIYFGVVYYQK
FT                   LHHMVADKLHARARGPVQILTRQPTEGRAREGGLRFGEMERDCLIGFGTAMLLKDRLLD
FT                   NSDRTMIYVCDQCGYIGWYDKNKNKYVCPIHGDKSNLFPVTVSYAFKLLIQELMSMIIS
FT                   PRLVLEDKVGLSGG"
FT   gene            complement(195129..196571)
FT                   /gene="rpoB2"
FT                   /locus_tag="SSO3254"
FT   CDS_pept        complement(195129..196571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB2"
FT                   /locus_tag="SSO3254"
FT                   /product="DNA-directed RNA polymerase, subunit B'' (rpoB2)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO3254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40568"
FT                   /db_xref="GOA:Q980R0"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:Q980R0"
FT                   /protein_id="AAK40568.1"
FT                   /translation="MASNLTIDERWRVIEAYFKSKGLVRQHLDSYNDFVRNKLQEIIDE
FT                   QGEIPTEIPGLKVRLGKIRIGKPRVRESDRGEREISPMEARLRNLTYAAPLWLTMIPVE
FT                   NNIEAEPEEVYIGDLPIMLKSAIDPISQYTLDKLIEIGEDPKDPGGYFIVNGSERVIVT
FT                   QEDLAPNRVLVDTGKTGSNITHTAKIISSTAGYRVPVTIERLKDGTFHVSFPAVPGKIP
FT                   FVILMRALGILTDRDIVYAVSLDPEVQNELFPSLEQASSIANVDDALDFIGSRVAIGQK
FT                   RENRIEKAQQIIDKYFLPHLGTSAEDRKKKAYYLAYAISKVIELYLGRREPDDKDHYAN
FT                   KRLRLAGDLFASLFRVAFKAFVKDLTYQLEKSKVRGRKLALKALVRPDIVTERIRHALA
FT                   TGNWVGGRTGVSQLLDRTNWLSMLSHLRRVISSLARGQPNFEARDLHGTQWGRMCPFET
FT                   PEGPNSGLVKNLAVNGSNCCTE"
FT   gene            complement(196577..196831)
FT                   /gene="rpoH"
FT                   /locus_tag="SSO5468"
FT   CDS_pept        complement(196577..196831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="SSO5468"
FT                   /product="DNA-directed RNA polymerase, subunit H (rpoH)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40569"
FT                   /db_xref="GOA:Q980Q9"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q9"
FT                   /protein_id="AAK40569.1"
FT                   /translation="MRGSSNKKIDPRIHYLVPKHEVLNIDEAYKILKELGIRPEQLPWI
FT                   RASDPVARSINAKPGDIIRIIRKSQLYGEVVSYRYVISG"
FT   gene            197205..199007
FT                   /gene="infB"
FT                   /locus_tag="SSO0228"
FT   CDS_pept        197205..199007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SSO0228"
FT                   /product="Translation initiation factor IF2 homolog (infB)"
FT                   /note="Translation, Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40570"
FT                   /db_xref="GOA:Q980Q8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q8"
FT                   /protein_id="AAK40570.1"
FT                   /translation="MKISNSERRLRQPIVVVLGHVDHGKTTLLDKIRGTTVVKKEPGEM
FT                   TQEVGASFVPSYIIEKLAEPLKKVIPIKLQIPGLLFIDTPGHEYFSNLRRRGGSVADIA
FT                   ILVVDITEGLQKQSIESIQILRERKVPFLIAANKIDKIPGWKSNNDIPFLASIEKQRND
FT                   VKVYLDNLVYNLVSQLANLGFSSERYDRIKDFTKTVAIVPVSAKTGEGVADLLALLAGL
FT                   TQRYLETRLKFAEGPAKGVILEVKEDPGLGHTIDVIIYDGVLKKNDTIILGGINGIIIT
FT                   KVRGIFVPRPLQDMKLSKYDLTPIDEVYAAAGVKISAPNLEEALAGSPIYVVEDESKVE
FT                   RYKQQIEEEIKEVRLYSDIDGIILKADSLGTLEALVSALQREGIPIRLADIGPISKRDV
FT                   IEASIVAQRSKEYGIIAAFRVKLLQGIDTSGIKILYNEIIYQLIEDIKKHINDVREAEK
FT                   RRTFDTLILPGKIKILPGYVFRRSDPVVVGIEVIGGIIRPKYPLIKEDGRRVGEVLQIQ
FT                   DNKKSLERATKGMEVAISIKGNIMIGRHVNEGDVLYTDVPKEDLEILVNKYPSSITDDM
FT                   REVIKEIIRIKRKEDPLYGLGLQI"
FT   gene            complement(198996..199412)
FT                   /gene="ndk"
FT                   /locus_tag="SSO0230"
FT   CDS_pept        complement(198996..199412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="SSO0230"
FT                   /product="Nucleoside diphosphate kinase (NDP kinase) (ndk)"
FT                   /EC_number="2.7.4.6"
FT                   /note="Central Intermediary Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40571"
FT                   /db_xref="GOA:Q980Q7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q7"
FT                   /protein_id="AAK40571.1"
FT                   /translation="MVAQRTFVMIKPDGVKRGLIGEIISRFEKRGLKIVSLKMVKMSRD
FT                   TAEKLYEEHKGKSFFEELVNYVTSGPVVCMVIEGDDVVQVIRRMIGNTDPKEAPPGTIR
FT                   GDYALSKSENVIHASDSIEKAQREMSLFFDKSDL"
FT   gene            complement(199416..199601)
FT                   /gene="rpl24E"
FT                   /locus_tag="SSO5478"
FT   CDS_pept        complement(199416..199601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl24E"
FT                   /locus_tag="SSO5478"
FT                   /product="LSU ribosomal protein L24E (rpl24E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40572"
FT                   /db_xref="GOA:Q980Q6"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q6"
FT                   /protein_id="AAK40572.1"
FT                   /translation="MPTTRQCSFCGHEIPPGTGLMYVRNDGTILWFCSSKCRKSMLKYH
FT                   RDPKKYKWTTRYMKVR"
FT   gene            199626..199922
FT                   /gene="rps28E"
FT                   /locus_tag="SSO5479"
FT   CDS_pept        199626..199922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps28E"
FT                   /locus_tag="SSO5479"
FT                   /product="SSU ribosomal protein S28E (rps28E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40573"
FT                   /db_xref="GOA:Q980Q5"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q5"
FT                   /protein_id="AAK40573.1"
FT                   /translation="MKYLSELFIVIAGGKMSEKTQQSQGSSIIEEFGFPAEVIQILDRT
FT                   GVTGEVTQVRVRVLEGRDKGRILTRNVKGPVRVGDILILRETEREARKITTKR"
FT   gene            199932..200582
FT                   /gene="upP"
FT                   /locus_tag="SSO0231"
FT   CDS_pept        199932..200582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upP"
FT                   /locus_tag="SSO0231"
FT                   /product="Uracil phosphoribosyltransferase (upP)"
FT                   /EC_number="2.4.2.9"
FT                   /note="Central Intermediary Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40574"
FT                   /db_xref="GOA:Q980Q4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="PDB:1VST"
FT                   /db_xref="PDB:1XTT"
FT                   /db_xref="PDB:1XTU"
FT                   /db_xref="PDB:1XTV"
FT                   /db_xref="PDB:3G6W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q4"
FT                   /protein_id="AAK40574.1"
FT                   /translation="MPLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISN
FT                   TLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGAS
FT                   RVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKR
FT                   IYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG"
FT   gene            200640..202016
FT                   /gene="gatB-1"
FT                   /locus_tag="SSO0232"
FT   CDS_pept        200640..202016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB-1"
FT                   /locus_tag="SSO0232"
FT                   /product="Glutamyl-tRNA-Gln amidotransferase, subunit B
FT                   (gatB-1)"
FT                   /EC_number="6.3.5.-"
FT                   /note="Translation, .tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40575"
FT                   /db_xref="GOA:Q980Q3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980Q3"
FT                   /protein_id="AAK40575.1"
FT                   /translation="MKTKLFCSCPSDYTGKDPNTVTCPVCLGLPGAIPVLNENAVKYGI
FT                   LTALALNCQIAEKLIFDRKHYFYPDMSKNYQISQYDGPGSMAIAKDGYIKLNDKIIRIR
FT                   RINIEEDPAKIVYPTGSILTSKYTLLDYNRSGTPLLEIVTEPDLRSAKEARFFLEKLRS
FT                   ILEHLGVCDCGIEGAMKADVNISVKGGERVEVKNVGSPKDVEDAINYEIARQRASILQG
FT                   IKIERETRHWDNERRVTVPLRTKETEEDYRYFPDPDLPPYSITPELIEKFKREMPELPD
FT                   QRAERFVKQYNVTPYQAQVLVNEKALADLFEEITNNYKNYAKVANLLINDYMRWLNENN
FT                   ITVTQSKAKANHIIELFEYLDSGLISIKIVKELLPEMILTGKTPGQLIKEKGMTNIKDE
FT                   NYLERIIDEVLNEEKEAVEKAKRDPKVVNYLVGMVMKKTGKRADPQMTVEIIKKKLGLT
FT                   "
FT   gene            202018..202758
FT                   /locus_tag="SSO0233"
FT   CDS_pept        202018..202758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0233"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Seems related to pur operon repressor. Similar to
FT                   PH1691, PAB2035, APE0060"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40576"
FT                   /db_xref="GOA:Q980Q2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Q2"
FT                   /protein_id="AAK40576.1"
FT                   /translation="MEIFMLQSNQIKEKELRLRLFSVDILKELKNIYTYKELSKFFNIQ
FT                   ESLICRYVNGRTIPSERQALEIVTRIKNKEFLYNFFIRKIRVYEDDFIDVSNLLFYPNL
FT                   LKTFLELYLIKLNKVSDVTKIVGIASNGIPFATIVASILEKPLIISKKHKDSTQIQYIE
FT                   ENIRESNGVISTLYIRGDYISKKDKILIVDDVIRSGKTLLSLYNLIGKANASVVGALII
FT                   ATNTDTWKDKFINKDINLMVLFKV"
FT   gene            202755..203297
FT                   /locus_tag="SSO0234"
FT   CDS_pept        202755..203297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0234"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40577"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Q1"
FT                   /protein_id="AAK40577.1"
FT                   /translation="MSIAKIQRNVYVIGGKLIDDNDTNAYLVYDDEKNYYTLIDTTTGA
FT                   NIRYVIESLLEILKGKDKLKYVILTSCKFENSGGLYYIYNLFKPITIAHFPDSIMIRKG
FT                   ECENRLYTPSPISLEIKQKQYILDNLLILLSKNITNGNIVVKYNDVLFSGSNTKITQYS
FT                   KYIKYICDVNKCRSVSD"
FT   gene            complement(203519..205267)
FT                   /locus_tag="SSO0235"
FT   CDS_pept        complement(203519..205267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0235"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to APE2598, AF2316, PH1458, Ta0670, MJ0619,
FT                   MTH831.Some similarity with molybdenum cofactor
FT                   biosynthesis MoaA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40578"
FT                   /db_xref="GOA:Q980Q0"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034471"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:Q980Q0"
FT                   /protein_id="AAK40578.1"
FT                   /translation="MAQIVNTERHSRLLPAPSSFEEGVVKFGDKEINIGGPLPTLAKDE
FT                   KLVRVTHSLCPACYRLLPATIFEKEGKLFIRKICPEHGEFEDLYYADSSLYYKFDYWEY
FT                   EGKGPKVPYVDLKSPCPYNCGLCPMHHQHSALVNLVITNRCDLSCWYCFFYAEKAGYVY
FT                   EPTLEQIKFMVDQLKKQDITLVIQVTGGEPTLREDIIEIIKMLRENGVKHIQLNSWGGT
FT                   FAKLYLEDPDKAIKYARALREAGVNTVYMSFDGTTRKTNPKNHWEIPYTLEVFRRAGMT
FT                   SVVLVPTVIKTVNDNDLGNIVKFAAYNMDVVRSVNFQPVSLTGMMKRNMRAKFRITIPE
FT                   VIKNIEEQTDGEITKDSWYPIGTSVVFSRLVEALTGKEQFEMANHPSCGAGTYVYVEWR
FT                   NHEPHFIPISKFIDLEGLLEYLKEKEEELREGANKVWVASKVLYSIRKFIDKEQGPKDF
FT                   DVYKMLYNIIIHHNYEALGEWHYRTLFLGSMHFMDLYNYDVQRVMRCDIHYVVPDGRVI
FT                   PFCTYNVLNDLYRDKVLREYQIPLDKWTKEHGENSLGDAIKYKRIASTLENSEIYKNTY
FT                   KSFQQM"
FT   gene            complement(205329..206300)
FT                   /gene="thiL"
FT                   /locus_tag="SSO0237"
FT   CDS_pept        complement(205329..206300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SSO0237"
FT                   /product="Thiamine monophosphate kinase, putative (thiL)"
FT                   /EC_number="2.7.4.16"
FT                   /note="Cofactor Biosynthesis, Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40579"
FT                   /db_xref="GOA:Q980P9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P9"
FT                   /protein_id="AAK40579.1"
FT                   /translation="MISNLYFVKLKNIGEHEFIKRYIKNYMDIKLLDDVFINEKRGYKV
FT                   DGFKLSYAFPFMSLYDIGWKAISASTSDIIAKGVKPEFYLISLGLPPDFDVNKAEELIG
FT                   GISDAIHYYGGRYVGGDLNDSDSNGWVDVFVEGEVLCDISDKVIDDGDLLVIGDYIGYT
FT                   TNVFISYINNFNIQILPESLLKVKHPIVKKSLLFFMKKYCKFIKYSTDISDGLMVSLYK
FT                   IVDNFNLGINITEIPIDKNVFNSLKLRLNLTELDILKYAGEEFLPLLIIDKNSPVKEML
FT                   AELQYLAFNPLIIGQVIHENRLITYKNTVIKNTGWDNFIGWY"
FT   gene            complement(206337..206424)
FT                   /locus_tag="SSOt13"
FT   tRNA            complement(206337..206424)
FT                   /locus_tag="SSOt13"
FT                   /product="tRNA-Thr"
FT                   /note="1 intron"
FT   gene            complement(206480..207904)
FT                   /gene="purB"
FT                   /locus_tag="SSO0240"
FT   CDS_pept        complement(206480..207904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SSO0240"
FT                   /product="Adenylosuccinate lyase (adenylosuccinase)(ASL)
FT                   (purB)"
FT                   /EC_number="4.3.2.2"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40580"
FT                   /db_xref="GOA:Q980P8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P8"
FT                   /protein_id="AAK40580.1"
FT                   /translation="MRLQYKLINVEHTLQLAMEDSICPLEWRYGSNEMRKFFSREEILK
FT                   RRIQVEIALLKALTKYGLVKEEDVQKVEKASLTIRPEEVDELESKIGHDVMAMVVLMAE
FT                   RSGDSGRYVHFGATSYDIVDTAYALVFRDAIRLVKTKVVEILEMMVSLAIKYKDLAMVG
FT                   RTHGQHALPITLGFKIANYIYEFSRSLERLNEVEKRIVKGKMAGAVGTMAAWGNIGLEI
FT                   EENVMKFLGLRPHEISTQVAPRDAFAELTSDLAILASQCDRFALEVRELMRPEINEISE
FT                   GVEGRVGSSTMPQKENPVTSEKIGGLAKVLRSLVVASLENIPLWHERDLTNSSSERIII
FT                   SHEFLVIDEILDSMISLLRNLRVNFENIEKNLNLTKGQIMAESLMINLTLKGMKRHEAH
FT                   QYVNKLTSKVRQTGKTLLEVCLEDSLILSYFSKQELENVLNPKNYLGSYDKLIERAISY
FT                   AKGVIKGSEIREAQDR"
FT   gene            207852..208922
FT                   /locus_tag="SSO0239"
FT   CDS_pept        207852..208922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0239"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to PAB0547, MJ0136, PH1348,AF0113, MTH1201."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40581"
FT                   /db_xref="GOA:Q980P7"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980P7"
FT                   /protein_id="AAK40581.1"
FT                   /translation="MANCKVCSTFINLYCNLTTMIIATIGSHSALQILHGAKKEGFQTM
FT                   VITDNKRENFYKNFSFIDNIYAYASLDEAVSIINGIKDYGILIPHGSLVEYLGKERVDK
FT                   IETKIFGNKKIFEWEADQKKKMELLRKSNIKIPEIFERPEDVDRLVIVKLNGAKGGKGY
FT                   FLARNKSEVKEGIQKLIESKMIRDENEVIIQEYVVGVPMYFQFFYSDIINRTEIFGIDI
FT                   RYETNIDGLRRLPFEYMKELKINPTFVVVGNIPAVARESLLPVALEYANNFVRTTKELV
FT                   PPGMIGPFCLESIITDNSDIVVFEFSGRIVAGTNLYVNGSPYSWLYWDEPMSIGRRIAR
FT                   EIRVANEKDKLSLVVS"
FT   gene            208923..209972
FT                   /locus_tag="SSO0241"
FT   CDS_pept        208923..209972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0241"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to PAB1272, PH0324, MJ0136, MTH1201,AF0256."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40582"
FT                   /db_xref="GOA:Q980P6"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P6"
FT                   /protein_id="AAK40582.1"
FT                   /translation="MNVKIAALASHSALDVFDGAKDEGFQTIGLCKKGRERPYLEFKAI
FT                   MDKCIILEDFKEIISDKVQSILLSENAIIVPNRSLAVYVGYDGIEKMKTKVFGNRYMLR
FT                   WEERIGEKNYYKILNEAKISIPKLFKPEEIDRPVIVKLPEAKRKVERGFFFAVNKEDFE
FT                   AKLNELLRNNVIDNEGLKNMVIEEFVFGAHFNLNYFYSPIFNRLELISVDRRIQSDWDS
FT                   LYRLPADIQIKLGRIPKLIEVGHEPVTIRESLLEKVFEIGYRFVDATQKLEPPGIIGPF
FT                   TLQVMVTPDLDLVVYDVAPRIGGGTNVYMGTGSQYSKFYFGKPISLGRRIALEIKHAII
FT                   NNLTEKILT"
FT   gene            210097..211104
FT                   /gene="purA"
FT                   /locus_tag="SSO0242"
FT   CDS_pept        210097..211104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SSO0242"
FT                   /product="Adenylosuccinate synthase (IMP--aspartate ligase)
FT                   (purA)"
FT                   /EC_number="6.3.4.4"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40583"
FT                   /db_xref="GOA:Q980P5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P5"
FT                   /protein_id="AAK40583.1"
FT                   /translation="MLELIIGGFFGDEGKGKVAAYLGIKDRPKLSVRTGSINAGHTVTY
FT                   SGRIWKLRIIPSAFINKSTELALGPGALTSLDALFKEMRETETYDRLYIDSHVGIITED
FT                   EIRDEKNDPYLMNVIGSTGQGVGYAESKRILRKLKLAKDYKELEKFIIDVPNKILDYLD
FT                   NGHNILIEGTQGHYLSLYHGEYPYVTSRNTTASGVLSEAGIGPKYVDHIIITFKSYVTR
FT                   VGKGPLEGELTEEDAKKLGLTEYGTVTGRLRRVAPFNVKLAREAIRINSATIVAITKLD
FT                   TLFKDAYRVREYEKLPAEARKWLDELEEELKTPIGLIGTGEDAYDMIDLREEVG"
FT   gene            211105..212514
FT                   /locus_tag="SSO0244"
FT   CDS_pept        211105..212514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0244"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to PAB1091, PH0303, AF0654."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40584"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P4"
FT                   /protein_id="AAK40584.1"
FT                   /translation="MSSYDVVIIGGGPAGLFAAYELAGLAKDNVSNYKILLVDKGARAS
FT                   KRTCPLLSPKEKCTFCDPCHIMYGFGGAGTFSSGIINLRPDIGGELHEITRSWDKAQEL
FT                   INYVDDIFVKFGAPKDRVFEPNMEKVREIQRRAAKVGAEFVPIRQRHMGTDKTPLIIEN
FT                   IVNYVEKRGIKIGELTEVIDIEKKGNKFFLKTSRGEIESRIVLVAPGRAGAKWFYEQSK
FT                   KLGVDTIPGPLDIGVRVETESFVFDELTEAVWDPKVILYSKRYDDKVRTFCVNPRGYIM
FT                   KEVYDDGTIGVNGETYVDKKSNNTNFAFLTTIKLSDPLEDTIEYGKSIARLMTRLGGGK
FT                   PILQRLIDFQKGRRSTWERINRSTVKPTLRDVTPGDISMGLPYRVVDNLIDGLERLDSI
FT                   APGIFSSNTLLYAPEIKYYSVRAVVDNNMETVVDNLFAAGDGTGLSRGINVAAATGILA
FT                   ARGIAIKLGLD"
FT   gene            212541..213524
FT                   /gene="nirD"
FT                   /locus_tag="SSO0245"
FT   CDS_pept        212541..213524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="SSO0245"
FT                   /product="Heme biosynthesis nirD related protein (nirD)"
FT                   /note="Weak similarity with nirD heme biosynthesis protein
FT                   homologs; Cofactor Biosynthesis, Heme"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40585"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P3"
FT                   /protein_id="AAK40585.1"
FT                   /translation="MNLVEISDIDKEILMKLEYEFPFDPQPFNIISDGLKISEEELLNR
FT                   VKKLLEDGIIKRIGMYVSFRAKGMDGALIAARIPQDKIEKFRKIALGIRELTHNYVRDH
FT                   PKFNIWFVLKANDRDTLNENVKELLSHVESNDYVILYSKKTLKLSVKYDVIRGVSWSPN
FT                   NTIRSLSKVPTAEELGINKQLLTELSYPLKISQRPFKEIAEKYKMKEDELVELIKELYD
FT                   KNVIKDYGATLNGEKIGIVENGMVLLDTSNVEQACEKLALNIPEATHVVLRESNDENWK
FT                   YLCYSMIHASKKETIRNVAKEISKETNSRSYMILFSLENLKPGIVI"
FT   gene            complement(213501..214310)
FT                   /gene="pheA"
FT                   /locus_tag="SSO0246"
FT   CDS_pept        complement(213501..214310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="SSO0246"
FT                   /product="Probable chorismate mutase (CM)/prephenate
FT                   dehydratase (PDT) (pheA)"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40586"
FT                   /db_xref="GOA:Q980P2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P2"
FT                   /protein_id="AAK40586.1"
FT                   /translation="MVDADGIYYLGPEGSFTHEAASLFKGKDLKAESTISLVFKRVYER
FT                   ESSIGIVPIENSLEGPVNETLDNLYNYDNIYVIGEIEKKIELVLAARSDNLSQIKRIYS
FT                   HPHAFNEAREKLKELGFNEYIPVESTSKAAKIVSQDSEAAAICSNFAAKLYNLKVLITI
FT                   SSHNNYTRFIVLSKEMNSNGNKSMILFTVPHKPGALYKVLQVFYEYNINISMIYSRPLK
FT                   SIPWQYYFYLEYEGGISNREFIEKLVKSTSVLKIKGSFSKLNNDPGF"
FT   gene            complement(214339..215556)
FT                   /gene="tdcB"
FT                   /locus_tag="SSO0248"
FT   CDS_pept        complement(214339..215556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="SSO0248"
FT                   /product="Threonine dehydratase catabolic (threonine
FT                   deaminase) (tdcB)"
FT                   /EC_number="4.3.1.19"
FT                   /note="Amino Acid Biosynthesis, Aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40587"
FT                   /db_xref="GOA:Q980P1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P1"
FT                   /protein_id="AAK40587.1"
FT                   /translation="MNYLEYFDRIRLAKEKIEKYVHITPIDYSTTFSRIINAKVYLKLE
FT                   NLQKTGSFKVRGAFNKLLSLKEEEKKNGVIAVSAGNHAQGVAYAASTLNIKSTIVMPET
FT                   APASKYLATKSYGAEVVLYGKYLHESMKKAEELIQNTGLIFVHPYSDLDVITGQGTIGL
FT                   ELYDIEPDYVIIPIGGGGLISGISIALKYRFPNVKIIGVQSSSSPSMKVSKDLGRLVEI
FT                   EPSYSIADGILVKSPSELTFSIINELVDDIVLVDDEEIAEAIVLLLERSKTLAEGAGAA
FT                   ALASLISGKVKVNGIDKKVISLVSGGNIDLSLLSTLTEKFLYRQKRVVKVRVIVPDKPG
FT                   QLNKVLSYVVKIRGNIIDIVHDRHSSDVLPGYTKIYITFELQSSEAITLLLTNLANEGI
FT                   DVKIVE"
FT   gene            complement(215580..216095)
FT                   /gene="hit"
FT                   /locus_tag="SSO0249"
FT   CDS_pept        complement(215580..216095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="SSO0249"
FT                   /product="HIT-like protein, hypothetical (hit)"
FT                   /note="HIT family hydrolase; Central Intermediary
FT                   Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40588"
FT                   /db_xref="GOA:Q980P0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:Q980P0"
FT                   /protein_id="AAK40588.1"
FT                   /translation="MDILWAPWRAKYISETSKVKQDECLFCRVIKEENDEQNYIVYRGK
FT                   HAFIILNAFPYNTAHVMVVPYRHVPSVELLSNDEALDIFTLSTIAIRAIRDIYAPDGFN
FT                   IGVNIGRVAGAGIESHIHVHIVPRWNGDSNFMPVIFNTKVMPETLSDTFKKLNTKVNEI
FT                   MKKPSRSE"
FT   gene            complement(216135..217109)
FT                   /gene="radA"
FT                   /locus_tag="SSO0250"
FT   CDS_pept        complement(216135..217109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SSO0250"
FT                   /product="DNA repair protein radA (radA)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40589"
FT                   /db_xref="GOA:Q55075"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="PDB:2BKE"
FT                   /db_xref="PDB:2DFL"
FT                   /db_xref="PDB:2Z43"
FT                   /db_xref="PDB:2ZUB"
FT                   /db_xref="PDB:2ZUC"
FT                   /db_xref="PDB:2ZUD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55075"
FT                   /protein_id="AAK40589.1"
FT                   /translation="MSNEVEQKKNIKTINDLPGISQTVINKLIEAGYSSLETLAVASPQ
FT                   DLSVAAGIPLSTAQKIIKEARDALDIRFKTALEVKKERMNVKKISTGSQALDGLLAGGI
FT                   ETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIENMAK
FT                   ALGLDIDNVMNNIYYIRAINTDHQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPG
FT                   RENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMARPDMFYGDPTVAVGGHTLYHVP
FT                   GIRIQLKKSRGNRRIARVVDAPHLPEGEVVFALTEEGIRDAEE"
FT   gene            complement(217166..217711)
FT                   /locus_tag="SSO0251"
FT   CDS_pept        complement(217166..217711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40590"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N9"
FT                   /protein_id="AAK40590.1"
FT                   /translation="MPFKEGIRMSFSEARIDEVRSKLEVIFSRYNCMNKLSEFICNKSF
FT                   YELKGKYNQLFMLTNNVDKDRLLEFLSGLLSKGLHPYSIGIPIIIYDMSEILPTLAFGR
FT                   YLAEICENKLVIFNYNLIYKIIYKKPIYINYAYNYKDVIIVDKMNNFIAYAKVKSKKRG
FT                   VHEVIPVKDIGWYLRRGG"
FT   gene            complement(217690..218709)
FT                   /locus_tag="SSO0252"
FT   CDS_pept        complement(217690..218709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0252"
FT                   /product="Proliferating-cell nucleolar antigen p120
FT                   homolog"
FT                   /note="FMU/NOL1/NOP2 family protein; Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40591"
FT                   /db_xref="GOA:Q980N8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N8"
FT                   /protein_id="AAK40591.1"
FT                   /translation="MENRIAKYLSAHYNLFQISPSYKAKRLASKYRFLDYMIERYLNMF
FT                   STEEELEEYLNSCSFPLKKSIRCNTLKTDCKKLEEIMLEKGFVLEKVKWLQHGYVVKRT
FT                   PPKPSLGSTLEYLMGYYHIQGLASMVPAYVLNPSYDDFVLDMAAAPGGKTTQLSQIMQN
FT                   KGLVIAVEKKRSRIRALLSNVNRLGAENVVLIKTDALNLININKSQFDKILLDAPCSGE
FT                   GLIQKDPTRRYKTTMDDLRDFAHLQLSLIEIAYELLKKGGYIVYSTCSVAPEEDELIVN
FT                   FAIEELGMKAMSVEGYPASNGYIEYYTTRFSNDVKNCLRFFPHKQGTEGFFLCLLKKE"
FT   gene            218719..219279
FT                   /gene="cyaB"
FT                   /locus_tag="SSO0253"
FT   CDS_pept        218719..219279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaB"
FT                   /locus_tag="SSO0253"
FT                   /product="Adenylate cyclase, cyaB-type, putative (cyaB)"
FT                   /EC_number="4.6.1.1"
FT                   /note="Cellular Processes, Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40592"
FT                   /db_xref="GOA:Q980N7"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N7"
FT                   /protein_id="AAK40592.1"
FT                   /translation="MIEKEVKIVVEYPSLEELRESLGKDMKLLDVEKQEDVYFNYVYRN
FT                   FKITDEAVRIRINNKGIELTYKGPKLHSSLKAREEISITVNDLNKTIELLRKIGFYPVI
FT                   TIKKTRINYLDKSFIVSLDLVKDLGQFIEIEAINEISDQEIQNYTSNFIRKYKIKGKLT
FT                   TKSYLELLIDKYEASSKSNSNTY"
FT   gene            219233..220078
FT                   /locus_tag="SSO0254"
FT   CDS_pept        219233..220078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0254"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with TM0660, aq_2196, APE2338, AF0461,
FT                   PAB1317, PH0463, MJ1651"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40593"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N6"
FT                   /protein_id="AAK40593.1"
FT                   /translation="MINMRRVPNQIAILTDFGLNDNYNGVMEAVIKKINPEAKITYISG
FT                   NSKPFNLIAGAYLLYTSYKYFPRNTIFLVVIDPGVGTSRRPLIIKTKNYVFIGPDNGVL
FT                   YPAITSEEIVKIIEIKNEKLYLAKTISNTFHGRDIFSVAAAFISIGVEIDTFGNQVRYE
FT                   DLTKLNFTYKPSKSEICGKVLYIDHFGNVATSIPKEVLLNNFKYDENIEIKVNNSKHKC
FT                   RFVKTFGYGMENELLIYFNGYFLVEIGINKGSAKDKLNVREGDEICLEGYIQEDFSHSI
FT                   "
FT   gene            220198..220551
FT                   /locus_tag="SSO0255"
FT   CDS_pept        220198..220551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0255"
FT                   /product="Nicotinamide mononucleotide adenylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.1"
FT                   /note="Amino-end extention is missing compared to other
FT                   homologues; Cofactor Biosynthesis, Pyridine nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40594"
FT                   /db_xref="GOA:P57084"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57084"
FT                   /protein_id="AAK40594.1"
FT                   /translation="MIRNSLKDVGMDLSRIYIIPMPDILMNNIWAHYVSTYTPKFEVVF
FT                   ARNPLVVRIFKEAGYKVEIPPAFNREKYNSTYIRRLIILNDNWSELVPKPVYKYILEIK
FT                   GDQRLREIVGTDK"
FT   gene            complement(220557..221096)
FT                   /locus_tag="SSO0256"
FT   CDS_pept        complement(220557..221096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0256"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40595"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980N5"
FT                   /protein_id="AAK40595.1"
FT                   /translation="MLISGVDDGYFPLSYKGGKGKTALVVVTFYDYEIIDLDWGFITVD
FT                   GNDATNVFKQLRKGDIVILDGVIFAGFNYIVPYSDRMIFFYSKMPKIDLIKKTLMKHFQ
FT                   SDTERVREILYVLNNLKQIPTKRGNVFLYSTVELSLAKSIIEKYQIYSKIPEVLKSAHI
FT                   IASSLGRFLAHYKKKI"
FT   gene            complement(221077..222270)
FT                   /gene="cdc6-1"
FT                   /locus_tag="SSO0257"
FT   CDS_pept        complement(221077..222270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdc6-1"
FT                   /locus_tag="SSO0257"
FT                   /product="Cell division control 6/orc1 protein homolog
FT                   (cdc6-1)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40596"
FT                   /db_xref="GOA:Q980N4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2QBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980N4"
FT                   /protein_id="AAK40596.1"
FT                   /translation="MSDIIDEVISSFKTSSIFINREYLLPDYIPDELPHREDQIRKIAS
FT                   ILAPLYREEKPNNIFIYGLTGTGKTAVVKFVLSKLHKKFLGKFKHVYINTRQIDTPYRV
FT                   LADLLESLDVKVPFTGLSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKL
FT                   SRINSEVNKSKISFIGITNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQ
FT                   MAFKPGVLPDNVIKLCAALAAREHGDARRALDLLRVSGEIAERMKDTKVKEEYVYMAKE
FT                   EIERDRVRDIILTLPFHSKLVLMAVVSISSEENVVSTTGAVYETYLNICKKLGVEAVTQ
FT                   RRVSDIINELDMVGILTAKVVNRGRYGKTKEIGLAVDKNIIVRSLIESDSRFADLWS"
FT   gene            222725..222798
FT                   /locus_tag="SSOt14"
FT   tRNA            222725..222798
FT                   /locus_tag="SSOt14"
FT                   /product="tRNA-Ala"
FT   gene            complement(222803..224134)
FT                   /locus_tag="SSO0258"
FT   CDS_pept        complement(222803..224134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0258"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to MJ1095, PH1812, APE0656, PAB0247, AF2259,
FT                   MTH966"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40597"
FT                   /db_xref="GOA:Q980N3"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N3"
FT                   /protein_id="AAK40597.1"
FT                   /translation="MKYVIGIDDHDSYKFGCTTHFSVILTSYLYKNHSTILLDLPYLVR
FT                   LNPNIPWKTRGNASIKLIVEFNGTKKELADIIFSYSIEYVKDVSLALEHGRKPGIAIME
FT                   YDKYITLFDKLYDFYIKGISDIIPIDYAKKFAEKNDIELRGDRGIIGSIAGLGMSGDYT
FT                   YELITYRKKENWLKKRMINKDSVKRVDESTFPLTFANYDYINDTPLITPHGTDPILYGI
FT                   RGASIQHLIKAMELIESNEDIDFFAIFKTNQSTDIHFQKIGNRFYQETKKVVQVKNVRI
FT                   LEGGDVIVETTDNDILFVYKETGELNSAAKLLKKGDEIVAYGAVKPSIAYGKIIELERF
FT                   EILKLYDLELVNPKCPRCGGSTNSLGKNKGYRCKKCKYIINTTNKSTKNIMRNLSLGMY
FT                   QTRSYRHLTKPIFLELENNKPSFYEERKFLEMYRSTLYKLDYHL"
FT   gene            complement(224131..224382)
FT                   /locus_tag="SSO5522"
FT   CDS_pept        complement(224131..224382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5522"
FT                   /product="Regulatory protein, AsnC family, putative"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40598"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N2"
FT                   /protein_id="AAK40598.1"
FT                   /translation="MASAIVLINTDAGGEEEVFEKLKNMNEVVEAYVVYGVYDIVIKVE
FT                   TENMDKLKNFISNSIRKIPKVRSTLTMIIMEGRSVIKK"
FT   gene            complement(225253..226020)
FT                   /locus_tag="SSO0259"
FT   CDS_pept        complement(225253..226020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0259"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to PH1124, PAB0735, APE0321, Ta0995, MJ1250,
FT                   AF0403"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40599"
FT                   /db_xref="GOA:Q980N1"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR010946"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980N1"
FT                   /protein_id="AAK40599.1"
FT                   /translation="MRILKKKMKLKGKVKKYLIDKLNDNEKLHFSLIDPFKINSSDELK
FT                   YITKNLYNAGTDAFLIGGTLGVSKDKLDFVISLLDDYEIPKIIFPSNINLLSEKADALL
FT                   FMSLLNSDDIYYIIGAQIVAAPIIKMLQMEVIPTAYVIVGHGGTAAHIGKARVIPYDNF
FT                   ELATAYTLAAEYLGMSFVYLEAGSGAPEPIRPEMISFIKNASSIPLIVGGGIRSVEVAL
FT                   KLVEAGADIIVTGNIIESDVNKAIKIIRGIKNK"
FT   gene            complement(225950..226273)
FT                   /locus_tag="SSO0260"
FT   CDS_pept        complement(225950..226273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0260"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40600"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniProtKB/TrEMBL:Q980N0"
FT                   /protein_id="AAK40600.1"
FT                   /translation="MGGKRRKRTKIIRVKPKLPKTFECPRCGKVSVSVKIKDNIATITC
FT                   GSCGLYTEVEVPPVFDEANAYSKFIDMYLEGRLQIKERTNENTEEENEIEGESEEISHR
FT                   QVE"
FT   gene            complement(226429..226788)
FT                   /locus_tag="SSO0261"
FT   CDS_pept        complement(226429..226788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0261"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0663"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40601"
FT                   /db_xref="GOA:Q980M9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M9"
FT                   /protein_id="AAK40601.1"
FT                   /translation="MSSNQTNRLLLKARRVVKEGRFVSLTLNDALFRIFIYIGRNNDYI
FT                   LNLNFCSCSFYIFNVVLRGKYDFCYHVLGLKYALEKDQITKIELYADDFKEILTEIYAY
FT                   GKSLKLRRILNKVES"
FT   gene            227300..227599
FT                   /locus_tag="SSO0262"
FT   CDS_pept        227300..227599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0262"
FT                   /product="Integrase, probable(amino-end fragment)"
FT                   /note="Multicopy; Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40602"
FT                   /db_xref="InterPro:IPR012922"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M8"
FT                   /protein_id="AAK40602.1"
FT                   /translation="MIREFPKTTNGDVIIRERKGKYYVYKLETINGEVKETYVGPLADV
FT                   VETYEKLKDSSGGVRVSPTTWARWDLNPGPPPCQGDVLTRLDDGPLILGYCFLF"
FT   gene            complement(227495..227569)
FT                   /locus_tag="SSOt15"
FT   tRNA            complement(227495..227569)
FT                   /locus_tag="SSOt15"
FT                   /product="tRNA-Val"
FT   gene            complement(227596..228060)
FT                   /locus_tag="SSO0264"
FT   CDS_pept        complement(227596..228060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0264"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with MJ119, APE2001"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40603"
FT                   /db_xref="InterPro:IPR018665"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M7"
FT                   /protein_id="AAK40603.1"
FT                   /translation="MKELYFGLHNLTSNQRLLDFSKLAFNVKYVKYLVLTKVGGTAAQS
FT                   GVPEVNKLAFKYNKPILVLPELKDAIELLKPEITLLVSQNAEKQIDFNDMIKHDKILIV
FT                   FSGLEGGGFNKIEQSLGEYVRILEDTQDLGAVSLASFFLCKYLQLVEGKV"
FT   gene            complement(228032..229009)
FT                   /locus_tag="SSO0265"
FT   CDS_pept        complement(228032..229009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0265"
FT                   /product="DNA modification methylase, type II R/M system"
FT                   /note="Cytosine-specific methyltransferase; Replication and
FT                   Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40604"
FT                   /db_xref="GOA:Q980M6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M6"
FT                   /protein_id="AAK40604.1"
FT                   /translation="MELIKIIDLFSGAGGFSLGFKKLGIEPKLAIDINHAATRTYSLNF
FT                   PNTIVIEDDIREISGGEILKNVGNDIDVVIGGPPCEGYTAANPLRMQDPLDRLYLDQRG
FT                   NLTLEFIRIVDEVKPKIFVMENVPAIIETQSLRDALINEFKKAGYGNIFFNILHAEDYG
FT                   NPSKRSRVFISNVRISPIKNQKRITVYDAIHDLDNKLDVPNNEVSEPNEKKLLKISKIG
FT                   YGKYLTMYRASKGRSIPLYIRLSPFDLAPTILGNSRFIHPFHDRFLTVREQARLMSYPD
FT                   DHVFLGSKDEQYNQVGESVPVALSTAIAKEILGILNERTIFRPT"
FT   gene            complement(228987..229523)
FT                   /gene="tfE"
FT                   /locus_tag="SSO0266"
FT   CDS_pept        complement(228987..229523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfE"
FT                   /locus_tag="SSO0266"
FT                   /product="Transcription Factor E (TFE), TFIIE alpha subunit
FT                   homolog (tfE)"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40605"
FT                   /db_xref="GOA:Q980M5"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR016481"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="PDB:1Q1H"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980M5"
FT                   /protein_id="AAK40605.1"
FT                   /translation="MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNI
FT                   KVNDVRKKLNLLEEQGFVSYRKTRDKDSGWFIYYWKPNIDQINEILLNRKRLILDKLKT
FT                   RLEYEKNNTFFICPQDNSRYSFEEAFENEFKCLKCGSQLTYYDTDKIKSFLEQKIRQIE
FT                   EEIDKETKLGANKNH"
FT   gene            complement(229516..229998)
FT                   /locus_tag="SSO0267"
FT   CDS_pept        complement(229516..229998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0267"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to MJ1385, APE2006, PH0461, PAB1040, AF0751,
FT                   MTH1113, Ta0931"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40606"
FT                   /db_xref="GOA:Q980M4"
FT                   /db_xref="InterPro:IPR002845"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980M4"
FT                   /protein_id="AAK40606.1"
FT                   /translation="MTTHVILVARAFGAKGVYIEGKDEKMVKSILKVIDSWGGSSYFLV
FT                   KEIENGKSIVNEWKEKGGTIIHLTMYGININDFQDRFEKIKYPLLIIVGAEKVEGWYYH
FT                   NADYNIAIGNQPHSEVAALAIFLDRIYKGRELYMEFEDAKIKILPQKAGKKVIRSG"
FT   gene            complement(230049..231119)
FT                   /gene="hflX"
FT                   /locus_tag="SSO0269"
FT   CDS_pept        complement(230049..231119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SSO0269"
FT                   /product="GTP-binding protein (hflX)"
FT                   /note="Predicted GTPase of the Era/HflX family;
FT                   Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40607"
FT                   /db_xref="GOA:Q980M3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="PDB:2QTF"
FT                   /db_xref="PDB:2QTH"
FT                   /db_xref="PDB:3KXI"
FT                   /db_xref="PDB:3KXK"
FT                   /db_xref="PDB:3KXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980M3"
FT                   /protein_id="AAK40607.1"
FT                   /translation="MKTAALFVSKEFEEEAIALVEGANYKVTSIYKLPKSPNVKFYIQY
FT                   DKLQQIKNDEEISTLIIFEQLKPRHFINIRRELKGKEVLDKILLLLEIFALHAGSKEAK
FT                   MQIELARLKYELPIIKETYTKSKIGEQQGPLGAGTYGVESTIKFYKRRINKLMKELESI
FT                   KIFKEKSIESNKRNNIPSIGIVGYTNSGKTSLFNSLTGLTQKVDTKLFTTMSPKRYAIP
FT                   INNRKIMLVDTVGFIRGIPPQIVDAFFVTLSEAKYSDALILVIDSTFSENLLIETLQSS
FT                   FEILREIGVSGKPILVTLNKIDKINGDLYKKLDLVEKLSKELYSPIFDVIPISALKRTN
FT                   LELLRDKIYQLATQLS"
FT   gene            complement(231116..231613)
FT                   /gene="MBP-like"
FT                   /locus_tag="SSO0270"
FT   CDS_pept        complement(231116..231613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MBP-like"
FT                   /locus_tag="SSO0270"
FT                   /product="Multiprotein Bridging Factor (MBP-like), putative
FT                   (MBP-like)"
FT                   /note="Similar to APE2011, PH0783, AF1977, MTH729, PAB0842,
FT                   Ta0948, MJ0586; Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40608"
FT                   /db_xref="GOA:Q980M2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="PDB:2MEZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M2"
FT                   /protein_id="AAK40608.1"
FT                   /translation="MQANSEEYCELCGSQIRGKGITVSYEGSIITVCNSCYDRIRKHAV
FT                   IVKADSKKSETRKKATLKPPKMENAELEIVTDYYKIIKTAREQLGISQQQLAQKLKVSE
FT                   NIVKRFESGKLKPTISQARQLEKILGIKLVTPLENNEESEKEFDDTGLTLGDVVNIKEG
FT                   KK"
FT   gene            231686..232867
FT                   /locus_tag="SSO0271"
FT   CDS_pept        231686..232867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0271"
FT                   /product="AAA family ATPase"
FT                   /note="26S protease regulatory subunit 4, putative;
FT                   Proteases, Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40609"
FT                   /db_xref="GOA:Q980M1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980M1"
FT                   /protein_id="AAK40609.1"
FT                   /translation="MSGDFDTIRDASSPDEVQLVRLLEEKIKSLQIEIENLRKELNYYK
FT                   AEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNIASHIDQKLIKPGISVALNQR
FT                   GSTILEVLPQKEDPIVKTMEIIERPNVTYSEIGGLEEQIRELREVVELPLKNPEIFREI
FT                   GVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEM
FT                   AKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFDPLDNVKIIAATN
FT                   RIDILDPALLRPGRFDRIIEVPLPDFKGRTEIFNIYLKKMKIEDNINLELLSQLTEGFS
FT                   GADIKNVCVEAAYMAIRDGRNKVTMNDLVEAINKINVKRNKMESMKERREKYS"
FT   gene            233034..233282
FT                   /locus_tag="SSO5542"
FT   CDS_pept        233034..233282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5542"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some similarity with AF0708"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40610"
FT                   /db_xref="GOA:Q980M0"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:Q980M0"
FT                   /protein_id="AAK40610.1"
FT                   /translation="MLTSRGELYLVLRAQDVLFSLTLLSGSVIKECSKFPEYRVIIPNS
FT                   FEEFIKNGRNVFSKHVIAVDKRIRAGDDVIVVNENDS"
FT   gene            233371..233670
FT                   /locus_tag="SSO0273"
FT   CDS_pept        233371..233670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0273"
FT                   /product="Hypothetical protein"
FT                   /note="Possible frameshift with SSO5544."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40611"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L9"
FT                   /protein_id="AAK40611.1"
FT                   /translation="MSNVKIVIKKDLSELKGSTFITGFRTIGEVGYLAIRHLALKRKME
FT                   RIGYVVTKYYRDVTFLDDYGIATPFDIFYDKDKHLVLLLNHILPFQREWNDFAS"
FT   gene            233827..234093
FT                   /locus_tag="SSO5544"
FT   CDS_pept        233827..234093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5544"
FT                   /product="Hypothetical protein"
FT                   /note="Possible frameshift with SSO0273."
FT                   /db_xref="EnsemblGenomes-Gn:SSO5544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40612"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L8"
FT                   /protein_id="AAK40612.1"
FT                   /translation="MVGPLALFTLHSEIEDLPALVLLPYADRERTDPVAAATAIEVLNK
FT                   MLSLNVSVDELYEEAKRIEEDLQRQMELLQKELSRGSADRVYM"
FT   gene            complement(234061..235572)
FT                   /gene="tgtA"
FT                   /locus_tag="SSO0274"
FT   CDS_pept        complement(234061..235572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgtA"
FT                   /locus_tag="SSO0274"
FT                   /product="Queuine/archaeosine-tRNA-ribosyltransferase
FT                   (tgtA)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40613"
FT                   /db_xref="GOA:Q980L7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004804"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980L7"
FT                   /protein_id="AAK40613.1"
FT                   /translation="MTVFEVKYEDLAGRIGTLRTRSGTLETPAFFPVINVLKKDEISID
FT                   EIRNIGFKNFITNSYILYKNNYIKDDIHKELRSEEMIIMTDSGAYQILEYGEIGITNLQ
FT                   IVNYQLKIKPDIGVILDLPTGNINDYDNAKKTVYETLKRAEEASEIIVKNQDNNIIWVY
FT                   PIQGGRYLDLVKTSAEGLSKFEHIYNMAALGSPTVLLEKYMYDTVIDMIYTAKSNIKRG
FT                   IPFHLFGGGLPHIIPFAVALGVDSFDSASYIIYARDNRYITRTRVYKLEDLEYFPCSCP
FT                   ICSKYTPKDLLEMNEKERTKALAIHNLYTILEEFKATKQAIKEGRLFEYLQEKAYSHPA
FT                   VYSAFKRLMKYKDYLEKFDPRIRGDPKGLFLFDGNSLHRPEIIRHSRFLERYIQKKDKI
FT                   SIYCYDKAISDTAYDFKEKIREKIADRNESDVFIAVPFFGLIPLEISDSYPLSQFEIPN
FT                   EIDEDVIDDMKTKIISFLRRNNYQKVELINCEKLGLHIDSISTSS"
FT   gene            complement(235569..236009)
FT                   /locus_tag="SSO0276"
FT   CDS_pept        complement(235569..236009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0276"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40614"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR028277"
FT                   /db_xref="InterPro:IPR037156"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L6"
FT                   /protein_id="AAK40614.1"
FT                   /translation="MSSGRRISSELNNLIDKTVIVKTTNGKTYTGQLYAYELSPFIISL
FT                   TNVKDDSNNTFYKLMINGNSISEIIIKNPPLFEPREFAELVEKSLNLRPADIKVYDETS
FT                   VVTILEKIKVSQNGVEGSGPMAQRIYDLYNDYINKKKKELGL"
FT   gene            236056..236454
FT                   /gene="rpoG"
FT                   /locus_tag="SSO0277"
FT   CDS_pept        236056..236454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoG"
FT                   /locus_tag="SSO0277"
FT                   /product="DNA-directed RNA polymerase, subunit G (rpoG)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40615"
FT                   /db_xref="GOA:Q980L5"
FT                   /db_xref="InterPro:IPR031555"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L5"
FT                   /protein_id="AAK40615.1"
FT                   /translation="MMESVAQEIILSCEINSIERGSLKNLSMVNMSCNGFNVSFDIIDS
FT                   INIFSQKEKVKVIISKNRPSYSHDDFCGHGYIVTELKDSSLNNGNKYTTIISLYGLLVK
FT                   IISNKESFLRTSQLNIMDHVYFCVKKNN"
FT   gene            complement(236451..237041)
FT                   /locus_tag="SSO0278"
FT   CDS_pept        complement(236451..237041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0278"
FT                   /product="Proteasome subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40616"
FT                   /db_xref="GOA:Q980L4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980L4"
FT                   /protein_id="AAK40616.1"
FT                   /translation="MEELPATAVGLKVNDGIVLASERRLSYGGYVLSKQAKKVYKINKF
FT                   LMAGAGIYGDLQTLTRIMNVEIKYYEVSTGKPISVHAAAKLLSVILYQYKVMPFISEIL
FT                   FGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMSLDVATQLITKA
FT                   IKASIERDITSGDGIDLAIIDKKGNYENKFIPY"
FT   gene            complement(237076..238356)
FT                   /gene="hisS"
FT                   /locus_tag="SSO0279"
FT   CDS_pept        complement(237076..238356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="SSO0279"
FT                   /product="Histidyl-tRNA synthetase (hisS)"
FT                   /EC_number="6.1.1.21"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40617"
FT                   /db_xref="GOA:Q980L3"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980L3"
FT                   /protein_id="AAK40617.1"
FT                   /translation="MVKFETVRGMKDYIGIDAEKIRYLESTFRDLAKKYGYSEIITPVV
FT                   EEFKLFELKGGEELRQTMYVFKDKADREISLRPEITPSVARAYIQNLQSSPKPIRLFYF
FT                   GTVYRYDEPQYGRYREFRQAGIEMIGDSSILADVEVLDLLYNFYDKLNLSKDITIKINN
FT                   IGIFRKIMDKYNIEDNLQEHVLHLIDKNKVDEALVILEKNIKNKDIMDFLNMILTKKEA
FT                   KLEDIESLAELEEVSKLDIKNEFEYLLRLSRILSSLNVKFKVDLGFVRGLAYYTGLIFE
FT                   VLHPSVQFSIAGGGRYDKLIELYGGLPSPAIGFAIGVERTLLVIKDLKVEEPINVIVVG
FT                   ISEEAIPAMFTVSRMLRKEEYKVVINTKDQPLSKLLPYYASQGFKLAIIIGKQELEKNM
FT                   ITVRNLITRKQISIPLENVLDAIKQTL"
FT   gene            complement(238363..238896)
FT                   /locus_tag="SSO0281"
FT   CDS_pept        complement(238363..238896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0281"
FT                   /product="Hypothetical protein"
FT                   /note="Weak similarity with tRNA intron endonuclease
FT                   (enda)"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40618"
FT                   /db_xref="GOA:Q980L2"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L2"
FT                   /protein_id="AAK40618.1"
FT                   /translation="MPIIVNIVDNCTTITTHYFSVLIIPNYFIRTTCRALHMKTITFMG
FT                   NILIFDNVTIMSEKSETTLDKIYTALNSSKQLPSEIIYLVNWDKVDVFVDLKQRGRVTI
FT                   DGIDEHSLIIKDKENGRYTAMVLIVDENEKVSFKKILDKLHQSKSMNLELYLSIVDKYG
FT                   DVTYYTLSEIKMSK"
FT   gene            238786..239298
FT                   /locus_tag="SSO0280"
FT   CDS_pept        238786..239298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0280"
FT                   /product="Hypothetical protein"
FT                   /note="Similar to S. shibatae YTF2_SULSH (P46221) protein
FT                   in TF55 5' region"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40619"
FT                   /db_xref="GOA:Q980L1"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L1"
FT                   /protein_id="AAK40619.1"
FT                   /translation="MQCPACGSNEIIWDNKNGEIVCSNCGTIIDNIYYNGQNESESTEI
FT                   ISINNKFYKDDIQVKELRVKNFLKNNRIETKKIDQYEIILRSMLLDSQYKKIYKLLYDE
FT                   GILSGLKAKSKLGLLIYFRFALNNGYLHLLEKFDIKNETLKKILKRIGRKRLTLLFDKL
FT                   NEESDRI"
FT   gene            239345..241018
FT                   /gene="thsB"
FT                   /locus_tag="SSO0282"
FT   CDS_pept        239345..241018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thsB"
FT                   /locus_tag="SSO0282"
FT                   /product="Thermosome beta subunit(thermophilic factor 55)
FT                   (ring complex beta subunit)(chaperonin beta subunit)
FT                   (thsB)"
FT                   /note="Translation, Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40620"
FT                   /db_xref="GOA:Q9V2T8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PDB:4XCD"
FT                   /db_xref="PDB:4XCG"
FT                   /db_xref="PDB:4XCI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9V2T8"
FT                   /protein_id="AAK40620.1"
FT                   /translation="MRKMATATVATTPEGIPVIILKEGSSRTYGKEALRANIAAVKAIE
FT                   EALKSTYGPRGMDKMLVDSLGDITITNDGATILDKMDLQHPTGKLLVQIAKGQDEETAD
FT                   GTKTAVILAGELAKKAEDLLYKEIHPTIIVSGYKKAEEIALKTIQEIAQPVTINDTDVL
FT                   RKVALTSLGSKAVAGAREYLADLVVKAVAQVAELRGDKWYVDLDNVQIVKKHGGSVNDT
FT                   QLVYGIVVDKEVVHPGMPKRIENAKIALLDASLEVEKPELDAEIRINDPTQMHKFLEEE
FT                   ENILKEKVDKIAATGANVVICQKGIDEVAQHYLAKKGILAVRRAKKSDLEKLARATGGR
FT                   VISNIDELTSQDLGYAALVEERKVGEDKMVFVEGAKNPKSVSILIRGGLERVVDETERA
FT                   LRDALGTVADVIRDGRAVAGGGAVEIEIAKRLRKYAPQVGGKEQLAIEAYANAIEGLIM
FT                   ILAENAGLDPIDKLMQLRSLHENETNKWYGLNLFTGNPEDMWKLGVIEPALVKMNAVKA
FT                   ATEAVTLVLRIDDIVAAGKKSGSEPSGKKEKDKEEKSSED"
FT   gene            complement(241015..242643)
FT                   /locus_tag="SSO0283"
FT   CDS_pept        complement(241015..242643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0283"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE2093, Ta0159, MJ1565, MJ1429,
FT                   PAB0810, AF1060, AF1030."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40621"
FT                   /db_xref="GOA:Q980L0"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980L0"
FT                   /protein_id="AAK40621.1"
FT                   /translation="MKMNKNLWIPILLIILGIGFLFHNLININLMFFVFPIIMIVVISF
FT                   IFRNSLKVKINKFILKNGIFQIMYDNTCICGVAMKITGKIEPTSNKNDIEKELKDFINA
FT                   IARKDSEFKFIIFTIVEKNKLGSSIIIYRILQHSTDIELDSFMEEVNNLLVLAKAIAPH
FT                   LEFKIIQPSKNVLPIPMAFGNYPFLTVSEITYTNPINSNIVSEDFDVEIGEATNGTVTS
FT                   RVGIRVKDITRHIGIFGSTGSGKTNTAILLASQLNAKGVKVIILDWHGEYDQLLKNGFR
FT                   IYDEKTIVKINPLHLIDLDVEDTVDIIGDVLQLTDPQRFLLYTILLKLKSYRKFSINQL
FT                   LEVINSIEDTSYWMRDVKYALLRKIFILFTPTASKLFSTVDETSLNDFPDYLTSSTIIN
FT                   LGFISNLKLRKLYSLFLIKLIVESYIRYKINQQTLIILDEAQNYFNREGNEFIDRLASE
FT                   IRKYNIGLCFITQSPSLLSQNVLKNTNIKIIHSIKSDVDKKAIRDTLSLDERLTQSLDK
FT                   LDVGEAIISAPNLKIPIIIKIKKIS"
FT   gene            complement(242664..243029)
FT                   /locus_tag="SSO0284"
FT   CDS_pept        complement(242664..243029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0284"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40622"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K9"
FT                   /protein_id="AAK40622.1"
FT                   /translation="MDIANINNLIKHDDEYVSQVLPLLPSEGVLRQACFLYFNYDTSRN
FT                   KIRSPIMFFLLLLLPFEQIKDALDYIRGEINSVNELYLIECIKNTSAQENFLPYQIMGN
FT                   KERLILTKNALVLIDSL"
FT   gene            complement(243065..243316)
FT                   /locus_tag="SSO5559"
FT   CDS_pept        complement(243065..243316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5559"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40623"
FT                   /db_xref="GOA:Q980K8"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K8"
FT                   /protein_id="AAK40623.1"
FT                   /translation="MPKVILKGPLISQFNFREIYVNDRELLRVLVKIDSKKHLILNESN
FT                   QLKSGILILINGKDWRLYRNQLLNDNDIIEIIPINHGG"
FT   gene            complement(243318..243557)
FT                   /gene="rps17E"
FT                   /locus_tag="SSO5561"
FT   CDS_pept        complement(243318..243557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17E"
FT                   /locus_tag="SSO5561"
FT                   /product="SSU ribosomal protein S17E (rps17E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40624"
FT                   /db_xref="GOA:Q980K7"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980K7"
FT                   /protein_id="AAK40624.1"
FT                   /translation="MGNIYTKDIKRIVKEIYDRYKDEIKDDYNTNKQIVIRYVDVKSKK
FT                   VRNRIAGYLTRYYKIMKEKETSPAEEKEEISEEI"
FT   gene            complement(243568..244716)
FT                   /locus_tag="SSO0286"
FT   CDS_pept        complement(243568..244716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0286"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Very similar to APE1109, MTH1686, PH0759, Ta1428,
FT                   PAB1515, aq_1790, AF1442, MJ0299"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40625"
FT                   /db_xref="GOA:Q980K6"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K6"
FT                   /protein_id="AAK40625.1"
FT                   /translation="MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNIISDY
FT                   YITYVGDDLQLIMTHNRGELDTRVHETAWNAFKEAAKIAKDLGLYAAGQDLLSDSFSGN
FT                   LRGMGPGIAEIEFEERPAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHE
FT                   GYKFEVLDVYEGESIMLNTPEESYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLN
FT                   LIAGKYVGKDDPVMVVRAQHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDAR
FT                   ATRFDGPPRLISLGFNIKNGKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRL
FT                   EPQEMEYTTLPLVIEKLKNRFKKETDMYKTKPSVYSHESSHE"
FT   gene            complement(244748..246550)
FT                   /locus_tag="SSO0287"
FT   CDS_pept        complement(244748..246550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0287"
FT                   /product="RNase L inhibitor"
FT                   /note="Central Intermediary Metabolism, RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40626"
FT                   /db_xref="GOA:Q980K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3OZX"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K5"
FT                   /protein_id="AAK40626.1"
FT                   /translation="MRVAVINYDFCKPDKCNLECINFCPVDRSGGKAIELSEIVKGKPV
FT                   IYEETCIGCGICVKKCPYEAISIVNLPDELEGEVIHRYKVNGFKLFGLPTPKNNTILGV
FT                   LGKNGVGKTTVLKILAGEIIPNFGDPNSKVGKDEVLKRFRGKEIYNYFKELYSNELKIV
FT                   HKIQYVEYASKFLKGTVNEILTKIDERGKKDEVKELLNMTNLWNKDANILSGGGLQRLL
FT                   VAASLLREADVYIFDEPSSYLDVRERMNMAKAIRELLKNKYVIVVDHDLIVLDYLTDLI
FT                   HIIYGESSVYGRVSKSYAARVGINNFLKGYLPAENMKIRPDEIKFMLKEVSDLDLSKDL
FT                   KTKMKWTKIIKKLGDFQLVVDNGEAKEGEIIGILGPNGIGKTTFARILVGEITADEGSV
FT                   TPEKQILSYKPQRIFPNYDGTVQQYLENASKDALSTSSWFFEEVTKRLNLHRLLESNVN
FT                   DLSGGELQKLYIAATLAKEADLYVLDEPSSYLDVEERYIVAKAIKRVTRERKAVTFIID
FT                   HDLSIHDYIADRIIVFKGEPEKAGLATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVN
FT                   KIGSYLDRVQKERGDYYSMVLSTQ"
FT   gene            complement(246892..247233)
FT                   /locus_tag="SSO0288"
FT   CDS_pept        complement(246892..247233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0288"
FT                   /product="Integrase, probable (fragment)"
FT                   /note="Overlaps tRNA.ArgCCG . Similar to ORF D-335
FT                   [Sulfolobus virus 1,SSV1]. Multicopy, similar to SSO0138,
FT                   SSO0288,SSO6468,SSO0853; Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40627"
FT                   /db_xref="InterPro:IPR012922"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K4"
FT                   /protein_id="AAK40627.1"
FT                   /translation="MATIIQWVKIKEKQHHYKYGDIIIRERKGRYYVYKLEYENGNVKE
FT                   TYVDPLVDVVETYEKLKDSSGGFRGYPPNPTTDPPGFEPGTSGSGGRRSILAELRVQHK
FT                   YTLYGLLNC"
FT   gene            246930..247004
FT                   /locus_tag="SSOt16"
FT   tRNA            246930..247004
FT                   /locus_tag="SSOt16"
FT                   /product="tRNA-Arg"
FT   gene            complement(247569..248924)
FT                   /locus_tag="SSO0290"
FT   CDS_pept        complement(247569..248924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0290"
FT                   /product="Inorganic phosphate permease related protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40628"
FT                   /db_xref="GOA:Q980K3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K3"
FT                   /protein_id="AAK40628.1"
FT                   /translation="MGYNKPDFSSLEFKSVLTAGMGVFTDGYELYAISLVFYYIQKEFL
FT                   LNGLEEGIVIASAYYGAAVSAILLGFLSDKLGRKFIYGLDVALMSLGILFQSISTNFAE
FT                   LVMSRIILGFGIGADYVLSPIITAENSNPKNRGKRMIVTFALLWGMGAVTAAFVEQILL
FT                   LVNMENDLIWRIVLFMGILPAISVFYLRRKIPETYKFLTRIKPKPEELKKLEKEIKSKV
FT                   AISPDEVPFSKRFVSAIGITIISSILWLLYDMYSSTFAIYGPITIAGNLGLNPIEFTYL
FT                   AQFLAGLPGQIISIYLVDKIGRKPLIVIGYAGVAFWLFMYSILLMDPYYFGLKIHISNP
FT                   LKAAESLTGEAALLGLSFYLMNYLSSAIGPASIIGSAMLTPELVPTKVRGTSQAISVAV
FT                   DRLAAAFSITAFPLLLAKFGLPVLLGIYSIIALVSCSITLFLIPETKGVELS"
FT   gene            complement(248996..249085)
FT                   /locus_tag="SSOt17"
FT   tRNA            complement(248996..249085)
FT                   /locus_tag="SSOt17"
FT                   /product="tRNA-Arg"
FT                   /note="1 intron"
FT   gene            complement(249129..249473)
FT                   /gene="rpoM-1"
FT                   /locus_tag="SSO0291"
FT   CDS_pept        complement(249129..249473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoM-1"
FT                   /locus_tag="SSO0291"
FT                   /product="DNA-directed RNA polymerase, subunit M (rpoM-1)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Possible in-frame shift with SSO5576. Similar to
FT                   carboxy-end of RPOM_SULAC, but most other thermophilic
FT                   genes are the same size; Transcription, RNA polymerase and
FT                   transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40629"
FT                   /db_xref="GOA:Q980K2"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K2"
FT                   /protein_id="AAK40629.1"
FT                   /translation="MIVVKFCPKCNSMMVPKKSNGKNVYRCTKCGYEKEVPETTIVVTS
FT                   KVKHSIKEKTLVLEEEEMPSGAQKIKGVLCPSCKNDEAYFWILQTRRADEPPTRFYKCT
FT                   KCGKVWREYE"
FT   gene            complement(249483..249755)
FT                   /gene="rpoM-like"
FT                   /locus_tag="SSO5576"
FT   CDS_pept        complement(249483..249755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoM-like"
FT                   /locus_tag="SSO5576"
FT                   /product="DNA-directed RNA polymerase, putative subunit M
FT                   (rpoM-like)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Possible in-frame shift with SSO0291. Similar to
FT                   amino-end of RPOM_SULAC; Transcription, RNA polymerase and
FT                   transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40630"
FT                   /db_xref="GOA:Q980K1"
FT                   /db_xref="UniProtKB/TrEMBL:Q980K1"
FT                   /protein_id="AAK40630.1"
FT                   /translation="MKKETRIAVFVKVNYLYAICVFRGNFLEKMFLDINQDNLIKQITT
FT                   SSIVDEIKYSNIGIGENFKEQVLEKICENLIKKLSEKLNIDKVNG"
FT   gene            complement(249752..250030)
FT                   /gene="rpoL"
FT                   /locus_tag="SSO5577"
FT   CDS_pept        complement(249752..250030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoL"
FT                   /locus_tag="SSO5577"
FT                   /product="DNA-directed RNA polymerase, subunit L (rpoL)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40631"
FT                   /db_xref="GOA:Q980K0"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR022905"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="PDB:2PA8"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980K0"
FT                   /protein_id="AAK40631.1"
FT                   /translation="MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQ
FT                   PHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK"
FT   gene            complement(250020..250589)
FT                   /locus_tag="SSO0292"
FT   CDS_pept        complement(250020..250589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0292"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0445, PAB2314, MTH1318, PH0043,
FT                   AF0206"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40632"
FT                   /db_xref="GOA:Q980J9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980J9"
FT                   /protein_id="AAK40632.1"
FT                   /translation="MRTQGELTLPGEELAVIEEFMTGDGTYEQNGIVRAAVVGKIFYDM
FT                   LNRKSNVLGFKKIIFQHLKKAKYVIGIVNSIKEDSALVSIVGIEERGLASPISAYLHIS
FT                   QISNKKINNVTDAIKIGDVIKAKLLSYTFPLALTIKMKDLGVIYARCSRCGYLLIKQDE
FT                   NNLKCQRCGNIEQRKIGSYMVKKGGN"
FT   gene            complement(250595..251596)
FT                   /locus_tag="SSO0293"
FT   CDS_pept        complement(250595..251596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0293"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE0447, MTH131, PH1105, PAB0746,
FT                   Ta0255, AF1803, MJ0483"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40633"
FT                   /db_xref="GOA:Q980J8"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J8"
FT                   /protein_id="AAK40633.1"
FT                   /translation="MSYNFEEERVIKEIREKNAKRVLLQFPEGLKYFSIDIVKKLREKL
FT                   PNVNFIISGEPSWGACDIAEDEAQQVNADLIIHFGHTPYTWYYPKFPTIFINAESNLDI
FT                   SENALHSLENDISKYNGRKISLTATLQHVRLLSKIKSFLEDKGYDIVIGKPSNRFMFDG
FT                   QVLGCDYKAAEVEADIYVIVSGGLFHALGLGLATNKPTIKLDPYLQKSEDITNDVRKIL
FT                   KVRYGKILQALDKRSWVIIQGVKVGQNRPNMIKYFYDKLTEKGYDVFTVTNKVLTLDIL
FT                   RNLDRNYIDVFLVTSCPRLPIDDLYNYEKPVLTPGEAKMIINNSLEPYIFPW"
FT   gene            complement(251593..252129)
FT                   /gene="rpl10E"
FT                   /locus_tag="SSO0294"
FT   CDS_pept        complement(251593..252129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10E"
FT                   /locus_tag="SSO0294"
FT                   /product="LSU ribosomal protein L10E (rpl10E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40634"
FT                   /db_xref="GOA:Q980J7"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980J7"
FT                   /protein_id="AAK40634.1"
FT                   /translation="MPLRPGRCYRHFSGPAYTRKEYIPGIPQPKITKFTSGNPNGDYDY
FT                   EVRLITTEIGQIRHNALEAVRTLTLKTLSKKTGSETSFFMWILKYPHHVLRENKMMAFA
FT                   GADRLQDGMRLSFGTPIGTAARIEKLGETLIVIKVKKEHLEFAKEALKIASKKLPLRTR
FT                   IEIIPLRLVRQEVQS"
FT   gene            complement(252385..253464)
FT                   /locus_tag="SSO0295"
FT   CDS_pept        complement(252385..253464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0295"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40635"
FT                   /db_xref="GOA:Q980J6"
FT                   /db_xref="InterPro:IPR017013"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J6"
FT                   /protein_id="AAK40635.1"
FT                   /translation="MVKRNSKEIVMEVFLGEPNNQEIREVVRNVYSKDNLCLSAYYSIE
FT                   PILFSFIISKNTKNSFTLSFIPEECETQIRLDANGKWIIDNKKKYFLGQNSFCSYLPIT
FT                   AEDVLPIVSCIITSTILDRRSLSEWELETIREMEKFDMTIEKNLKIPAYKTLPAFLSLM
FT                   FSLDPYIPGISGNRENAISLIREVNASEISKLEDLNESQLNTLLFRIISTIVKENPKFT
FT                   RDDIITDRFFYLDYDILELAFSLIYSFDTIGSNEILQFVLSSSYAEALISRFRQTLSKG
FT                   FSINSIENKQSYYIVETSNLTSPLLAQIILLQLQKIRRDKMIVIRDNDRLFTSRFFIPS
FT                   VKKEGLIKIDDRVKNLIGI"
FT   gene            complement(253437..254333)
FT                   /locus_tag="SSO0296"
FT   CDS_pept        complement(253437..254333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0296"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40636"
FT                   /db_xref="GOA:Q980J5"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J5"
FT                   /protein_id="AAK40636.1"
FT                   /translation="MDKKYIAAIFLPFIVIIVYAYIFKINIIYVLQEDPKFFLIFLLTY
FT                   TAQNFVSSFKDSLLIKRRVDITLRARLLGNFVGLLVPGWAGQELVRSLVYNKYGVNLRQ
FT                   AFSYSILIGSIDVLAICLGYILLLPFFFNPLEFVFILVVLFNIAGWIGALSYFYLQHDK
FT                   VNKIEQFIFKIVKMERIVTDYMEFKYYLKQGTTKDFVIYIMIDIFSFALYGGYFYYVTH
FT                   NIFLSIFISFLYQVSILIPIPSAAIVGELALSIFLNPSYVFATRLNYIISNLLGSIFFK
FT                   DMSFEELKKWSKEILKR"
FT   gene            complement(254333..255334)
FT                   /gene="thiF"
FT                   /locus_tag="SSO0298"
FT   CDS_pept        complement(254333..255334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="SSO0298"
FT                   /product="Thiamine biosynthesis protein related protein
FT                   (thiF)"
FT                   /note="Cofactor Biosynthesis, Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40637"
FT                   /db_xref="GOA:Q980J4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J4"
FT                   /protein_id="AAK40637.1"
FT                   /translation="MSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVER
FT                   YSRQLIVLGLGIQQRLNELKILIAGCGALGTAVAELLARLGVKELTIVDADVVDITNLH
FT                   RVHLFDENDVGKPKAEVCAKKISLINSSIKINYIIDILDEENVERLISDKDYVFDALDS
FT                   LYYKLLLNDAIVKLGKILIYGGINGEYGSAKLIDPSQTSCLSCFIDYSDQDEIGNSCDV
FT                   IGTTPLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNSQCKTCVLNE
FT                   YPFLYQKISKPKCGIFRTNMKIPELDEPKVFKNLGNVTLCYPSIGCFEKRGR"
FT   gene            255258..256103
FT                   /gene="tkt-1"
FT                   /locus_tag="SSO0297"
FT   CDS_pept        255258..256103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt-1"
FT                   /locus_tag="SSO0297"
FT                   /product="Transketolase, N-terminal section (tkt-1)"
FT                   /EC_number="2.2.1.1"
FT                   /note="Energy Metabolism, Sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40638"
FT                   /db_xref="GOA:Q980J3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J3"
FT                   /protein_id="AAK40638.1"
FT                   /translation="MGIDIVPMEKGGGSDGTPISIEELDKLRQVAEKARRNVIKMLFYD
FT                   QTIHVGSSLSSIEILTTLIFKHIRTDSSLVNKDWLILSKGHAAPALYAVLAEKGYIKEE
FT                   ELWRIQDITGLLQGHPETFIPGVDMSTGSLGQGLSFGIGVATGIKMANGTGRVYVIMGD
FT                   GEQDEGEIWEAMTHAVVRNLDNLIAFIEMNNFQLDGSTDEIKPKNFLPKVWEAVGWKVL
FT                   NCDGHDFISITNAVNEAYKASKPVVIFAKTVRGKGFPPIENTHKQRSSPDDARKYLLNA
FT                   "
FT   gene            256072..257013
FT                   /gene="tkt-2"
FT                   /locus_tag="SSO0299"
FT   CDS_pept        256072..257013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt-2"
FT                   /locus_tag="SSO0299"
FT                   /product="Transketolase, C-terminal section (tkt-2)"
FT                   /EC_number="2.2.1.1"
FT                   /note="Energy Metabolism, Sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40639"
FT                   /db_xref="GOA:Q980J2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J2"
FT                   /protein_id="AAK40639.1"
FT                   /translation="MMQGNIYSMRETFGRLLADLGDKNKDLVVITADVGDSTRALYFRE
FT                   KFKDRYFNVGIAEQDMVNFAAGLAAVGKKPAIVNFGMFLMRAWEQIRNSIARMNLDVKM
FT                   FVTHTGYSDHGDGSSHQVLEDIALMRVLPNMKVVVPADPKDIERSLPVIINEERGPLYY
FT                   RIGREYSPPITIGQEYEFKIGKAYVIKDGSDLAIIGAGVVLWDALKAAEELEKLGISVA
FT                   VINLFSIKPIDENTIEYYARKAGKIITIEEHSIYGGIGSAVAEVTARRYPVPIRFVGAT
FT                   TFGRSARSQRDLLDYYNINYKTIIREAIDLLK"
FT   gene            257014..258054
FT                   /gene="tyrA"
FT                   /locus_tag="SSO0302"
FT   CDS_pept        257014..258054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="SSO0302"
FT                   /product="Chorismate mutase/prephenate dehydratase,
FT                   putative (tyrA)"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40640"
FT                   /db_xref="GOA:Q980J1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR010950"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J1"
FT                   /protein_id="AAK40640.1"
FT                   /translation="MTEEITRLREEIDKVDEQLVKLLSYRLELSRKIGKAKSNSNISVT
FT                   DENREMKVREKWIANAKKYNIPNSLVESILPLIFSYSKLVQINPGEKERVVIYGYGGMA
FT                   KSIVSILSLAGHEVSITGRDLSKAEMLANQFKCVSMSLLKAIDWGDIIIFAIPPSAILN
FT                   NSDELFSKALKDKIVMDISSSKFKIFGFLEELSRKLEFRYISTHPLFGPIEYPIGERVV
FT                   IIPSKTSSNDDVMKVENFWRKSGLVPVITDVETHEKAMAIVQVLTHYYLLGLSNAIDTL
FT                   SLELGVDYSNFHTTNFRELNKILKRVKDLKNVITEIQNQNPYSYKVRNIGLEELKKIKE
FT                   ELEGGK"
FT   gene            258056..259051
FT                   /gene="aroG"
FT                   /locus_tag="SSO0304"
FT   CDS_pept        258056..259051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="SSO0304"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase
FT                   /chorismate mutase (aroG)"
FT                   /EC_number="2.5.1.54"
FT                   /EC_number="5.4.99.5"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40641"
FT                   /db_xref="GOA:Q980J0"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q980J0"
FT                   /protein_id="AAK40641.1"
FT                   /translation="MILYVLKDRADYSILIEKLNENSASFKILNLYGKNLILAWPDQNV
FT                   KGIIDNSIEMAVEVKKSYVLAGNDWKKQPTVVNVKDVEIGSKKVIVAAGPCAVENEEQV
FT                   LTTAKAVKRAGASLLRGGAYKPRTSPYSFQGLGEEGVKILRRVGDEVGLPIVTEIMDTR
FT                   DSNIFSQYVDMIQIGARNAQNFSLLKEVGKLGKPVLLKRGMGNTVEEWLQAAEYILLEG
FT                   NGNTVLCERGIRTFEKSTRFTLDIGGMVAAKLMTHLPICADPSHPAGKRELVHSLALAA
FT                   VAAGADMLLIEVHPHPEKALSDSEQQLTPESFEVLMNRIRTLARALGRDA"
FT   gene            259048..260112
FT                   /gene="aroB"
FT                   /locus_tag="SSO0305"
FT   CDS_pept        259048..260112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="SSO0305"
FT                   /product="3-dehydroquinate synthase (aroB)"
FT                   /EC_number="4.2.3.4"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40642"
FT                   /db_xref="GOA:Q980I9"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980I9"
FT                   /protein_id="AAK40642.1"
FT                   /translation="MREILEDICCSEVRVVVGEGSLSKLSKIKDNNAAVIYSRKISIAD
FT                   KINKYLPNAYFIPINDGESTKELSSVISLVEKLFEKNFDRGDYIIGVGGGTVTDVAGFL
FT                   ASIYLRGLNLINVPTTFLGMVDAAIGGKNGVNFNNIKNLIGTFYQPSMIISDLEFLETL
FT                   PIEELKKGLAEVIKYGLTLDKELYDYLSLNKEKILNKDKQALEDIIFRSTLDKLSIVKE
FT                   DERETKGIRIVLNFGHTIGHAIEAGSSFNVPHGYAISVGMVCEAKMAEELGYAEEGVVE
FT                   DVLWLLQIYGLPYDISQIDAPVDLKLALNAINMDKKHRKDVILIPFPTRIGSWKKVEVP
FT                   LDTVKGFAEQCLKK"
FT   gene            260097..260906
FT                   /gene="aroE"
FT                   /locus_tag="SSO0306"
FT   CDS_pept        260097..260906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="SSO0306"
FT                   /product="Shikimate 5-dehydrogenase (aroE)"
FT                   /EC_number="1.1.1.25"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40643"
FT                   /db_xref="GOA:Q980I8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980I8"
FT                   /protein_id="AAK40643.1"
FT                   /translation="MLEEINYDTKLFGLIGKNIKYTLSPYIHNFSFRTLGINAVYLVFD
FT                   LDEMKFKRSISGILEIAEGLNVTIPYKDEVMKYLDNTDTHSTRIQAVNTIYKKSGYNTD
FT                   YLAIKNLVRKKIKNVSGYECYIYGAGGAAKAAAFALSELGCSSISIVNRTKSRAYELAE
FT                   LLNKNGYNASIKENCNITNNILIVNSTPNSSVVPEDCVKKSDLVIEFVYRPVETELIKN
FT                   AKKYGIQYINGLEILVNQAVEAEKIWFNKSVADEKIIEYLYARELVW"
FT   gene            260884..262059
FT                   /gene="aroC"
FT                   /locus_tag="SSO0307"
FT   CDS_pept        260884..262059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="SSO0307"
FT                   /product="Chorismate synthase (aroC)"
FT                   /EC_number="4.2.3.5"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40644"
FT                   /db_xref="GOA:Q980I7"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980I7"
FT                   /protein_id="AAK40644.1"
FT                   /translation="MPGNSFGKLFRITTFGESHGPAVGVVIDGVPAGLPLTVEDIKFEL
FT                   EFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYDEIKYKPRPG
FT                   HADLPFIMKYGYENWDYRGGGRASARETVSRVIAGAVAKKLLMLTDTWIAGHLRSLGPE
FT                   ELSEEVTFEEVLCSKYSPVRASKKDLEEKYEALIKKATQEGDSYGGIAEVIAKNPPIGL
FT                   GEPVFDKMKAELAKAIMSIPAVMGFEYGLGFIASKMKGSEANDEIIRKNNRIGWKYNYA
FT                   GGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEESYISVIGRHDPAVAIRGVTV
FT                   VESMVALTIVDHAMRAGAIPLVKLTEDQANTIQQRWERYVKSCKPMEESQS"
FT   gene            262008..262835
FT                   /locus_tag="SSO0308"
FT   CDS_pept        262008..262835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0308"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with AF0250, MJ1440, PAB0301, MTH805.
FT                   Distantly related to homoserine/aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40645"
FT                   /db_xref="GOA:Q980I6"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q980I6"
FT                   /protein_id="AAK40645.1"
FT                   /translation="MGEVCEIMQAYGGVSIVNALPSWYGSSMAINLKVKVEIREGKRVY
FT                   SQESELIKTILNYFKEKYSIPDIEVDIESELPQKSGLKSSSAVSVALIAEIAKQYDLRN
FT                   INPPILSAILSLKAGVSYTGALDDAVASYCGGIAFTYNKMFRIVKLENLEDNLSILILA
FT                   KGGRQKPVNLNELRKYSHVFEEIFKIALKDYLTAMKMNGILIANILGYSLEPIEIALKK
FT                   GALAAGISGNGPSYFAVSKNGEEGPIYESLKKFGDVIIVRPVSLDCKDLSIKD"
FT   gene            262804..264048
FT                   /gene="aroA"
FT                   /locus_tag="SSO0309"
FT   CDS_pept        262804..264048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="SSO0309"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase
FT                   (5-enolpyruvylshikimate-3-phosphate synthase)(EPSP
FT                   synthase) (aroA)"
FT                   /EC_number="2.5.1.19"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40646"
FT                   /db_xref="GOA:Q980I5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980I5"
FT                   /protein_id="AAK40646.1"
FT                   /translation="MIVKIYPSKISGIIKAPQSKSLAIRLIFLSLFTRVYLHNLVLSED
FT                   VIDAIKSVRALGVKVKNNSEFIPPEKLEIKERFIKLKGSATTLRMLIPILAAIGGEVTI
FT                   DADESLRRRPLNRIVQALSNYGISFSSYSLPLTITGKLSSNEIKISGDESSQYISGLIY
FT                   ALHILNGGSIEILPPISSKSYILLTIDLFKRFGSDVKFYGSKIHVNPNNLVEFQGEVAG
FT                   DYGLASFYALSALVSGGGITITNLWEPKEYFGDHSIVKIFSEMGASSEYKDGRWFVKAK
FT                   DKYSPIKIDIDDAPDLAMTIAGLSAIAEGTSEIIGIERLRIKESDRIESIRKILGLYGV
FT                   GSEVKYNSILIFGINKGMLNSPVTDCLNDHRVAMMSSALALVNGGVITSAECVGKSNPN
FT                   YWQDLLSLNAKISIE"
FT   gene            264045..264707
FT                   /gene="aroD"
FT                   /locus_tag="SSO0311"
FT   CDS_pept        264045..264707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="SSO0311"
FT                   /product="3-dehydroquinate dehydratase, putative (aroD)"
FT                   /EC_number="4.2.1.10"
FT                   /note="By similarity with other thermophiles; Amino Acid
FT                   Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40647"
FT                   /db_xref="GOA:Q980I4"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980I4"
FT                   /protein_id="AAK40647.1"
FT                   /translation="MRPLIVASLPIKKIEDLKLIENFLDADLIELRLDYLREREVSLIS
FT                   DYYEFLDKYKKKLIVTLRDKGEGGINQLADELKIKILNELYERQYLYDIEVSFLQKYDI
FT                   PYDNRIVSVHYFNYLPTLEKIKEIVSKFSEKAFSVKIAVPSLKGYKEVLLPLLEYENVT
FT                   VIPMSNNSLERIAVGLLGSKLVYSYAIEPLAQGQLYYKKVIQIFNYINDITTSSLVT"
FT   gene            complement(264668..264982)
FT                   /locus_tag="SSO0312"
FT   CDS_pept        complement(264668..264982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0312"
FT                   /product="Benzene 1,2-dioxygenase system ferredoxin
FT                   component, putative"
FT                   /note="Cellular Processes, Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40648"
FT                   /db_xref="GOA:Q980I3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q980I3"
FT                   /protein_id="AAK40648.1"
FT                   /translation="MEYIRISRTDFKTGEKRKIILPNGRELVVFYLGVDRFFVFDNKCP
FT                   HLGCDLSKYGVIIKEELVCQCHFSHFSIYSGEPKKGASKKPIKVYRVQVTKDEVVISLI
FT                   "
FT   gene            265543..267195
FT                   /locus_tag="SSO0313"
FT   CDS_pept        265543..267195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0313"
FT                   /product="DNA helicase"
FT                   /note="Similar to CHL1 (S.cerevisiae). Belongs to the
FT                   RAD3/XPD subfamily of helicases; Helicases, Helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40649"
FT                   /db_xref="GOA:Q980I2"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980I2"
FT                   /protein_id="AAK40649.1"
FT                   /translation="MELREWQSKIAEKIVEALRNNFLVSLQAPTGSGKTLFALYTALKV
FT                   KPKVAFVVRTHNEFFPVYRELSLHFKDKKYGFLVGKSSACVFSSSDVDAQDIYCNGCEI
FT                   FNASAVTVTDSPKVSLNKLKEEGKKLGFCPYYSLLETIKTADVILLTYPYLFIPWLRES
FT                   LDINWEDYVVIVDEAHNIENVSNIEEKKLNKRIIEMAISQSHSQNVKVILERLKENVEK
FT                   AVYSEDKYILIEKDKLDNILPSNEEIEILSEEYDEIRKIMIKNKTVSRNYLGSILRFFD
FT                   LVNDEGIRVFSYSGSLIAKYIIPSYFTDILNDEKITYMLMSGTMQPLDYLRNIIGIKRK
FT                   ILYIDAEKVMKKRLTGTYECLISIDVTTTYSLRSEQMARKYASYLLKIFYNSRRHVLAI
FT                   FPSYEFMRIVSKFLNIRYLAEDTETSIEEIMSNLKKEKTIIMGIARGKLAEGIEIVENG
FT                   SSLISDVAMVGIPYPPIDDYLKIRVEEISKILKKDISNELISIQALIAVKQSIGRAIRG
FT                   PTDNATIWLLDKRYDSLWWKKELNCLNARKIKL"
FT   gene            267173..267997
FT                   /locus_tag="SSO0314"
FT   CDS_pept        267173..267997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0314"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE1701"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40650"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q980I1"
FT                   /protein_id="AAK40650.1"
FT                   /translation="MQGKLNCEIEMEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDT
FT                   ELYPFLAFEKGVISTPSIFIDGKLVYAGIVDFEEFERILSGQKVTKQIDKASLVEKLML
FT                   GIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEREGDEYYNYLRNVMVKEGDR
FT                   YLEEWKPRMLRNISSNFIREIFWLYERKISKETLTQKYPVEVFAHWLMIRSGAVGRVGL
FT                   RIYPLSDSTVMKRVLEAYNFMLENYDEIFNKVQKEQMELKTKNKEQVRYLQL"
FT   gene            complement(268425..270347)
FT                   /locus_tag="SSO0315"
FT   CDS_pept        complement(268425..270347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0315"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40651"
FT                   /db_xref="GOA:Q980I0"
FT                   /db_xref="UniProtKB/TrEMBL:Q980I0"
FT                   /protein_id="AAK40651.1"
FT                   /translation="MRDNIILSMFIKNMEANSDIVYEYINRVIVAVINAILSYKIFFSF
FT                   LPIDYVYFVIAIISVISFFFYKPLSIIFLAIYIIESAVVFKTLYNITLLPLIQGYSIEY
FT                   LIELLVALIFIFIIPLFSILKYSSIGGVITSSSILLSIYNPFFLLFLPFGIAEKNSRIT
FT                   VNILSVLPLLILIVPSILSYNTTSYILHNYSLWVSIILALAAGILFGISQLYSLIGSIP
FT                   LSIFLYLNGQALEIITLTGLLTIILNIIPSIVSLIKANFYIKKELVDTRKRIIENLDEL
FT                   KGVLEKIKLVIKDTNDIELTPLIQKYNKFFADISSNLENISDMKTLQNLELELNAKRLE
FT                   LERSINDYLFDQISRYNEIVDEIKNYGIVLDKIEPLSEAIKINDEGVIKIRKLLSRVNV
FT                   NVQILYKYIESIYNSLELLLGKKYNNEITDIRFNIEMSIKYFNRLLNKENLETCKTCTE
FT                   LMLKFLQLSNSLNLNANQELLKNIIKLSDEKPAIFVVKSKEFLEQGLKTASIVLAKVKE
FT                   EYEYIKNEIPSLSRYKEFDLINLLEKEINDSTKPICKRIETLSSSFQVIQDLSSIIAHK
FT                   SEIADVINLINDNYDLILQKVIEEGCIKLSELGIALDYGKFIDLVLQEKGTNLRVVNDS
FT                   ICYMR"
FT   gene            270412..271047
FT                   /gene="sod"
FT                   /locus_tag="SSO0316"
FT   CDS_pept        270412..271047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sod"
FT                   /locus_tag="SSO0316"
FT                   /product="Superoxide dismutase [Fe] (sod)"
FT                   /EC_number="1.15.1.1"
FT                   /note="Cellular Processes, Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40652"
FT                   /db_xref="GOA:P80857"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:1WB7"
FT                   /db_xref="PDB:1WB8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80857"
FT                   /protein_id="AAK40652.1"
FT                   /translation="MTLQIQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNG
FT                   ANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGG
FT                   ALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAE
FT                   IPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYLTK"
FT   gene            271082..272167
FT                   /locus_tag="SSO0317"
FT   CDS_pept        271082..272167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0317"
FT                   /product="Sugar phosphate nucleotydyl transferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Cell Envelope, Surface polysaccharides and
FT                   lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40653"
FT                   /db_xref="GOA:Q980H9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H9"
FT                   /protein_id="AAK40653.1"
FT                   /translation="MVSAIVLAGGYATRLRPLSLTKPKALFPILNKPILGYILESLINS
FT                   DVSDIYLSLRVMADKIIDYLKDTSMLDKVKIEVESEPLGDAGPLKLISQKYNLDDDVLV
FT                   IYGDIYSEINIKSLLDFYYKKSCDAVVVGTEVEDPRRYGVLYTENDVLVELIEKPKKPI
FT                   SNLINGGVYIFKKDLFKLVETPSSISKDFLPKLLRTKSISVYKYHGIWADIGVPDDYLR
FT                   LNFEVLVQKYPKGYINSSAKVSEKSTLIPPYYIGSKNVIGEDAYITSNTILGNDVEIGK
FT                   GTYISESILMNKVQVKEYTYISGSIIADKTKIGRWNHILDGSILGEEVITSDGVLINRR
FT                   TIILPNKEVKEHVYDKGKIIL"
FT   gene            272169..272882
FT                   /locus_tag="SSO0318"
FT   CDS_pept        272169..272882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0318"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40654"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H8"
FT                   /protein_id="AAK40654.1"
FT                   /translation="MTIMILREIIDELSYQLKQRRIINVCVSPAYTSVMLDDQSIGISH
FT                   TITDGEIEGAGEIIGKNAYDVVINNLDSNLQRSLSLAILNALGSMIDFTQGDPINLYSG
FT                   GKLCVFGFSPQLSYSNFDSVIVYDFMSTENKKVGNTEIKPYSSLSREVCSTALIFASSI
FT                   VNNTIDRIISQISANHLILTGISSVDAPITLKNHGFEVLGKLFPVEKYRVFRTICEGGS
FT                   NKLLSKYIMRYFKKL"
FT   gene            complement(272869..274047)
FT                   /locus_tag="SSO0320"
FT   CDS_pept        complement(272869..274047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0320"
FT                   /product="Hypothetical protein"
FT                   /note="Weak similarity with Mitochondrial Ribosomal Protein
FT                   Var1"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40655"
FT                   /db_xref="GOA:Q980H7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H7"
FT                   /protein_id="AAK40655.1"
FT                   /translation="MILNSRTIDDAKFFDKPILLFFTDENCKDCDTIYSKLQDSTIFSK
FT                   YIGKKVNALEYIHYTIRLTRGMIPTITILSPTLDLLAVIESKDLKFIENKLRELLDEYK
FT                   RRIVKGIKLEGYTPDPIEPTPSIIYETINKVIGGYEADTRMIEVYLTYTNVYKEYLKAK
FT                   DKIKCSDDVARYLLEGKGEIKIDEKSSANVSMLVNYGVTSVQKLLDFIDINSGEVYRSK
FT                   KKETKGILLDEALAGNALVSEYERTINEEYLSLAIKVADYIKNNLQHERGFRDIKEIDN
FT                   ITKVPYLEPISNSEASIFFSRLWNITGDETYKNLALKGLGSALGGALNNPKVIARAAIA
FT                   YLKLFDSIKANRYLNIIDARITVVKNNGCNDSMLYYSGQCYSKIDEIQPTAF"
FT   gene            274562..275344
FT                   /locus_tag="SSO0321"
FT   CDS_pept        274562..275344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0321"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE2064, PH0762, PAB0861"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40656"
FT                   /db_xref="GOA:Q980H6"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980H6"
FT                   /protein_id="AAK40656.1"
FT                   /translation="MISVKLVSYTNDGEKVIAIAAKMSRSRKGWDYHEKDMTDDEIETW
FT                   IRDAILHGYWSVLEHSVYTFSIEEISRVASHQLVRHRIASYTQMSHRFAKPIDEYYKPI
FT                   IPPSAKKRSKELVEKAYKEAYDNYYTLLESGVPEEDARYVLPNGVNTNIVVTMNARELY
FT                   NFFSLRLCSRAQWEIRAIAWKMLEEVKKVHPRLFKYTGPNCIIHENFIRNENESITLED
FT                   IFKDYKLEFISQRCIEGVLRDGIKKCIINSRSVLDNIK"
FT   gene            275424..275813
FT                   /gene="NuoA"
FT                   /locus_tag="SSO0322"
FT   CDS_pept        275424..275813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoA"
FT                   /locus_tag="SSO0322"
FT                   /product="NADH dehydrogenase subunit A (NuoA)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40657"
FT                   /db_xref="GOA:Q980H5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H5"
FT                   /protein_id="AAK40657.1"
FT                   /translation="MSFTQAILGFGIPIVVFLAAGYGLYKFLLLILPSKPNPLKVSRFE
FT                   AGNIPTGSGRLWFPLQYYGYLLLYVTLEPIIVLLLPIAFSNYYSVPVAFRDLLLIIVVF
FT                   IVLMYPVLYYAIRQINLLYQWEMRR"
FT   gene            275795..276304
FT                   /gene="NuoC"
FT                   /locus_tag="SSO0323"
FT   CDS_pept        275795..276304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoC"
FT                   /locus_tag="SSO0323"
FT                   /product="NADH dehydrogenase subunit C (NuoC)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40658"
FT                   /db_xref="GOA:Q980H4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H4"
FT                   /protein_id="AAK40658.1"
FT                   /translation="MGDEKMSEALKSLVNDLQTKFKCQAKIESDRRITVIVPDKKIIRD
FT                   VASFLKDFGFDHVKAVTGIDYPEHEKLEVVYHISSYSNLDLAKIILALRTTVSYKDPSL
FT                   PSLYSIFESAWTGERETYEMLGIRFEGHPDLRRFFLDEDFEGVYPLRKSYKIKLEGVFV
FT                   DKPTTE"
FT   gene            276282..277514
FT                   /gene="NuoD"
FT                   /locus_tag="SSO0324"
FT   CDS_pept        276282..277514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoD"
FT                   /locus_tag="SSO0324"
FT                   /product="NADH dehydrogenase subunit D (NuoD)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40659"
FT                   /db_xref="GOA:Q980H3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H3"
FT                   /protein_id="AAK40659.1"
FT                   /translation="MTSQPQNEIQEQLLAATGMSVEFIPVQGELNVGPQHPGSGHMRIF
FT                   VKLNGDIIEDVDLDVGYVHRAVEKLSENRNYMHLIPLVERPAILDSIHMNLGYIIAVEK
FT                   ILGVDVPERAQYLRSFAAEVNRIASHLYGLGILAIFLGHSTGFMWGFGDREVWVTILEA
FT                   LTGARVTNSYVIPGGVRKDITQEIKEMTIKAIAYQRKRLEDWKKIFFYNPSIRARLENV
FT                   GVMSRENAIKWGAVGPNLRASGVYYDVRKIEPYGAYDKLDFEIPVYKEGDGLARGLVRL
FT                   EEIEQSMRILEQIIKNIPEGNILSDRFFKQIPPIRLKKYWETYRRIVLPGYYASFRPPK
FT                   GEAISRVEAGRGELAYYVVSDGSPKPYRLRMITPSYRLIYVFKELCKGSRYADLVSIYG
FT                   SLDYFPPEADR"
FT   gene            277514..278572
FT                   /gene="NuoH"
FT                   /locus_tag="SSO0325"
FT   CDS_pept        277514..278572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoH"
FT                   /locus_tag="SSO0325"
FT                   /product="NADH dehydrogenase subunit H (NuoH)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40660"
FT                   /db_xref="GOA:Q980H2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H2"
FT                   /protein_id="AAK40660.1"
FT                   /translation="MSVLSALQYYFFYPSFFLTVIFPGLIFTLIFLLVTIWFERKAAAI
FT                   VQLRYGPYYASKRLGGILQLFADAIKFVFSEIIIPNGVNQTLYAISPVLVLIFAFLPMA
FT                   LIPISTIPTQGSILSVYHGIFYDTQIHQGILVPYFIEYNLIGIIALESLYPILVIFLAW
FT                   NTNNRFAIVGSIREAYLSVSYDVLIIISTLALGLEYHTLDVAKIVTSGIPGFIANPIAA
FT                   FVFLVAMLIGSSRFPFEIVEAETELVIGPYTEYSGFLFVLTMAGSYVANLVYAILFVDL
FT                   FLGGWLPFTGFVGAIFTVFKAAIVVFFAVFLRAVYGRYRIDQALRGSWKYFFPLALASL
FT                   LLGVVVGYLWIR"
FT   gene            278497..279063
FT                   /gene="NuoI"
FT                   /locus_tag="SSO0326"
FT   CDS_pept        278497..279063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoI"
FT                   /locus_tag="SSO0326"
FT                   /product="NADH dehydrogenase subunit I (NuoI)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40661"
FT                   /db_xref="GOA:Q980H1"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H1"
FT                   /protein_id="AAK40661.1"
FT                   /translation="MEIFLSLSFSFLIIRCGGGLFMDKVKEYKKENIASLFAEHIQSIV
FT                   TGIKYFVKPQRITLQYPEDSLTLPTGYRGMIRLYKDVCIGCTLCALICPADAMKMVTES
FT                   GKKFPQINYGRCVFCGFCVDVCPVDALKETKVHDLVFNNRKQLIFDPDRFNVDIDDVPM
FT                   QDKPVRKVKAIIDEKRGIKYVPADE"
FT   gene            279044..279547
FT                   /gene="NuoJ"
FT                   /locus_tag="SSO0327"
FT   CDS_pept        279044..279547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoJ"
FT                   /locus_tag="SSO0327"
FT                   /product="NADH dehydrogenase subunit J (NuoJ)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40662"
FT                   /db_xref="GOA:Q980H0"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q980H0"
FT                   /protein_id="AAK40662.1"
FT                   /translation="MYPQTSEIIQYILFGFFGVMTIAFSIYIVRAKNVFYGAVSLAFLG
FT                   LSIAALIALEAPSTYGIYSVFHILLYVGATVTFLAISLVMFKDLEVKFGRGALGILAGG
FT                   AVTLLFLIIVFISIPQVSSAEVQPINFQVLANDLIENYWFPLIILVIALLTTLIEAISL
FT                   ARRD"
FT   gene            279779..283225
FT                   /gene="NuoL"
FT                   /locus_tag="SSO0328"
FT   CDS_pept        279779..283225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoL"
FT                   /locus_tag="SSO0328"
FT                   /product="NADH dehydrogenase subunit L (NuoL)"
FT                   /note="Genes seems duplicated compared to other homologues;
FT                   Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40663"
FT                   /db_xref="GOA:Q980G9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G9"
FT                   /protein_id="AAK40663.1"
FT                   /translation="MHLRLLYFTIGKRINWRWNKMFPLSFIMLIISFILAVSIFFVRSR
FT                   VASFILSFVSIAINIPFLVFRGIFENIFVSKYVGDFGIVVNNFNYPFIITIIIITLLSA
FT                   IYSLRYMEHKFDEERKSSWGLYYALYTLFALSMLYTVLSTNLLELYIFLEISLISSFLL
FT                   IALYGYGDRRRISLMYFIWTHIGTILLLASIIVIGLSTGSMNIYVDAYTFANYSTISYG
FT                   ILVFIIAVVGMFVKGAQAGFNIWLPYAHGEAPTPISVLLSPNMVGLGIFVVIIYYYLFP
FT                   TMSFLAPIFIAWAIITMIYGGINALAQKDFKRFLAYSSVSQMGYMLLGASIAFLSGLSN
FT                   SIISLPIGILASILIYVSHGFGKAILFMSAGASITELNERNIEKLGGLYLSSPLHSTLA
FT                   FIGALNLLGLPPTIGLISEALLIFSLGTILDKIGIVGFIVIVAFIMIAIGTSSAYIGYL
FT                   FKTVYAGKKETKNIDNVKEYSIPMLLIGIFSIITFFIPQYVSPSLVFTSLFSNSTILPF
FT                   IAFLPVLGSLIALITPKSLNQDLRGAIVVVSIGISMVLSAVLLVNNLGKPLFGHPQLSY
FT                   SFGYLQFSANLLQSILALFVSSLSFFIALYSIGYMREDNVLRRYWGFFGLFVTSMLSVV
FT                   LANNVLLFIAGWEGTSLASYGLISYWLDDNERNVVGDFGRRIFGIENVSKPTTSGIRAL
FT                   IFTRVGDVGLLAVLGYLLSLSSYNYILYPISNVSSTVFSALYAVASHPEGWLILLIFFL
FT                   GGLAKSAQFPFTQWLLTAMTGPTPVSALIHAATMVNLGAILTFLTYQFIPINSNTYLFF
FT                   AIMVGITLFTALYTSINALASNEQKVILAYSTADQISLMIFSSSLGALLGNVSLGIIIG
FT                   LIQMFAHGLYKASLFMNAGSVIHYTESRYVASKPLLYKEIPSVFILQLIAALNLANLPP
FT                   LIGFWAHNIIGNLASSTSTTIFYLYIILEFLGSIYILRYIARTFLWKGETDKTHEHGHL
FT                   SILMVISPAFLILGSIILGVLYFNLATFFNIIQFSEIDFLSLTLSIIGWIIAFAIYTRY
FT                   LNLSSVKPLIDFVYYGWYVNPAFDKFGYLFKDFAGALFKNFERGVIDLGLNERLPKSIV
FT                   NFGSRIYNVVEDHILGDYIMLYAWGIVLLLIIVLILFGVIG"
FT   gene            283168..284619
FT                   /gene="NuoN"
FT                   /locus_tag="SSO0329"
FT   CDS_pept        283168..284619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoN"
FT                   /locus_tag="SSO0329"
FT                   /product="NADH dehydrogenase subunit N (NuoN)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40664"
FT                   /db_xref="GOA:Q980G8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G8"
FT                   /protein_id="AAK40664.1"
FT                   /translation="MGYSFTFNYSFDSIRGDWIMDPMYYLPILIPSIFILFSSISVLFI
FT                   DNGLDENRFRLSVILSVVLLGVSLAFLIYSWTASVINYTLFSKSLLIDVPGYFFSITVF
FT                   SIGILAILLSKDHIISWPTRSSMLSLMLLSLLGLFYMSFANNIIIVLTTWAISSAASYA
FT                   IAMLRKDYKSVDAGIKYLIMGLLSSSIMIIGFASYLISTGSLLFTTSVIYPNLFFFSIS
FT                   FISIAFLFKIGAFPFQAWLPDVYTDADRISVAFISSVGKLIGIIPLFRVVYLSDPNMVE
FT                   LVIFIVISVASMLVGNITAFSRRDVAAILSFSSITQMGYILIGFAMFTVSPAIAVVGIL
FT                   VQSLAYGIAQVGLFGIVSHVEKVSGTSDISGLRGISSQDKPLAFAIVVLILSLLGIPPI
FT                   FGFWGKLFLFESSFTYPWLTIIAVLNSAISAGYYVPIVREVFREGEFEVIKSSERNIAV
FT                   VSAILSIILGIVIPIVFQILVSQID"
FT   gene            284612..285646
FT                   /locus_tag="SSO0330"
FT   CDS_pept        284612..285646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0330"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40665"
FT                   /db_xref="GOA:Q980G7"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G7"
FT                   /protein_id="AAK40665.1"
FT                   /translation="MIRIALIGVGNVASALVQSIELIRNGKEIYGILDLPIRPNDIEIV
FT                   AAFDIDKRKVNKRLREAIFTKPNVVDKYVDVKNDIIVMRGPTLDGRVGILSNIIEESEE
FT                   EPVDIVDVLKKEKVDVVVNLLPTGATSASNFYAKASLEAGSAFINTTPSPTAKEFKDQF
FT                   MEKRLPILGDDLLSQIGGTITHAGIIEFLKSRGVKVLKSYQIDIAGSTEALVALEDWRK
FT                   DLKKSLKSSFISSFTNDVEVVAGTSDYVEFLKDRRVSYMVIEGLYGIGVPIRIDISLKT
FT                   YDSFNAVAPLIDLIRIAKLLGRHGIGGAVKEVCYYYFKDPPEKAKSIMDAKRSLDSLLN
FT                   KLLG"
FT   gene            complement(285759..286874)
FT                   /gene="thiI"
FT                   /locus_tag="SSO0333"
FT   CDS_pept        complement(285759..286874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="SSO0333"
FT                   /product="Thiamine biosynthesis protein thiI (thiI)"
FT                   /note="Cofactor Biosynthesis, Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40666"
FT                   /db_xref="GOA:Q980G6"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980G6"
FT                   /protein_id="AAK40666.1"
FT                   /translation="MLVIIRPSGEIALKSPRSRRNFEYTLINNIRNTIGGGKIWRSQGV
FT                   ILLEVNDNNANIEALSEVFGISSFSPVIAIKSNNLEDIVNKAKEIFAEIVKGKIFAVRA
FT                   KRIGSHSFTSLDVERRAGEALYPYSKGVDLENPEVEIFIEIRNEMTYFYHKVIKGPKGL
FT                   PVGVAGKTVVLFSGGIDSPVATWMMMKRGSVPIILNFNLGGDLHKELVLKELNMLKRWS
FT                   GGHKLKIFIVKGTDVFIKLSQVERRSRVVMLKRVMYKTAEKLCEKTNAKSITTGESLSQ
FT                   VSSQTMANLYVTEYGIKYPIFRPLIGFDKEEIVDIARKIGTYKHSIKLPEYCAISTKAR
FT                   TSEDLNEILKNEERLNVDYEKILENSEVIEL"
FT   gene            complement(287131..288432)
FT                   /locus_tag="SSO0334"
FT   CDS_pept        complement(287131..288432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0334"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40667"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G5"
FT                   /protein_id="AAK40667.1"
FT                   /translation="MYLSPSNATAEVIANDTVFFGFVNQGQPNFPMIYDIHVAITAYFV
FT                   YNITTASWQITKEIWNSTEVNALSDTVYYNLNEPIMKVSGIDTVTINASSGQGYTLQVG
FT                   NVMVIVKPDTYAELANGTMLSVYNFSLVTFSLEAIYSPPTAPNLTPLYAFAFAVNNQIT
FT                   PAISLVTMSNGKVIAQPPITVVWAPNTWTSWTWFGGTFNGTAYIGGSYKFVDHWLYGNG
FT                   VMVNVQFFKPVIWIFESSETPVAQTPKPVQVSVSSVYGLTPVNVYSYEINGTQGGVAVA
FT                   GNMIVTIQPNTKIVTPSGNLSVFNFSIVFYNPANAGNAPNGQVPILAFAYAINGNVTFS
FT                   YSSVNSITGLANPFITVILTPSQNVSMWTWGAKGYIFKDPIIVGNGIVINLTFFKPVPW
FT                   ILTAPEISSSSSTPMTSSSSTSTTTTSTSSPYWG"
FT   gene            complement(288531..289544)
FT                   /locus_tag="SSO0335"
FT   CDS_pept        complement(288531..289544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0335"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Methanococcus /Methanococcus /Plasmodium Falciparum"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40668"
FT                   /db_xref="GOA:Q980G4"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G4"
FT                   /protein_id="AAK40668.1"
FT                   /translation="MGKNFLNKFQLSSRSKMADMKTIAFSIVAVVLIVIAAIGFYEYSV
FT                   ANSRYTSAYNEYQSVDSQYMALQGNYTKLNQTYSQLASQYKLLEGMYNAVLTEAKNNYT
FT                   LYRQAETNYTYYKTLYEQMLQQISKLNVSGYKPGAALSAVLQFYDGIAIESPSDVVPLL
FT                   ASNFTAYIMGQPFAGTYNLTTFNTTWLANFFGTYETVYFYTTALPTVTQINGNTFNVTD
FT                   VVQYFVAPTADPVYLQVFNASNTIIVQYIHGVPEITELIWKGNEVPPSAVITGYPSQHL
FT                   IQANQVLDEFLSQMNALGAEFPGSTIAQNFAPNAQLVLIGQLLRYLKRELILEFLV"
FT   gene            complement(289591..290643)
FT                   /locus_tag="SSO0337"
FT   CDS_pept        complement(289591..290643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0337"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40669"
FT                   /db_xref="GOA:Q980G3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G3"
FT                   /protein_id="AAK40669.1"
FT                   /translation="MIEMLGIKIPLRKTTILPVLSFTLSSYFLTNFIFYLQYTDYTGLV
FT                   EFLLIGAPFIGRAITPITYPFLMSRINIERITYLSLGNMAILDILEFFMGTDTLALILL
FT                   RVATGILFGLATSAAVELATQSRSKIIMGMTMGGWALGWILSALMSFLMGKMVLITSSF
FT                   SLVFFLLIKRSNIDKKLFSNSGSISIAFSWKALLIFLLGFEPAYILQLIPSLLGENNAI
FT                   EETIIAYSISFIAYIILPSIGNIRISSLLTSLMIGILGFTSFITLKAWMFIPFTVLGLG
FT                   LNSLLPIIIKLMKVEVTKIGPSMNLASLSGFLIPSLVSIGDIEINSAILTLISSISLGA
FT                   IVYKNLKITA"
FT   gene            complement(290891..290978)
FT                   /locus_tag="SSOt18"
FT   tRNA            complement(290891..290978)
FT                   /locus_tag="SSOt18"
FT                   /product="tRNA-Arg"
FT                   /note="1 intron"
FT   gene            complement(291003..291644)
FT                   /locus_tag="SSO0340"
FT   CDS_pept        complement(291003..291644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0340"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40670"
FT                   /db_xref="InterPro:IPR007368"
FT                   /db_xref="InterPro:IPR041652"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G2"
FT                   /protein_id="AAK40670.1"
FT                   /translation="MYFTDVFREAYLDYKYFLNRDYSRKVVLDIIAAKYNLSSLERLLL
FT                   YRCVHSDKEIEIIKGKINNEEREVVLDGYNLALTLISAINNDELYLCDDGFLRDLGLGR
FT                   HKSSEIISDTLILISEYCEKYRIKCEIILDKQLSKSGEITSKLRKKGIEIRTVNKADKE
FT                   IIISNKAVYSNDFVILFKSQKISTILNTIFFESTFKILKGPWIANLEEKL"
FT   gene            complement(291654..294356)
FT                   /gene="alaS"
FT                   /locus_tag="SSO0341"
FT   CDS_pept        complement(291654..294356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="SSO0341"
FT                   /product="Alanyl-tRNA synthetase (alaS)"
FT                   /EC_number="6.1.1.7"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40671"
FT                   /db_xref="GOA:P96041"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96041"
FT                   /protein_id="AAK40671.1"
FT                   /translation="MKASEEEYKLNFFIKNDFKRKICKSCQTPFWTKDDKKEYCSDIPC
FT                   TDYYFFDINIKSQPLTVKEAREKFLSFFEKRGHTRIPPKPVLARWREDLYLTIASIVDF
FT                   QPHVTSGLVPPPANPLVVSQPSIRLEDIDNVGVTFGRHLTTFEMAAHHAFNYPDRYVYW
FT                   KDETTAYATEFFTKELGIPEEELNFKESWWEGGGNAGPCLEVTVGGLELATLVFMQYKI
FT                   TDNGDYIPLKLKIVDTGYGVERIAWVTQKTPSAFHAIYGNLVYKFFDKIGVAYIDETLL
FT                   KVASRFAGKIDPDNPDTIKIHRQMVSKELGIDIKNVEEELDRAAKVFQILDHTKTIMLM
FT                   LADGLVPSNSGEGYLGRLVIRRALKVLRLLKSDVRLYELVKEQIGFWKEDFPQVLKNKD
FT                   YILDAVELEQQRFEKILEKVPSIASTLARKSEITTEDLIQVYDSNGVPPDLLEEELKKK
FT                   RVKFELPRNFYALVAKRHQTSTIKNVYDKVKLPKDLLEYITTLQPTEKLYYKDQYMRSF
FT                   EGKVLGIYKNYLILDKTTFYPEGGGQLGDTGLIIDEKSSKRYEVVDTQKVNDVIIHVLK
FT                   EEPSTIKVGDNVRGEINWERRYRLMRHHTVTHVILAAAKKVLGDHIWQAGAEKTPEKGR
FT                   LDITHHKALTEEEVKLIENYANSVISDRRPVKPLEMNRMEAEMKYGVSIYEGGVPNSAT
FT                   IRLLEIKDWDIESCGGTHVSNTSEIGAVKIINVERIQDGIIRLEYVAGPALVDYIRETE
FT                   AKIAEASKIIGTSPDQLPSRLRRILNEVEKKNNLIIQYRRIVETELLNSLKPYEINGNK
FT                   IYIIEGLNDEEENKEILRKLTSTDNTIAISISDNRLQIATSKNMRVDKIVEELLKGGGK
FT                   GGGKGTFANVILSSKKSKEEIIDIVRKSL"
FT   gene            complement(294560..294880)
FT                   /gene="rpl12AB"
FT                   /locus_tag="SSO0342"
FT   CDS_pept        complement(294560..294880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl12AB"
FT                   /locus_tag="SSO0342"
FT                   /product="LSU ribosomal protein L12AB (rpl12AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40672"
FT                   /db_xref="GOA:P96040"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96040"
FT                   /protein_id="AAK40672.1"
FT                   /translation="MEYIYASLLLHSAKKEISEDALKNVLTAAGISVDEVRLKAVVAAL
FT                   KEVNIDEVLKNAAAMPVAVAAQPQATQAQPAAEEKKEEKKEEEKKGPSEEEIASGLASL
FT                   FG"
FT   gene            complement(294927..295943)
FT                   /gene="rplp0"
FT                   /locus_tag="SSO0344"
FT   CDS_pept        complement(294927..295943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplp0"
FT                   /locus_tag="SSO0344"
FT                   /product="LSU acidic ribosomal protein P0 homolog (rplp0)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40673"
FT                   /db_xref="GOA:P96039"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96039"
FT                   /protein_id="AAK40673.1"
FT                   /translation="MKRLALALKQRKVASWKLEEVKELTELIKNSNTILIGNLEGFPAD
FT                   KLHEIRKKLRGKATIKVTKNTLFKIAAKNAGIDIEKLEQYLTGPNVFIFTKDNPFITNM
FT                   FFENYKLRRYAMPGDKAEEEVVIPAGDTGMPAGPILSVFGKLKVQTKVQDGKVHVVKDT
FT                   VVAKPGDVIPAEALPILQKLGIMPVYVKLKIKVAYHEGLVIPAESLKLDLEGYRSNITE
FT                   AYRNAFTLAVEIAYPTPDVLKFTISKVFKNAIALASEIGYITPESAQAVISKAVAKAYA
FT                   LATAIGGKVDLGVQLPTVQQSQSQQPAAEEKKEEKKEEEKKGPSEEEIASGLASLFG"
FT   gene            complement(295940..296596)
FT                   /gene="rpl1AB"
FT                   /locus_tag="SSO0345"
FT   CDS_pept        complement(295940..296596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl1AB"
FT                   /locus_tag="SSO0345"
FT                   /product="LSU ribosomal protein L1AB (rpl1AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40674"
FT                   /db_xref="GOA:P96038"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96038"
FT                   /protein_id="AAK40674.1"
FT                   /translation="MQIVDRSNLEASLKLALSPENNPKRNFVQSVEIIVTFKEVDMKKG
FT                   DLKLREIVVLPKPPEKTKKVLVVPTIQQLEYAKKAEPNTILTKEELQKLQGNKRAIKKI
FT                   ARQNDWFLIAPDSMALVGRILGPALGPRGKFPTPLPNTADISEYILRFKRSTLVKTKDQ
FT                   PQTQVFIGTESQQIADLAENALAVLNVIESKGYAQKVRNIYVKTTMGKVVKVELR"
FT   gene            complement(296598..297119)
FT                   /gene="rpl11AB"
FT                   /locus_tag="SSO0346"
FT   CDS_pept        complement(296598..297119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl11AB"
FT                   /locus_tag="SSO0346"
FT                   /product="LSU ribosomal protein L11AB (rpl11AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40675"
FT                   /db_xref="GOA:P96037"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96037"
FT                   /protein_id="AAK40675.1"
FT                   /translation="MNKVPIKTIKIMVEGGNVKPGPPLAPTLSQLGLNVGEVVKKLNEA
FT                   TSSFKGMSVPVTIEVDSSTKKYEIKVGIPTTTALLLKEAGASEPSGDPAHKKIGNLSLE
FT                   QVIKIAIMKKPGLTTKSLKAALKSMLGTAKSIGLTVDNRDPKELVKEVEEGKYDDLLAK
FT                   YENEWNGVKE"
FT   gene            complement(297116..297589)
FT                   /gene="nusG"
FT                   /locus_tag="SSO0347"
FT   CDS_pept        complement(297116..297589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SSO0347"
FT                   /product="Transcription termination antitermination factor
FT                   (nusG)"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40676"
FT                   /db_xref="GOA:P96036"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96036"
FT                   /protein_id="AAK40676.1"
FT                   /translation="MGCNFVEKPNMRNYYAIKVVGGQEINVALMLEERIKTNNIKGIYA
FT                   IIVPPNLKGYVVLEAEGLHIVKPLIAGIRNARGLAQGLLPRDEILKIVSRKTVGPTVKP
FT                   GDVVEVISGPFRGTQAQVIRVEEAKGEVVLNILESAFPLQVTVPLDQIKVSKR"
FT   gene            complement(297579..297767)
FT                   /gene="secE"
FT                   /locus_tag="SSO5663"
FT   CDS_pept        complement(297579..297767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="SSO5663"
FT                   /product="Protein transport protein sec61 gamma subunit
FT                   homolog. (secE)"
FT                   /note="Transport, Cell membrane transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40677"
FT                   /db_xref="GOA:P58191"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58191"
FT                   /protein_id="AAK40677.1"
FT                   /translation="MSSNKIINWFRRLREDWNRIITVARKPDRNFFSLNLKVTLLVLAV
FT                   VGVLAYIIQLALTLIGV"
FT   gene            complement(297799..298599)
FT                   /gene="srpR"
FT                   /locus_tag="SSO0348"
FT   CDS_pept        complement(297799..298599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srpR"
FT                   /locus_tag="SSO0348"
FT                   /product="Signal recognition particle protein (docking
FT                   protein) (srpR)"
FT                   /note="Cellular Processes, Intracellular transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40678"
FT                   /db_xref="GOA:Q980G1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q980G1"
FT                   /protein_id="AAK40678.1"
FT                   /translation="MRYQLLESDVSFEVTEKILEDLKENIIGKKVKRSDDLERIVKDSL
FT                   KKSITEIITKNNAINVLEEIKKSPKPYIIIFFGINGVGKTTTIAKFAYMLKKNGLSCII
FT                   SASDTFRAAAQEQLEVHSRNLEIPLIKGRYGGDPASVAFDAIRAAKSRGIDVVLIDTAG
FT                   RMHTDTDLVNELKRVVNIAKPNLKILVLDSLGGNDALEQAKYFENNVGFDLVILTKVDA
FT                   DVKGGVILSLAYELNKPVGYLGIGQAYDDLIPFNAEWFIQRLFS"
FT   gene            complement(298872..299315)
FT                   /locus_tag="SSO0349"
FT   CDS_pept        complement(298872..299315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0349"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40679"
FT                   /db_xref="GOA:P58179"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58179"
FT                   /protein_id="AAK40679.1"
FT                   /translation="MSQGQGGITLDELIAQADYLKRYIDSLQRTQLELLESINSIDSAK
FT                   QAIETMKSGNKEMLVFIDRKGYLLAKVGGIIGDKVTVHLGLSYYAEVDLDSAIKILDKR
FT                   KDEISKAAQDLNNELQKAASTYNQIVDILNQIQQAAARRQQGE"
FT   gene            complement(299322..299591)
FT                   /gene="rplX"
FT                   /locus_tag="SSO5668"
FT   CDS_pept        complement(299322..299591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SSO5668"
FT                   /product="LSU ribosomal protein LX (rplX)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5668"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40680"
FT                   /db_xref="GOA:P58222"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58222"
FT                   /protein_id="AAK40680.1"
FT                   /translation="MNEMSGIKFYLVKGTALFGESHYPEKRKFVKIVRALNEKQAIEYV
FT                   YSHFGSKNKIKRYNIKIEQISEIKEEEIPDRRIRELAKVDKIIM"
FT   gene            complement(299584..300255)
FT                   /gene="eiF6"
FT                   /locus_tag="SSO0351"
FT   CDS_pept        complement(299584..300255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eiF6"
FT                   /locus_tag="SSO0351"
FT                   /product="Translation initiation factor 6 (eiF 6) (eiF6)"
FT                   /note="Translation, Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40681"
FT                   /db_xref="GOA:Q980G0"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980G0"
FT                   /protein_id="AAK40681.1"
FT                   /translation="MNLQRLSVFGTDNIGVYIYTNNKYTIIPRGLDSETKENIAQVLGT
FT                   ELLEAEISRSFLLGIFISGNDNGILLPKSTIDDEFRFLKENLRDCRVEILNSKVTALGN
FT                   TILANNKAALIYPEFNDIEEKIIKETLGVEDIKRGKIAQMITVGSVGVITNKGGLVHVD
FT                   TSEKELKELEKLFGVKIDIGTVNFGSVFIKSGLVANDKGTLVGASTTGPEILRIQKALG
FT                   E"
FT   gene            complement(300252..300518)
FT                   /gene="rpl31E"
FT                   /locus_tag="SSO5671"
FT   CDS_pept        complement(300252..300518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl31E"
FT                   /locus_tag="SSO5671"
FT                   /product="LSU ribosomal protein L31E (rpl31E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5671"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40682"
FT                   /db_xref="GOA:P58190"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58190"
FT                   /protein_id="AAK40682.1"
FT                   /translation="MKEKDNFEMIINLRKIKTGKRTGRSKRAVKFIKKVVARHFNAEKV
FT                   IIDPLLAKSISKNGNDKIVSKIRVVVSKIEEKIYLVRLAIKSR"
FT   gene            complement(300522..300683)
FT                   /gene="rpl39E"
FT                   /locus_tag="SSO5672"
FT   CDS_pept        complement(300522..300683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl39E"
FT                   /locus_tag="SSO5672"
FT                   /product="LSU ribosomal protein L39E (rpl39E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5672"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40683"
FT                   /db_xref="GOA:Q980F9"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980F9"
FT                   /protein_id="AAK40683.1"
FT                   /translation="MEMSRNKPVAKKFRLAKALKANSPIPIWIVLKTRGRVRYNPLRRN
FT                   WRRNDLKV"
FT   gene            complement(300674..301030)
FT                   /gene="pdcd5"
FT                   /locus_tag="SSO0352"
FT   CDS_pept        complement(300674..301030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdcd5"
FT                   /locus_tag="SSO0352"
FT                   /product="Apoptosis-related Tfar19 related protein (pdcd5)"
FT                   /note="Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40684"
FT                   /db_xref="GOA:Q980F8"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="PDB:6IQC"
FT                   /db_xref="PDB:6IQO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980F8"
FT                   /protein_id="AAK40684.1"
FT                   /translation="MSTPNSYDDEELEELLRRKAAQEQKRIEEERKRKAELESQKESIL
FT                   RVILTPEARQRLTNIKLVKPEFAESLENQLIALAQSGRIKIPITDEELKQILEQISQQN
FT                   RRDFKIQIRERGWK"
FT   gene            complement(301042..301518)
FT                   /gene="rps19E"
FT                   /locus_tag="SSO0353"
FT   CDS_pept        complement(301042..301518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19E"
FT                   /locus_tag="SSO0353"
FT                   /product="SSU ribosomal protein S19E (rps19E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40685"
FT                   /db_xref="GOA:Q980F7"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F7"
FT                   /protein_id="AAK40685.1"
FT                   /translation="MSLIMITAEMVPPDLLIKRLAIYLKENVKTVDPPEWALLAKTASF
FT                   KERVPDNAEDWWYIRAASLLRKLYVNSIIGIEKTRTIYGGRKRRGTRPEKFVKAPGHVN
FT                   RLIFQQLEKAGLVQKIKNKGRSLSPKGRSLLDKLALEIFKELAENNTSLKVYLE"
FT   gene            301577..302740
FT                   /locus_tag="SSO0354"
FT   CDS_pept        301577..302740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0354"
FT                   /product="Nicotinic acid phosphoribosyltransferase,
FT                   putative"
FT                   /note="Cofactor Biosynthesis, Pyridine nucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40686"
FT                   /db_xref="GOA:Q980F6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F6"
FT                   /protein_id="AAK40686.1"
FT                   /translation="MEFYIADFKQIKEGKVTDIYFERTLKTLEYLGIKDAKVRMEVHSY
FT                   GLPKGYEWALFTGLEEVLHLLEGVPVNVYAMPEGTLFKEIEPVMIIEGNYLDFGIYETA
FT                   FLGILRHYSSISTKAARLKFLAMDKTLFFFGLRSLHPALAPMADRAAYIGGMDGVSGAM
FT                   SKEYLGVDPSGTMPHALMLIVGDNVKAWKAFDEAMGSEVPRITLVDTFEDERTEALKAA
FT                   TLLGKKLYGIRLDTPSSRRGNFRKIIQEVKWTLKIHGYDHVKIFASGGIDEDDIINLRD
FT                   IVDGFGIGTSIAFPPSVDFSADIVEKFVDGKWVPFTKRGKWPGAKQVYRCGKLNDVITL
FT                   MDQEHPSSDCKPLLQKYMENGKIIKPLPSPKEIREYVIKQLTELQSS"
FT   gene            complement(302737..303792)
FT                   /locus_tag="SSO0356"
FT   CDS_pept        complement(302737..303792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0356"
FT                   /product="Phosphate regulatory protein, putative"
FT                   /note="Regulation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40687"
FT                   /db_xref="GOA:Q980F5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F5"
FT                   /protein_id="AAK40687.1"
FT                   /translation="MEVRRVQKFGKSTLMVSLPAEWVKEVSLSPGESVYLEVDEDGSLK
FT                   VYPPNLKAESKVKEMKISIQNDSVQGELVSRVIYSLYILGYDRIDIESKSGIFTEDILR
FT                   KVKDTIRNLIGLEIVSQTTDTIQIQSFLDPTKYTMNNLINRLSNSIKQMLHYLDLGIKE
FT                   SSRTFLQEVIELEREVDRLYYLALRQLLLAQMNRSLAYMIGVKRIQIVGNRILIKAIEE
FT                   AADEISEIALDLLSLHPSDLEEMKRLWNKINMYIEQTSSVIDHAVKVLAKEDTILINEV
FT                   MEELRTLRRVLITEAIISEEMLKEVKSPSLIAVLRALNLRLYNAIRRMEPITEIAFNRS
FT                   IENQKEIIITG"
FT   gene            complement(303854..304849)
FT                   /locus_tag="SSO0358"
FT   CDS_pept        complement(303854..304849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0358"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40688"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="InterPro:IPR014537"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F4"
FT                   /protein_id="AAK40688.1"
FT                   /translation="MMIRAITIFVTNYSKISDYTEKLSKLNDNNIWSKRISLPPTPIDL
FT                   SLSKLIELLPTTHSEIIFSLINLQEKDKRLREIKDILKSDKRIYVHVLVKTTDNLKDLA
FT                   KLIISLEPEEASRFALLFNQDFLLTPYFPTSSANTVYDSFGISLLYVDEFKQGKINEAL
FT                   SKADTIGRQLEKKLNIKYLGIDASLSPWMESSVGEIVESRSKKMFDISNLSAVAEINRE
FT                   IFEGVWRNRVNPIGFSELMLPIAEDNLLRERVKEGSLTLKDLLLMSYVCVAGIDMVGIY
FT                   SDLVTYENILKSVYYIQYTKRKPYGVRMIPTNGSPVLTKMFGEIPEVKVV"
FT   gene            304893..305294
FT                   /locus_tag="SSO0359"
FT   CDS_pept        304893..305294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0359"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40689"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F3"
FT                   /protein_id="AAK40689.1"
FT                   /translation="MSKITILLADNNIDKLYHGLVVALGAKALGWDVKFFVTSQAVVLF
FT                   TKAKKGKGKLGLPFFARFFVRLQMKRLNIPNPEKLIDDAINQGVEFFVDEAGLRLVNAR
FT                   SEDLLENVKLSGTITFILEAKESDVVITL"
FT   gene            305563..306456
FT                   /gene="cysM"
FT                   /locus_tag="SSO0360"
FT   CDS_pept        305563..306456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SSO0360"
FT                   /product="Cysteine synthase B (cysM)"
FT                   /EC_number="2.5.1.47"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40690"
FT                   /db_xref="GOA:Q980F2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F2"
FT                   /protein_id="AAK40690.1"
FT                   /translation="MSNPLHVFSNEQELLEGMWPTPLLKLRIGNDTWAKLEFYNPFSRS
FT                   VKDRTAWFLFRQALLKNATHIVEATSGNTGIALASLSSIFGMRFTMFLPVVAPKVYKVF
FT                   VKLLGGNVIEAGNSTNDVIPLVKKFAEMTNALNLDQFNNPINVIAHYETTAREIDEQLS
FT                   SIGKKPSRIIATMGTGGHIAGIAKYFKEKYGNDVEIIGVQPSENSRIPGIKRQNGSNSL
FT                   LRDVKIDRVVDVSLEEAIDGTISVARTSGILIGISAGATVAAYKKISDVSSTTVLIFPD
FT                   DAFKYVDILEQTLKEI"
FT   gene            306624..307280
FT                   /locus_tag="SSO0361"
FT   CDS_pept        306624..307280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40691"
FT                   /db_xref="GOA:Q980F1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q980F1"
FT                   /protein_id="AAK40691.1"
FT                   /translation="MFKNSYSQSRIIKKDNNIYVQKCYMTIFGIKWYFISTFFWNYPYV
FT                   ADPKERFVRELDFFLDNAWKDTVVVPKLIDIDAKELCITREFIEGDEINEENIEIMAKG
FT                   LREIHEVGYVLGDTKISNFVIVDKSKLAVIDAEQSFKSNNLYYRAWDLLVFFLFLSYKM
FT                   VNISHFQEVAKRFLDEYMPDKNIVKEFFDMKNINLMGLYPPTHLYVLKNLMSNFY"
FT   gene            307487..308413
FT                   /gene="moaA"
FT                   /locus_tag="SSO0362"
FT   CDS_pept        307487..308413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="SSO0362"
FT                   /product="Molybdenum cofactor biosynthesis protein A
FT                   (moaA)"
FT                   /note="Cofactor Biosynthesis, Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40692"
FT                   /db_xref="GOA:Q980F0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980F0"
FT                   /protein_id="AAK40692.1"
FT                   /translation="MIDRFGRPLEDLRITLTHACNFECFFCHMEGEEGDNYLLSKEDIL
FT                   LVAKVARKFGINSVKLTGGEPTLRRDLVEIVRGLKQLGYEDVSMTTNGFLLKDLAHKLK
FT                   LAGLDRINISLHAVSRDTFKKITGVDAFDRVIEGIKSAIDVGLVPVKLNFVVNRRNREE
FT                   AFKFIELSQNLGVNEIHLIELHPVGLGKLAFKEHDDLREIEEYIEKISIKKLIRKKHFR
FT                   PRYVLPSGLIVEVVKPYANPIFCAGCNRIRLSVDGKLKTCLYREDNVIDVLDILKGEYS
FT                   EDVKEELLGRAFMIAIAIREPNFKYKI"
FT   gene            308410..309468
FT                   /gene="pepQ"
FT                   /locus_tag="SSO0363"
FT   CDS_pept        308410..309468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="SSO0363"
FT                   /product="Prolidase (Xaa-Pro dipeptidase) (pepQ)"
FT                   /EC_number="3.4.13.9"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40693"
FT                   /db_xref="GOA:Q980E9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E9"
FT                   /protein_id="AAK40693.1"
FT                   /translation="MNRLRKLKAILEDKKDSCAIIFGSPNLFYFLEYSGAGALIYCDSR
FT                   FTLLVPALEMYRAENVKDVDIAIYYPSKILENVIEGNIFRAIEKIVNKSNIMLDVSWVE
FT                   ASTYKALSEKYKVIDFSNEIVRLREVKDNDEIERIRKAGEITAVAMKIGMEKLSEGTSN
FT                   EKQVAGIIDMTMRSMGAEDYAFPSIVAFGENSAYPHHIPTDRVLGNNDIVLFDIGAKYN
FT                   GYCFDSTRTFVFKNSEAKKVYEVVLEAQMEAIDAVRDGVMASEVDITARRVIEKAGYGK
FT                   YFIHSTGHGVGVEIHESPAVSMNSKQILKENMIITVEPGIYLKGRFGIRIEDTLIVTKG
FT                   KPIVLETAYKLL"
FT   gene            309522..310148
FT                   /gene="folE"
FT                   /locus_tag="SSO0364"
FT   CDS_pept        309522..310148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SSO0364"
FT                   /product="GTP cyclohydrolase I (folE)"
FT                   /EC_number="3.5.4.16"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40694"
FT                   /db_xref="GOA:Q980E8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980E8"
FT                   /protein_id="AAK40694.1"
FT                   /translation="MQKTELDDQKLVEEIARRIREILELLGENPEREGLKETPERVAKA
FT                   LLEMTSGLRTPPPQIKVFNLGDDGEVYEKNQIVLIKDVNFSSLCEHHMLPIIGKIHVAY
FT                   IVSNSGKVAGFSKIIRIVNYYSSRLQIQERLVEQIADAIMNSEIKPKGVMVIGNAIHMC
FT                   SYVRGVKDKEAKLVSVAYRGLFKTNRALQNHVFRLLDNANKVNLL"
FT   gene            310168..311073
FT                   /locus_tag="SSO0365"
FT   CDS_pept        310168..311073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0365"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40695"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014466"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E7"
FT                   /protein_id="AAK40695.1"
FT                   /translation="MLMGSKDKVISILKEKGPISQTELSKLSGLSKSRLSEVLSELEKQ
FT                   GIVKRRKVLGKNLEVSLSQDRFLRLGIIRAAEYPFIIPFIKNLENRGYSVTVKIYENGI
FT                   DLTRDLVEAKLDLGLSPIITQIIFSTIYRNIRIIGGGAKGGGGIIGKTCNRIASTVMSS
FT                   MEIWAFSEFKNIEIIPSYSSYEMLDFLEKGIVDGIAIWEPFLSILERKGHKVHRFTPLH
FT                   CCTLAVRETMDWERIKNIYEESFSWFKSSIDRWVSSYSNLLNIDYNILKEASKNYEFDY
FT                   YLDLKEFKNSLKNTGIFIPI"
FT   gene            complement(311070..312485)
FT                   /gene="glnA-1"
FT                   /locus_tag="SSO0366"
FT   CDS_pept        complement(311070..312485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA-1"
FT                   /locus_tag="SSO0366"
FT                   /product="Glutamine synthetase (glutamate ammonia ligase)
FT                   (GS). (glnA-1)"
FT                   /EC_number="6.3.1.2"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40696"
FT                   /db_xref="GOA:P23794"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23794"
FT                   /protein_id="AAK40696.1"
FT                   /translation="MPSTAEDVLKFLKENNIKWVDLQFTDVPGRLHHITIPADEFDLES
FT                   LKTGFGKLDGSSIRGFTSIYESDMVLLPVPETMTLIPWSPGVARVLCKVFWGGGKGRFE
FT                   RDPRFIAEEAEKYQTEQGYTSYYGPELEFFMFDKVKLDVSAPQSGTGYKIYAREAPWSD
FT                   SGTFVIRFKEGYYPAPPVDQLMDVRVEIVDTLVKYFGYTIEATHHEVATAGQGEIDFRF
FT                   STLVDTADKVQTLKYVAKNIAAKHGLVVTFMPKPIYGDNGTGMHTHLSLWTKDGKKNLM
FT                   YDPNDEYAEISQFGRYVIGGLLTHARALSAIVSPTVNSYRRLIPGFEAPVYIAWSKGNR
FT                   SAVIRVPAYYRGMEKAKRIEYRPPDPSTNPYLAFAALLMAALDGVNKKIDPGDPVDENI
FT                   YHLTPEKRRQLGIKELPRSLNEALDELESDKEFLKPVFNSSILDTYIDLKRDEARSLQG
FT                   YPHPMELYYYLDS"
FT   gene            complement(312608..313216)
FT                   /locus_tag="SSO0367"
FT   CDS_pept        complement(312608..313216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0367"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40697"
FT                   /db_xref="GOA:Q980E6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E6"
FT                   /protein_id="AAK40697.1"
FT                   /translation="MIEVYVKKKLQAFLLNVNFSEKGIIAITGKNGSGKSTLLNVIAGI
FT                   LKPDEGYIRLNDIDITNLPINKRNVILVTPDSYIPTLDLKKHLTWGAKLRGRKVNDKEV
FT                   MEVAKLLGVPNENKKVGNLSLGNREKVSLATAILTKPNLILVDEGFSNISEKEYFINIY
FT                   TDLCKKNQIDLIYVTQDTEDAKFSDHHYVMNNGSLHKVF"
FT   gene            complement(313213..313614)
FT                   /gene="trxA-1"
FT                   /locus_tag="SSO0368"
FT   CDS_pept        complement(313213..313614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA-1"
FT                   /locus_tag="SSO0368"
FT                   /product="Thioredoxin (trxA-1)"
FT                   /note="Close hits to Eukaryotic version; Energy Metabolism,
FT                   Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40698"
FT                   /db_xref="GOA:Q980E5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3TCO"
FT                   /db_xref="PDB:6H1Y"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E5"
FT                   /protein_id="AAK40698.1"
FT                   /translation="MSEIDSLIKEVAERLQKKAEEYGKKKEDVTLVLTEENFDEVIRNN
FT                   KLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTL
FT                   IFVNGQLVDSLVGAVDEDTLESTVNKYLK"
FT   gene            complement(313601..314965)
FT                   /gene="fadD-1"
FT                   /locus_tag="SSO0369"
FT   CDS_pept        complement(313601..314965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD-1"
FT                   /locus_tag="SSO0369"
FT                   /product="Long-chain-fatty-acid--CoA ligase (fadD-1)"
FT                   /EC_number="6.2.1.3"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40699"
FT                   /db_xref="GOA:Q980E4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E4"
FT                   /protein_id="AAK40699.1"
FT                   /translation="MSLATLLYKWFKETPSKTFLIDKNQSLTYEQVTREVVYVASNISP
FT                   GDTVVHIMLNSLQSVINYLAIFWAGGKAVAVDPQTSAEDLKFILEDSNPDLIVTDEEIY
FT                   KREYDILKSYQVIVNKRGKDVFTKPYEYREDEVGLVYYYAGIVGRTMQVLHSANRVELN
FT                   SATLYNSIGLKEIRGILTVPLAHVLGNSVLGITLEAGGKLYIMSKFNVDEAIESINKYN
FT                   INYLSTVPTVYDYLNNEEKRKVDSLELCVSSAAPLYPSTVNTFKSKYGKDIVQQYGFTE
FT                   GLILTFQPKELSGVISIGKPLPGVEIKIVDDKGNENNEGELWVKAPWLMLGYKDREETA
FT                   RVFNEGWLRTGDLVKIDEKGLLYFRGVKKRMLKFKGYPIFPRDLEEILKTHPMVEDVKV
FT                   IGEDAGNLGQQPVALVKVKEHKAGIEDELLNYVNSRVAFYKRLKKVYVVDRIERN"
FT   gene            315002..315880
FT                   /locus_tag="SSO0370"
FT   CDS_pept        315002..315880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0370"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40700"
FT                   /db_xref="GOA:Q980E3"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E3"
FT                   /protein_id="AAK40700.1"
FT                   /translation="MIKIVGLSRIHITLFDLEGKYGRLDGGAGVALKYPRIVVRSGNCF
FT                   KPEVSLPFDVPKICIEEDFEQHIGLGHTTQYLLSVAKLAAEYNFKRLNSYELAKLVKRG
FT                   GTSGVGVYAFEYGGFIVDGGHSTKVKRELLPSDFSSAPPPPLIARLNFPWYIYVNVVRG
FT                   GRRVFGKDEINAFKQAKLEGLDTLARVVLMELIPSVAERDLEGALNAISLIQDLGFKKV
FT                   EVFLQTDEVKKLMNDMVKAGFPAGLSSFGPAVYTFVSSKREGDELISRFGGFVSEPNNE
FT                   GAKVFWSTMSS"
FT   gene            315925..316908
FT                   /gene="sun-1"
FT                   /locus_tag="SSO0371"
FT   CDS_pept        315925..316908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun-1"
FT                   /locus_tag="SSO0371"
FT                   /product="Sun (fmu) protein (sun-1)"
FT                   /note="NOL1/NOP2/sun family protein. Related to eucaryotic
FT                   proliferating-cell nucleolar protein p120; Cellular
FT                   Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40701"
FT                   /db_xref="GOA:Q980E2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E2"
FT                   /protein_id="AAK40701.1"
FT                   /translation="MNAIRKPNPRLYIRVNTLKTSVEKILERLPHFKPDEDFKEAIYVE
FT                   IKGPNEINIHENKVIVDKKTAESAMLGANVYKPGLKSVVINNAKDKRVTVYSDNGIPVA
FT                   EGKYYGMNTNLVVEVTNSLYTSPKLADLPELKNGLIYVQGKASMYVAHLLDPHPNEKIV
FT                   DMTAYAGGKLTHIYQLEPRVKLIGFDHTEKKVEKLRDLANKMGMRIEIYKADSRYLYED
FT                   YKIGDVDKVVIDPPCSALGIRPKLYDHKTKQDILNFHKYQKQFLNSAYKILKKNGVVIY
FT                   STCTVTTWENEKVINDPRFSVEYEIRFHPHIHEITGFFIAKLIKKG"
FT   gene            316920..317429
FT                   /locus_tag="SSO0372"
FT   CDS_pept        316920..317429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0372"
FT                   /product="Ferripyochelin binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40702"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E1"
FT                   /protein_id="AAK40702.1"
FT                   /translation="MPIEEYLGKTPKVSQKAYIHPTSYIIGDVEIGDLTSIWHYVVIRG
FT                   DNDSIRIGKESNVQENTTIHTDYGYPVEIGDKVTIGHNAVIHGAKVSSHVIVGMGAILL
FT                   NGSQVKEYSIIGAGSVVTQGTVIPPYSVAVGVPAKVIKKLREDEILIIDENAEEYLKHT
FT                   RRLLKL"
FT   gene            317426..318394
FT                   /gene="nirJ-like"
FT                   /locus_tag="SSO0373"
FT   CDS_pept        317426..318394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ-like"
FT                   /locus_tag="SSO0373"
FT                   /product="Heme biosynthesis related protein (nirJ-like)"
FT                   /note="Only one domain shows homology; Cofactor
FT                   Biosynthesis, Heme"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40703"
FT                   /db_xref="GOA:Q980E0"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q980E0"
FT                   /protein_id="AAK40703.1"
FT                   /translation="MNKDLKAIKWFITTQILKDPFNPAYATFKVTSRCNLRCTFCSPSY
FT                   YSGELGEGSTERVKKIIDNLRDSSIVVLSFEGGEPTYRPDILDLLEYAHDGSFYIMLTT
FT                   NGYRLKDEDFLTKLADKIDFLHYSIDEYHWNVKELENLCRFRKYGLKVNVQTVVTRYNL
FT                   YKLEEKVRKVAECGYKILAMPAVDYPNSKVKLAPDPYEFYKVLYDLKRKYGSTLNNSWG
FT                   FINAIIGKVPKRVVSYAITIYPNGDLPYPDDINGEIVGNVAEEPLNKILQSSKVKELQQ
FT                   KMLENQAKFEYLHLQTASFNNIRDLASYVSEMLRWRFTGRA"
FT   gene            complement(318365..319240)
FT                   /gene="xerC/D"
FT                   /locus_tag="SSO0375"
FT   CDS_pept        complement(318365..319240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC/D"
FT                   /locus_tag="SSO0375"
FT                   /product="XerC/D integrase-recombinase protein (xerC/D)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40704"
FT                   /db_xref="GOA:Q980D9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR033686"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980D9"
FT                   /protein_id="AAK40704.1"
FT                   /translation="MKLDLGSPPESGDLYNAFINALIIAGAGNGTIKLYSTAVRDFLDF
FT                   INKDPRKVTSEDLNRWISSLLNREGKVKGDEVEKKRAKSVTIRYYIIAVRRFLKWINVS
FT                   VRPPIPKVRRKEVKALDEIQIQKVLNACKRTKDKLIIRLLLDTGLRANELLSVLVKDID
FT                   LENNMIRVRNTKNGEERIVFFTDETKLLLRKYIKGKKAEDKLFDLKYDTLYRKLKRLGK
FT                   KVGIDLRPHILRHTFATLSLKRGINVITLQKLLGHKDIKTTQIYTHLVLDDLRNEYLKA
FT                   MSSSSSKTPP"
FT   gene            319315..320832
FT                   /locus_tag="SSO0376"
FT   CDS_pept        319315..320832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0376"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40705"
FT                   /db_xref="GOA:Q980D8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D8"
FT                   /protein_id="AAK40705.1"
FT                   /translation="MVSLLLISLLYLGIMLIAAKISEEIFRRIGLVTFVGPILMGILLG
FT                   NGVFGVIQINEIISFITSLGIVFLLFLAGAEEFNVENRPNANVFLAVILESIIPFSVIL
FT                   VAIYIIGFKNYLILIVPLAMSSAGPLSRMLMDVKISDNRISNLIFQQVILIEIIFVILF
FT                   AILLKTSEILITIIEIFLVFAFTIMFGRTLAKILEKIEYYFKAREIEFASLIAIILIIG
FT                   YLAELYKFNSAISAFFLGILLKDYLKDRPELLERLHAFTYGFFEPLFFLGIGLYVTKIN
FT                   ASIILFSLLFFSLIIASKFLAGFISSKILNIKGKINGFATSVKGGVDSSLLLTGLTLGY
FT                   INEFMYSFSILAISLSALIVPLLFQINFKISNKISESKKVKLSQEVIKLQIKPLYASCE
FT                   ENLRSVISKISERGVRGIVVVNYENKPLGYVSIQTLLEIDPELYESTKACEVPLDEVPI
FT                   EYDNVKVIDLLRKFRETEKPVIAIINKEGVLVTTVYERELARFLISF"
FT   gene            320846..321364
FT                   /locus_tag="SSO0377"
FT   CDS_pept        320846..321364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0377"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40706"
FT                   /db_xref="GOA:Q980D7"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D7"
FT                   /protein_id="AAK40706.1"
FT                   /translation="MTVWYTGTGDKGKTKLPSVGEIWKDDDIVNAIGDLDELNASLGVI
FT                   SSLYPQLREIMVRIQSDIFSLSSEIAGFDMNFEEEKVKWIEEEISSFSKGIPELRNFIL
FT                   PGGHVAASFLHLARTICRRSERSVVKILKRSKAKDVHVKYLNRLSSLLFVLALYVNKQE
FT                   KVQEIIWKR"
FT   gene            complement(321348..322277)
FT                   /gene="ocd-like1"
FT                   /locus_tag="SSO0378"
FT   CDS_pept        complement(321348..322277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocd-like1"
FT                   /locus_tag="SSO0378"
FT                   /product="Ornithine cyclodeaminase related protein
FT                   (ocd-like1)"
FT                   /EC_number="4.3.1.12"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40707"
FT                   /db_xref="GOA:Q980D6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D6"
FT                   /protein_id="AAK40707.1"
FT                   /translation="MIILTRKDLDELLKAEIAVSSVKEAFKLHYQKKVDQPQRLVMSVK
FT                   GNWWGLMPSSTDYSFVTKIVNVIPENKERGLPLVQGVVILMSPDTGEILAIIDGTTLTA
FT                   IRTAAASILSTELAINGRNIGILGIIGAGTEAYYHAKLALEYFKVQKLYISARKSHFEL
FT                   AKRVGGEATDLETLLKNSDTIFATTSSNFPVVLGKYLKDVFHLSSIGAHTPDSRELDDD
FT                   TIIKVKSYIVDSLEAVSKESGDYIIPKQRGLLENKMIKELGEIIEKGIKIERPSLFKTV
FT                   GIAVEDNITAHIAYQEALRRGIGFNVSI"
FT   gene            322456..323946
FT                   /locus_tag="SSO0379"
FT   CDS_pept        322456..323946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0379"
FT                   /product="Hypothetical protein"
FT                   /note="Hits to only one domain"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40708"
FT                   /db_xref="GOA:Q980D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D5"
FT                   /protein_id="AAK40708.1"
FT                   /translation="MYLILINIILLSKKFIYKHVLHNVMSVNLRKVLVTGFISLFAILM
FT                   LILPITLAQSQTISNVLLIPTGFITIPTSGSSASFTAYVINNNPNSETVTVYLNGNSYT
FT                   TLTIPPYSYSPVTLSLSTGKNILIVNGQSLIINVNSISKVISANILLNNSANLILINGI
FT                   PGKLYTVNLTIANIHNWNISISTYTYSSIFFTNMYKLYNAPFELQPPLSNSSYIPILVP
FT                   LYVPQGLYYFYNYVQFYNISNYQQVLGYIPFLIFINVSYGLNGTLVTSNTYTSNNITVS
FT                   YVTANGYTYILSKYPFSLSDKVIVKVIPHSSSLNPYTVVLGNFTSTLTINGQALQEPYF
FT                   GSNSSEFAYGNSWIELKIPEQYTGTQYQINITYITPHGIVSTGVIPAITSSTTTTTTTS
FT                   STTTTSTTTSTTSTTSTSSSTTSTTTSSSSTTTTSSSITSSSTTSSTTSSTSTTTPTST
FT                   SSSTTSVTTSGVSTSVIIGIAIVVIIIVIVAVVLLRRR"
FT   gene            complement(323985..325076)
FT                   /locus_tag="SSO0381"
FT   CDS_pept        complement(323985..325076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0381"
FT                   /product="Sugar phosphate nucleotydyl transferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Several close hits to other proteins; Cell Envelope,
FT                   Surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40709"
FT                   /db_xref="GOA:Q980D4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D4"
FT                   /protein_id="AAK40709.1"
FT                   /translation="MSEMKAIVLAGGKGEGLLPYTEKVQKEAITVLGKAIINYTIEGLK
FT                   KAGVKEFEIIVNEKGNQIEEEVEKLDVSFETIVQKKQGIDGAVLEGIESIDDDVFVLAF
FT                   GDIIAPAEFYKSLMDTYIMTGSQAVIPLIPISEGTETYGLVKIVDNKLKVVKESSTLAL
FT                   GGAYILPKPKDNFTSLLDYIDLLSSQARLNYFIWSESWVDIGYPEDLLFALETLLRRKE
FT                   SVISDKAEISKNAIIGKGVIIEDYAIIEDYAIIKGPAYIGKNAYVGSFSLVRDYSSIEE
FT                   GAKIGAYCEIAHSLIEPFAEVGSKSYLTYSIVGKGAKIGASVITASYPAHSLSRPRFNK
FT                   LGALISPEKVIKHGSVIEAGTKV"
FT   gene            complement(325069..326844)
FT                   /gene="glmS-1"
FT                   /locus_tag="SSO0382"
FT   CDS_pept        complement(325069..326844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS-1"
FT                   /locus_tag="SSO0382"
FT                   /product="Glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) (glmS-1)"
FT                   /EC_number="2.6.1.16"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40710"
FT                   /db_xref="GOA:Q980D3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D3"
FT                   /protein_id="AAK40710.1"
FT                   /translation="MCGIIGIVSNKESNRLAELVVSCLNRLEYRGYDSVGVAALSGGNL
FT                   EVRKAKGTVEEVVRKKNIKELSGYAFLGHTRWATHGAPTDYNAHPHTDCINNIAVIHNG
FT                   TIRNFKELRDELQALGHKFKSETDTEVIPHMMEEYMKRGMDTFQAFRSAIKNIQGSYAV
FT                   LAIVKGERRIFFAKRDNPLVIGLGDDKTFVASDIPSFLPYTRKVIVISDGELGYVTPNT
FT                   VYMEDENGNPIDVTSRIKIIDWDASSASKQGYPHFMLKEIHESPIAVKDTISGLLSEVD
FT                   KINEIAEEIRESSRIIVTAAGTSYHAGLYFSLLLTRKGYTVIPLIASEYHNFRARKGDI
FT                   VLAISQSGETLDVKMGIRKFKDEGAKIIALTNVIESDIARESHYKLYMRAGPEIGVAAT
FT                   KTFTSEIVSLLFLYSLIEKESISYLETAHETVRNVITETEGFAKKIGEELANKNNVYYL
FT                   GRGLGVPLAMEGALKIKEIAYIHAEAYPAGESKHGPIALVESGFPIIFVNDGELVDELE
FT                   KNLQEMKARGGKTYSISVNKRLNFADTEILVNTSEKLSSLAIAPIIQLIAYYASVKRGY
FT                   DPDKPRNLAKTVTVE"
FT   gene            complement(326885..327829)
FT                   /locus_tag="SSO0383"
FT   CDS_pept        complement(326885..327829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0383"
FT                   /product="Mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40711"
FT                   /db_xref="GOA:Q980D2"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980D2"
FT                   /protein_id="AAK40711.1"
FT                   /translation="MMVEAKVPLKLTLFGEHAVVYDRPAIAMTISESLKVKVSENDKFL
FT                   IISPSLNIKGVKLDLNEMKIESDEAKKVLRYVFEVLNYFEMKKPVKIEINSTVEPSVGL
FT                   GTSAAVIVGTVAAYSKYLGIDLSRDEIAKISHNIELKVQGIASRMDTYTETYGGLIYFP
FT                   AGGKGFEKIDTNFELTAGYIRRSMSTADVLWRVRTLKESNKEVFENILDVIGEITNRAK
FT                   SLIVEQNFEELGLLMYVNHGLLFSLGITSPEADEIVSRAKQLGIKGCKISGGGAGGSII
FT                   CIKSVEAEVLLRSYNARIVNSTLTKDGVIFSIL"
FT   gene            complement(328136..329296)
FT                   /gene="thrS-like"
FT                   /locus_tag="SSO0384"
FT   CDS_pept        complement(328136..329296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS-like"
FT                   /locus_tag="SSO0384"
FT                   /product="Threonyl-tRNA synthetase homolog (thrS-like)"
FT                   /EC_number="6.1.1.3"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40712"
FT                   /db_xref="GOA:Q980D1"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980D1"
FT                   /protein_id="AAK40712.1"
FT                   /translation="MIILFIHASDFSFNVKERAIKEPEEAKLKSIELKNTLVCFTTVEK
FT                   GDDEEILSKAIDDILDVYSKVKADSVVIYPYAHLSSNLANPDTAIKILESLENLLKDKV
FT                   KVYRAPFGWYKAFSISCYGHPLSELSRRIRKTEELEKSEELKYCEKFGFPSSSESAFMR
FT                   RATIGYLRNLFQPLFESENNENVRDGEMSILYQNVESGRILPCINENPRIVVVYGGVRE
FT                   LNFPKEINDSKNRIRVWWVNESKIYVDVGRLIYYFILESVKQQPPTLPDWLNPIQVRLL
FT                   PVKKDFLDFSIQVAERLRKEGIRVNIDDLDDSLGNKIRRAGTDWIPFVIVIGEREVKTN
FT                   TLTVKIRARNEQKSMTVEELVKEIKDEVKERQNLPLYYTLYRHKNN"
FT   gene            complement(329319..330797)
FT                   /locus_tag="SSO0386"
FT   CDS_pept        complement(329319..330797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0386"
FT                   /product="mRNA 3'-end processing factor, putative"
FT                   /note="Transcription, RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40713"
FT                   /db_xref="GOA:Q980D0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q980D0"
FT                   /protein_id="AAK40713.1"
FT                   /translation="MPMTFVFITVGFSITIFFSLVSIITLVAFICSVFIPILSIFFRSE
FT                   GFIFAITCFIEEEVNLIVCGYDISQMNYFLKILGGGREVGRSAIEVGNSDGSIILDYGV
FT                   NFDEKDNPNFPLQEMPGKVKGFVVSHAHLDHIGALPIYQIGSLNTKVYGTVATRIITET
FT                   MLKDFLKLSGAKIPYEWVEVRKTMDNFMAIGYGEEVEIDSLKVSLYNAGHIPGSSIIKV
FT                   SSEKGVIAFTGDINLTETKLMKPAEIENIGDANVLVMESTYGKFNHPNRKDVENDFYDK
FT                   VMEVVESGGTVLVPAFSLARSQEVLSVLAERNFPYPVYYDGMSREITEIMLGFKEFLNR
FT                   PDLLKKAYDNFNYVKGWEDRHRAWKEKGVIVASAGMLKGGPAVYYFKKLSENSKNAVFL
FT                   VSYQAINTPGRKLLEMGKFDEYSGLLKARLEIFDFSSHAGRRQLLEIVKSVKDLEKVVL
FT                   VHGSPDNESSLADLIKQEIGVEVITPENGQEISL"
FT   gene            complement(330962..331702)
FT                   /locus_tag="SSO0387"
FT   CDS_pept        complement(330962..331702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0387"
FT                   /product="Conserved hypothetical protein"
FT                   /note="M.jannaschii homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40714"
FT                   /db_xref="GOA:Q980C9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C9"
FT                   /protein_id="AAK40714.1"
FT                   /translation="MFITLMAVDELFDSYIIETIGKRISGDIVWSKDISGSLRKWREMF
FT                   NVSQGELAREMGIKQSVIADYERGRRQAGSEFIKRYVSALISIDARRGYKVVKELAKMF
FT                   GINFPFIVDMRDFNSPICIDKLIRAVDGVVVNSFVTDKKVYGYVVTDSIRAILSLSGLE
FT                   FYQVLSMMVNRVVVFTRVSSGRSPMIALKVAPIRPQVVVFHRPVKLDPLALMLSEVEGI
FT                   NIIVSMKPTEEDLIKGLRSLLAES"
FT   gene            331724..331799
FT                   /locus_tag="SSOt19"
FT   tRNA            331724..331799
FT                   /locus_tag="SSOt19"
FT                   /product="tRNA-Pro"
FT   gene            complement(332169..333398)
FT                   /locus_tag="SSO0388"
FT   CDS_pept        complement(332169..333398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0388"
FT                   /product="LPS biosynthesis protein, putative"
FT                   /note="Hit to only one domain of this protein; Cell
FT                   Envelope, Surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40715"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C8"
FT                   /protein_id="AAK40715.1"
FT                   /translation="MTTLGVVYDKFLSPYFAGGGAVHAYEVTIRLKEHFKIVYYPSSPV
FT                   LSWDKENVEKKAKELESQGIKVADEFYEILEEKRRIGRLKRFLFADKIAREFSKGFKVD
FT                   ADILYEPDHTSLDIFYLARDTKYGVTFHEPPFYNNSLRYFRRLVKFYGVNPYTGKGFHT
FT                   RFLYNEYIKYLYKRLFKKVKKPTFLAGVSEAPLLESGLGGEVIKPGNAFNPSLLKFRNR
FT                   GKEDYVVFWSRLNQDKGFHELPDILRIMEKRGGNKVRLILMGKFFDKYNERRFWSKVRK
FT                   YDLRVDYKGFVKREELADIVSKAKVLIYPSHVDGFSLVALESLALGTPVVAYDIPAIKS
FT                   VYGGLECVRIVNEFDKESMAENALKFYKMSEKEIEEIMNGDKLMEFLKLHSNWDNVANS
FT                   VLKILKKYLI"
FT   gene            333447..333520
FT                   /locus_tag="SSOt20"
FT   tRNA            333447..333520
FT                   /locus_tag="SSOt20"
FT                   /product="tRNA-Ala"
FT   gene            333735..337430
FT                   /locus_tag="SSO0389"
FT   CDS_pept        333735..337430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0389"
FT                   /product="Hypothetical protein"
FT                   /note="Homoserine dehydrogenase domain in protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40716"
FT                   /db_xref="GOA:Q980C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980C7"
FT                   /protein_id="AAK40716.1"
FT                   /translation="MNKTLGLILTSVFLLSTLGIITGFVIPTQAANSNDAAIYTIPSVT
FT                   SVSNTSNIVINLFFNATSNSTVGAQASAFNYGLAINYTLDAITFTVVLPSGTSYPLIKL
FT                   NAKNFANYGYYDLAHNSIVLLLNTTASSTAKELAYSYEQSIGVTPSASYKIYNYTNKTV
FT                   NVNQYMNELPLSMLIYMATNGKYNNLASLPVGTKLEFTYAGVTYIIAVSPTVKLVGELL
FT                   NPLYTANSKMLPGTNYAVGRSNITVAVYDNLITTTTSPFNFTLTYSSLAPALIYWFVIA
FT                   NTTYTNNGASTPTASFQAPPFKQYFPSNSTILYSAAPTKSSILMFNGQMNVTAHENVTL
FT                   TLQTGTNIYTSPNFNVTPPGNYTFSGKLGVGFNGFIYQNGSATLTATIFNGTINFFFSS
FT                   TGQKAAFTFFLVPIVPINLGDNNGATVIYNGVSLNTGFPQVVVMFNITGNFTKSGSNYL
FT                   LYGSVYEAELKPLGSTQLQKLAGATDSTQFVGNLISSASSPLVSYFNYGESTTTITGTS
FT                   LSFTVLMPLKFIVERLGYIYLVTFHIWGPSATVTVTGVDYHGTQIALGSFRAYVALPSF
FT                   YTLPKTPLVGLTCDNMYTLAQVSDAGSVLETSTANSNANNATVIGPYDLMSNAGLHVAI
FT                   YNGSKLVKSGNLGLLPNATTAPITTTITLNGQTVALTYSSAPTAIYPVDFKFEPGFSYS
FT                   VTTNVIYNTSIPTYVVTVYMPLKYILQTKIVMWYVSPDYAAYFYYSSTGQYQTSNVTLT
FT                   FANVTPELVMPQVFPVGKLYMPFGINDPYYVFYSSISIGPQSGVIEAVENGFNVGNITS
FT                   ITVELNGMNESIVLSPLNVSKLLISSNLGEVSQCSPLFTTTLFNISALASLLGLPNAAA
FT                   LNGSYLYVTYHDIISGAYVTNRTLLVVGQFYVMPPTTPGSVEWILTAKYINATTGIPVE
FT                   ISYAVVQQPSAKVVDINAANASITQIQVTGVKIVSKYATVTVMYNPSNASTIVYMNGMF
FT                   VASYGGNLISSLSETSTFGVYYGAVVNLYVATGTLSSPNGTMYVVLGSHKVAVGTANLY
FT                   TYAGYHFGPYTALPLVSNVTFTVQDPVTHATLTGQTTLGAFNNTPIRLAPLGVSIPQTA
FT                   QYKVFYYYSTPLVLSPTSQYIVLSVTSVISYPYPFYIETVSFLGYNVTTGTPVPGTPAF
FT                   QTVYSPSLGPGVVLQVPVQSYQFISLSTPSEPHTVVMFAVPFAGGPAISLYPTFLVYAN
FT                   VTAISS"
FT   gene            337472..338665
FT                   /locus_tag="SSO0390"
FT   CDS_pept        337472..338665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0390"
FT                   /product="Hypothetical protein"
FT                   /note="One domain shows homology to P.falciparum
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40717"
FT                   /db_xref="GOA:Q980C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980C6"
FT                   /protein_id="AAK40717.1"
FT                   /translation="MVVKKTFVLSTLILISVVALVSTAVYTSGNVTFYSPSVNNQIYYV
FT                   GKSVTIDAVVPQQFAGQGAVINLFFPNSTLAASIPTTVNATGGIYVPNAYTFPHVIGIW
FT                   QITVEVTGGVAVGTIDVNVTTPAVAPIILTLQNLAMYENTYPQFIEFANGIITSVVMQN
FT                   GTVNIMGYVYNSTVGPLSGATVSLTLNIPTVGTKTLSTTTASNGSFMLSFQVPQLSTTL
FT                   TLISSYLISGSLTVSYGVHTVTYNVFITAIPNYLSVINALNNEVSTLRSEISSLNSTIA
FT                   SLNKSLANANTQISNLQSEITTLNSEIGKLNSTVGSLSTQLSSLSSQYNTLSSQVTALN
FT                   GKISNLSTSLSTLNGEVASLRSTVSSLTTIAYGGIIAGIIGLIVAIVAIVLVMRRIS"
FT   gene            338925..339000
FT                   /locus_tag="SSOt21"
FT   tRNA            338925..339000
FT                   /locus_tag="SSOt21"
FT                   /product="tRNA-Gly"
FT   gene            338970..341201
FT                   /locus_tag="SSO0391"
FT   CDS_pept        338970..341201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0391"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40718"
FT                   /db_xref="GOA:Q980C5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C5"
FT                   /protein_id="AAK40718.1"
FT                   /translation="MIPGSNPGGRIHNVIEMFENYFMDAVKGYYRHLAIIESQDPLEKI
FT                   NSLIDDYLKVNKKPRVIYGFHPWLDNSKDRMKELKKRFENFLDIDYSNSEKYLGQSADL
FT                   VILDAMDDFRPNYIARFVDMTKGGGIAIIYSDNILEGKLYKKSLTRYGVVKDLFEARFI
FT                   ELAKRYRGIIFFQGNDRITFTPYSSNETHKPYKKIPKSPKVSMELHELCLSSDQNKVLE
FT                   ESLFIMNLGKRVLVITAARGRGKSASIGLFLSYLMSEGNFGSIIVTSPTYYSSQEIFKF
FT                   IIRGLEALNVKYKVITSRDGKIMKISTRDSRVKWVSPDLAKNEEGDLIVIDEAAAMGIE
FT                   FLDYIVRSWDKVILVTTIHGYEGSGKAFLKYVDKLKGKVLLKNIKMDYPIRYAKGDPIE
FT                   KFLFDVFLLDAEPHEVEYNGKLKIVEVPQEELFRDDDLLKSVYGILVTAHYRNSPDDLM
FT                   LLGDMAFQKVIVGYSSENPVAVCQVVYEGGLTDKQIWDISNGLKNEGHLIPHRLIKYMR
FT                   ALDFGKLKGWRIMRIAVSPENQGKGIGSRVIEEVIKMAKGVDWIGSSFVADYSVLRFWI
FT                   KNGFLPVYLSSIKNEELNGYSVIVIKALSERTKEFVVKLSSLLKDKLLRTSHQVYYNLN
FT                   PQLIVLLLRNTYSERIEGEVPDLYVDKIKAYTEGKVPYNVIAEAAHFLVTKHFLELKAD
FT                   LSIEAEASLVARVLQGKSWYHAGLMLGLSSREVEDNVKQSLGVLLETYT"
FT   gene            complement(341832..341916)
FT                   /locus_tag="SSOt22"
FT   tRNA            complement(341832..341916)
FT                   /locus_tag="SSOt22"
FT                   /product="tRNA-Ser"
FT   gene            complement(341941..342501)
FT                   /locus_tag="SSO0392"
FT   CDS_pept        complement(341941..342501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0392"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40719"
FT                   /db_xref="GOA:Q980C4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C4"
FT                   /protein_id="AAK40719.1"
FT                   /translation="MSHEYIIFEVINGIPLTLLSSPGIFSKKELDLGTRILLENIKVAE
FT                   NGTVADVGCGYGPIGIYLALKNPNLKVYMVDVNYIAIKLAKKNAKLNGVENRTIIVKSD
FT                   IFDNIPIDVKFTAIYSNPPLSKGVDFLKKLEAEAYDRLVEKGFIQLIAYKGEENIEKIF
FT                   SKRFKIESIKRKKGYSLITIVKD"
FT   gene            complement(342491..343246)
FT                   /gene="truB"
FT                   /locus_tag="SSO0393"
FT   CDS_pept        complement(342491..343246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="SSO0393"
FT                   /product="tRNA pseudouridine synthase subunit B (truB)"
FT                   /EC_number="4.2.1.70"
FT                   /note="It may also have a function in cell cycle, it is a
FT                   cbf5 homolog; Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40720"
FT                   /db_xref="GOA:Q980C3"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980C3"
FT                   /protein_id="AAK40720.1"
FT                   /translation="MLPIGIENATKIMNYISKGGKEYVCVMQVHCEYNKEELAKIISSF
FT                   KGEIYQRPPVRSSVKRRLRIRRIYDIEILDMDKKLVLLRVNCDSGTYMRKLCHDIGIIY
FT                   GCGAHMRELRRTRSGIFTESTNLVKLHELSEAIYLYKNCKDETELRRVLIPMEFATCEI
FT                   PKIVIEDSAVNALAYGAQLAVPGVVAYQNFKKNDTVAVLTLKGELVATGNALMDSEELE
FT                   NAKKGIVVNLSRVFMQRDIYPKAWKKHES"
FT   gene            complement(343263..343532)
FT                   /gene="truB"
FT                   /locus_tag="SSO5761"
FT   CDS_pept        complement(343263..343532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="SSO5761"
FT                   /product="tRNA pseudouridine synthase subunit A (truB)"
FT                   /EC_number="4.2.1.70"
FT                   /note="It may also have a function in cell cycle, it is a
FT                   cbf5 homolog; Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5761"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40721"
FT                   /db_xref="GOA:Q980C2"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C2"
FT                   /protein_id="AAK40721.1"
FT                   /translation="MILNDFIYKIDNFCGYKNEWKIRKDSETSDKYGYYPEKRPIEIHI
FT                   KNSIINLDKPPGPTSHEVAYWVKKMLNVTKAGHGGTLEPIHWAG"
FT   gene            complement(343538..343828)
FT                   /gene="rpl14E"
FT                   /locus_tag="SSO5763"
FT   CDS_pept        complement(343538..343828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl14E"
FT                   /locus_tag="SSO5763"
FT                   /product="LSU ribosomal protein L14E (rpl14E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5763"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40722"
FT                   /db_xref="GOA:Q980C1"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="PDB:2JOY"
FT                   /db_xref="PDB:2KDS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980C1"
FT                   /protein_id="AAK40722.1"
FT                   /translation="MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVK
FT                   RRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL"
FT   gene            complement(343869..346610)
FT                   /locus_tag="SSO0394"
FT   CDS_pept        complement(343869..346610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0394"
FT                   /product="ATP-dependent helicase"
FT                   /note="Lhr-like protein; Helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40723"
FT                   /db_xref="GOA:Q980C0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980C0"
FT                   /protein_id="AAK40723.1"
FT                   /translation="MINVTNEFLVRLKKLGYEDLTPIQKIAIPKVLSGKNVLIIAPTGY
FT                   GKTEAAILPIFYTIFKDKPEKISTLYITPLRALNRDLELRLRRLGEAFNISVNVRHGDS
FT                   SQKERKEILDNPPDVLLVTPETLLYLVLNDTFRKYFTNLKWIIIDELQEMLDEKRGIEL
FT                   SVLIQRIKKIATRNKIQLIGISATIGDVEIAKRYLDREGEVEIANINAIKDIKVDLILP
FT                   KVEKKDADLAVKLGLRPDTIARLEKLNEIIKNNKPIIIFTNTRETSEFIANQLMSNYSL
FT                   KIASHHGSLSREIRIKTENDFKNGNIDAIVATSSLELGIDIGRINLVVQYMSPRQVIRL
FT                   IQRVGRSGHKIGRTSIGYVIPSEDLFDILECRAIIEALYSGYLEKPLFEENPLDVAAHE
FT                   IAGMVLEGYKNPKEMMEILRNSFYFENFTDEMFENVIELLESAKIVKRREDGSLFPSRR
FT                   IWKYYYTTNMIPDSIRSYIVIDHATNMKIGTLDEDFVVTLDEDSVFILGSRLWKVVSIE
FT                   NDRIFVERAELKNGILPSWFGESIPVEKEIARKVYEYIYAVEKEKRETEDNSLAEVVRE
FT                   YMKRGYPELRPDLILVEIVKNNLIIVHSPFGSRGNNTLGAIISVMLDVEKQTKTTYRAD
FT                   PYHIAISSVLPITKNDMEKIVSTLNSTPIDRIIEILKKGIKESPQFKWKLLVEIKRFGM
FT                   IDPEKEITLTSSIIKAYGDTIIGEEAVKELLVKNYDVEIIKELKNYNWKIVEVYEASPL
FT                   AKQFLDKILNYTSFDKEEKPLMIEIFKKRLENKELKLICLSCGWEGKYSIINSPSKCPK
FT                   CSSIFLTATNPDDSDSVKIVRKAIKGEKLTSKERRQLEDLKRVASFFPDYGKYSLIALA
FT                   TNGVGPSNLGKVLSKLNEGENEFYMALIDEEKRFIRTRKYWH"
FT   gene            346650..348368
FT                   /locus_tag="SSO0395"
FT   CDS_pept        346650..348368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0395"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40724"
FT                   /db_xref="GOA:Q980B9"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B9"
FT                   /protein_id="AAK40724.1"
FT                   /translation="MYEKRHIVANILMLIVAYLVDNLMYYLTSAGNLSQLVNNLSTLLL
FT                   IIPILVVIFSVFITLMFSSIIVSFLYYVTAIAYALVISNNVGSTLILSTFLNLLGYYAL
FT                   ATIIIGVILGISRRSFPDEILLNVSRLNVSVNKKNAIYGGLIVLISFLIFYEVLSSPFL
FT                   FVGSIASFTLLFFISNDSIFPLIILSWFSFPFLFTQLSAYSVNEKGIELGSIEGVLAPS
FT                   LVNRISNTKYGWKKFSNLKFVLNFDGAKNYNIVILGTSGSGKSSLAKSIIGKFTDASFL
FT                   VFDLHGEYEIEKAERIDISKNSLNPLSLNGASPRQRALEVAYMLRSIFKLGNLQTIDIF
FT                   NIIMDTYAEKGIDENDESSWNLTPPTFRDVLLMIERRKKLVDNSQDLSRLSSIEPYIQF
FT                   LANQILSGNSLNMKKIFESNIILDFSKVTTDELKYVLIETILRDFRNYIYRRGISGLWK
FT                   FLVIDEAPFILSKETGLEIVERLFAEVRKFGVGMILISQLTENIENIVQNSSYIFIFNV
FT                   VEPKELDYLSRVLSGSDRDKYEAIYQAIRSLERGYVVTVSGDNRAILLVKLNSLK"
FT   gene            348369..348683
FT                   /locus_tag="SSO0396"
FT   CDS_pept        348369..348683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0396"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40725"
FT                   /db_xref="InterPro:IPR021985"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B8"
FT                   /protein_id="AAK40725.1"
FT                   /translation="MVSGMSTDEEKEGTSDEEVNEEKEVEETSEDEFPKLSIQDIELLM
FT                   RNTEIWDNLLNGKITLEEAKKLFEDNYKEYEKRDSRRKAKKAVSKKVKKTKKKEKSVEG
FT                   "
FT   gene            348688..349437
FT                   /gene="pcnA-like"
FT                   /locus_tag="SSO0397"
FT   CDS_pept        348688..349437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnA-like"
FT                   /locus_tag="SSO0397"
FT                   /product="Proliferating cell nuclear antigen putative
FT                   homolog (PCNA-like) (pcnA-like)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40726"
FT                   /db_xref="GOA:P57766"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="PDB:2HII"
FT                   /db_xref="PDB:2HIK"
FT                   /db_xref="PDB:2IO4"
FT                   /db_xref="PDB:2IX2"
FT                   /db_xref="PDB:2IZO"
FT                   /db_xref="PDB:2NTI"
FT                   /db_xref="PDB:3FDS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57766"
FT                   /protein_id="AAK40726.1"
FT                   /translation="MFKIVYPNAKDFFSFINSITNVTDSIILNFTEDGIFSRHLTEDKV
FT                   LMAIMRIPKDVLSEYSIDSPTSVKLDVSSVKKILSKASSKKATIELTETDSGLKIIIRD
FT                   EKSGAKSTIYIKAEKGQVEQLTEPKVNLAVNFTTDESVLNVIAADVTLVGEEMRISTEE
FT                   DKIKIEAGEEGKRYVAFLMKDKPLKELSIDTSASSSYSAEMFKDAVKGLRGFSAPTMVS
FT                   FGENLPMKIDVEAVSGGHMIFWIAPRL"
FT   gene            complement(349404..350543)
FT                   /gene="trzA-like"
FT                   /locus_tag="SSO0398"
FT   CDS_pept        complement(349404..350543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trzA-like"
FT                   /locus_tag="SSO0398"
FT                   /product="N-ethylammeline chlorohydrolase related protein
FT                   (trzA-like)"
FT                   /note="Close hit to N ethylammeline chlorohydrolase related
FT                   protein; Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40727"
FT                   /db_xref="GOA:Q980B7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B7"
FT                   /protein_id="AAK40727.1"
FT                   /translation="MAYGGRITLNVRIALVGEELEIRENVNIEIEEGIITHIGNGFSSE
FT                   GITFKNGILIPGIVNAHVHSADFICQEMGYNMPISKVVGDPHSVKYECFAKNTKESIMN
FT                   SIERFVLRARELGSNVMIDFREQGLEGSLISSTIKKKMATNGVKYYFLGRLEEDEFKDI
FT                   RNLNSLYKIADGYGLSSAFSTSEIELIKHVFNNKIRSVHVSETIKHWLRDDLEYVMKRY
FT                   EPNLIIHGTYLSEEEIDIMRYRKASIVYCPRSNLWFSVGIPKVINGLKSGVNLLIGTDN
FT                   GGVLDPDMWKEMETLLLISRVQDPLSDHSLQILKASTINAYKFLGIRGWIEEGNPIEAG
FT                   LLVLEGDSTGILNSNNKYIGIIKRGNKIIYNLGAIQKII"
FT   gene            complement(350522..351217)
FT                   /locus_tag="SSO0399"
FT   CDS_pept        complement(350522..351217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0399"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40728"
FT                   /db_xref="GOA:Q980B6"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980B6"
FT                   /protein_id="AAK40728.1"
FT                   /translation="MKILAIKLLDYREWTERLGYDREWLIQKIQNKFMMKIHEIASQYN
FT                   TFPLQLRFDNFLMIADGITTTQLAYMINDMQENLPVRIKSCLGYGKTPLEAQWNASICL
FT                   NNQDDNEIKEYTDEKIAALHFDINFNTETLKYTSVYDSFIEITNIYVNLSRFLYKIGGI
FT                   LQYLGGDNYLGFISTESVNKVIEEFSDDNKIKVGIGIGKNARTAIRLATTSLEKIRNNR
FT                   EKTWHMEEE"
FT   gene            complement(351214..351678)
FT                   /gene="ribH"
FT                   /locus_tag="SSO0400"
FT   CDS_pept        complement(351214..351678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SSO0400"
FT                   /product="Riboflavin synthase beta chain (6,7 dimethyl
FT                   8-ribityllumazine synthase) (DMRKL synthase) (ribH)"
FT                   /EC_number="2.5.1.9"
FT                   /note="Also close hit to riboflavin synthase beta subunit;
FT                   Cofactor Biosynthesis, Riboflavin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40729"
FT                   /db_xref="GOA:Q980B5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980B5"
FT                   /protein_id="AAK40729.1"
FT                   /translation="MQEKSIRLGIVVAEFNYDITQLMLQKALSHARFLNVEVKVVIKVP
FT                   GTFDMPLAIKKLLEKDFIDAVVTLGAVIKGETKHDELVASQTARKIVDLSTEFNKPVTL
FT                   GIIGHGATHEQAVERIEEYATRAVEAAIKLVQRTRKLDELKEIKETVIIE"
FT   gene            complement(351659..352126)
FT                   /gene="ribC"
FT                   /locus_tag="SSO0401"
FT   CDS_pept        complement(351659..352126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="SSO0401"
FT                   /product="Riboflavin synthase (ribC)"
FT                   /EC_number="2.5.1.9"
FT                   /note="Cofactor Biosynthesis, Riboflavin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40730"
FT                   /db_xref="GOA:Q980B4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B4"
FT                   /protein_id="AAK40730.1"
FT                   /translation="MTRKYGIADTTFSRVDMGSLVYKVIRSEDSEADIVRYTVPGIKDL
FT                   PVAAKRLIDEGCDGVITLGWVGKTMLDKYSYLATSIGLIMVQILTSKHVIDVTVHEDEA
FT                   DDEEKLKEIAIDRATKHAKNLVKLVKEGKNALTKYAGKGLRQGYSNAGEID"
FT   gene            complement(352123..352782)
FT                   /gene="ribA"
FT                   /locus_tag="SSO0402"
FT   CDS_pept        complement(352123..352782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="SSO0402"
FT                   /product="GTP Cyclohydrolase II (3,4-Dihydroxy-2-Butanone
FT                   4-Phosphate Synthase (DHBP synthase) (ribA)"
FT                   /EC_number="3.5.4.25"
FT                   /note="Cofactor Biosynthesis, Riboflavin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40731"
FT                   /db_xref="GOA:Q980B3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B3"
FT                   /protein_id="AAK40731.1"
FT                   /translation="MDFLSLRKDLESGIPILIYDFDGREEETDMVFYAGAISWKSIYTL
FT                   RKEAGGLICYATAINEAKTLGLNFIAEELKQHETYSKLVKKPSYGDYPAFSVWVNHVNT
FT                   KTGISDYDRYITISELHKIILKTKTNPEEARREFYENFMTPGHVPILIARDIRERRGHT
FT                   ELSITLLQKLGLERSAVIAEILDEKSSMNKDKAKMIAKNFGLHFIEGKDIFKEVII"
FT   gene            352910..353668
FT                   /locus_tag="SSO0403"
FT   CDS_pept        352910..353668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0403"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40732"
FT                   /db_xref="GOA:Q980B2"
FT                   /db_xref="InterPro:IPR009198"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B2"
FT                   /protein_id="AAK40732.1"
FT                   /translation="MSSTGYNPFNWKFVLLSQVMMILFSLVLSFFPKYFIEFYILYILV
FT                   YLGITSVIMMRSNPLLRERRSLGEIANARTLYEEKKASELVNQDEEYLKETTEVMKKNF
FT                   SSMGIMFLYMIILILVYNYVIIRFVTNIDNTLYKFGFFVLYFELLYGVSFLMNRRVLKF
FT                   QTNIPMAPTSYKITEKGIIATDRSGVFLPSKYLIDAQISQNRDKKYIEIRSSSKFPFQV
FT                   RLYSQDIDKVSELIERVKKIELKKQSSAES"
FT   gene            complement(353640..354944)
FT                   /locus_tag="SSO0404"
FT   CDS_pept        complement(353640..354944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0404"
FT                   /product="Cobyrinic acid A,C diamisynthase (CBIA)"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40733"
FT                   /db_xref="GOA:Q980B1"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980B1"
FT                   /protein_id="AAK40733.1"
FT                   /translation="MKRILLSSDRSGSGKTLITSAIMRALSKKYKVRGFKAGPDFIDPG
FT                   YHKIATGFPSINLDLWMMGKNNVKRSLAKYGKEFDIGIIEGVMGLYDGVDTLYSTYELA
FT                   KVTKTPIILIINCSNIGSTVGAIVKGLKYYRSDVSIRGVIFNKIASETHYNYCRNAVED
FT                   VEVLGYVPFDKNLEIKSRHLGLVTVEDNREVQNLIRYASELVEKYVDLDKIYEMASDED
FT                   LEIDLPEDNESNGVKRKMAIAYDPAFSFYYQENLDILKNKYELEFFSPLNNEYVEDAEA
FT                   IYIGGGYPELHLNELEKSTRTKKWLKNMSYAGVKIYAECGGLMYLSKNLIDENNKNHSM
FT                   TGIFDIDIKTKDKLTIGYTELEAVKENFIVNKNNVVRGHEFHVSKPISVNEKEFVFKVR
FT                   IGKGIINKLDGVKSNNTVASYSHLHFSNFQLRIVF"
FT   gene            355009..355788
FT                   /gene="pcnA-1"
FT                   /locus_tag="SSO0405"
FT   CDS_pept        355009..355788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnA-1"
FT                   /locus_tag="SSO0405"
FT                   /product="Proliferating cell nuclear antigen homolog (PCNA)
FT                   (pcnA-1)"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40734"
FT                   /db_xref="GOA:P57765"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="PDB:2HII"
FT                   /db_xref="PDB:2HIK"
FT                   /db_xref="PDB:2IJX"
FT                   /db_xref="PDB:2IX2"
FT                   /db_xref="PDB:2NTI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57765"
FT                   /protein_id="AAK40734.1"
FT                   /translation="MIYLKSFERNIRLINMKVVYDDVRVLKDIIQALARLVDEAVLKFK
FT                   QDSVELVALDRAHISLISVNLPREMFKEYDVNDEFKFGFNTQYLMKILKVAKRKEAIEI
FT                   ASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINLQFDISATISSDGFKSAISEVST
FT                   VTDNVVVEGHEDRILIKAEGESEVEVEFSKDTGGLQDLEFSKESKNSYSAEYLDDVLSL
FT                   TKLSDYVKISFGNQKPLQLFFNMEGGGKVTYLLAPKV"
FT   gene            355785..356777
FT                   /gene="metE-1"
FT                   /locus_tag="SSO0406"
FT   CDS_pept        355785..356777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE-1"
FT                   /locus_tag="SSO0406"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase (metE-1)"
FT                   /EC_number="2.1.1.14"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40735"
FT                   /db_xref="GOA:Q980B0"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q980B0"
FT                   /protein_id="AAK40735.1"
FT                   /translation="MIMNVKKALVGSFPKNPKLGKVISWYNTGKINKEKLEKHISENIK
FT                   KLFELAGNIKLEYTTNGLFRWDDIVDVTFGFISGTEKGPLQRFFDNNFYYRQPIIKEKI
FT                   NVKKREENSFLQDLEFSRKIKEEVSLPSKLKAVIPGPLTYYVLSDNRYYNSPIELMMDY
FT                   ASVVNSLSQELSSVVDAIEIHEPAIYTNNIKRDILEKLPEIYKSMLDNVKIEKHLITYF
FT                   EINNLKRLDTLFSLPVDYFGIDVIENLKKLGRVYTYFSSRKVYLGMLNARNTKMERITT
FT                   IIRVYNSVKRKGVSDVIIGNNTLFDFIPEVVVVKKLKLLKKLEKVEINE"
FT   gene            356770..357768
FT                   /gene="metE-2"
FT                   /locus_tag="SSO0407"
FT   CDS_pept        356770..357768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE-2"
FT                   /locus_tag="SSO0407"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase (metE-2)"
FT                   /EC_number="2.1.1.14"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40736"
FT                   /db_xref="GOA:Q980A9"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR022921"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A9"
FT                   /protein_id="AAK40736.1"
FT                   /translation="MSKLPLLPTTVIGSYPRPKWLRESIRLHKAGKMSNEDLQEAFNDA
FT                   VIAVFQDHYKAGVDVPTDGEVRRDEMVEFFAERIKGFKFYGPVRVWGTAYYRKPSVVSK
FT                   IEYREPMLVDEFTFAKSVSYTDNLKITITGPYTIAEWSYNEYYRNKKDLVFDLAKAINQ
FT                   EIKNLVEAGAKIIQIDEPALHTRKEDVSWGVEAVNEAVKGVNAKLVMHICYGDYSFVAP
FT                   YFNEIKVDQINFALKIYNYKPLELLKKYGFDKELGAGVVDVHNRKVETSEEVANDIRKI
FT                   LEYFPPEKVWINPDCGLKLLSRKIAYQKLVSMVEGTKVVREELKRKGYSVD"
FT   gene            357792..358250
FT                   /gene="rpS13E"
FT                   /locus_tag="SSO0408"
FT   CDS_pept        357792..358250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpS13E"
FT                   /locus_tag="SSO0408"
FT                   /product="SSU ribosomal protein S13E (rpS13E)"
FT                   /note="Close hits to several plant species' 40S ribosomal
FT                   protein; Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40737"
FT                   /db_xref="GOA:Q980A8"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A8"
FT                   /protein_id="AAK40737.1"
FT                   /translation="MNKRRAKGKSHSIRPARAGAPKWVRLTREEVEMLVEELAKRGYTP
FT                   SMIGIILRDQYGIPLVKQIVGKKVTQILEERGLAPQIPEDLFNLIRKAVNVRRHINEYP
FT                   RDKTAKKGLEEIESKIRRLTRYYKGIGKLPQEWVYDPAKAELLVAGAS"
FT   gene            complement(358247..358633)
FT                   /locus_tag="SSO0410"
FT   CDS_pept        complement(358247..358633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0410"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with MJ0970, MTH1397."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40738"
FT                   /db_xref="GOA:Q980A7"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR023652"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A7"
FT                   /protein_id="AAK40738.1"
FT                   /translation="MLGVLLVLHGSKIPEWKDVGIKYAEYLSKYFSLVEFGFLEFNKPT
FT                   LSEALSNLLAKGADKIVVVPLLFATGTHFRRDIPRLLGIDNDEKKIRYMGREIEITIAD
FT                   PLGFDEKIGEVLVKRVNETYNKNY"
FT   gene            358711..359355
FT                   /gene="rps6E"
FT                   /locus_tag="SSO0411"
FT   CDS_pept        358711..359355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps6E"
FT                   /locus_tag="SSO0411"
FT                   /product="SSU ribosomal protein S6E (rps6E)"
FT                   /note="Hit to one end of protein, other domains not
FT                   recognized; Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40739"
FT                   /db_xref="GOA:Q980A6"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A6"
FT                   /protein_id="AAK40739.1"
FT                   /translation="MPDFKIVISDPQSVEPKRIKVKVKASDQVKSITGEKDGKAVPQAK
FT                   VNEKTKQLLNVDTLLTLEITKQEGDKKVKVKGHFKVDVDNSVPDNEVWISKTMAEKFGA
FT                   EDFEAFAYRTKTLQISVDQNKATNLVGLKIGDVFEANQLIGLPVKLKITGGSDNSGFPM
FT                   RFDVIGAAKRKILLSGPPGFYPNENGERRRKTIRGNTISQEIVQINTIIVR"
FT   gene            359364..360611
FT                   /gene="eif2G"
FT                   /locus_tag="SSO0412"
FT   CDS_pept        359364..360611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eif2G"
FT                   /locus_tag="SSO0412"
FT                   /product="Translation initiation factor eiF 2 gamma
FT                   (eif2G)"
FT                   /note="Translation, Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40740"
FT                   /db_xref="GOA:Q980A5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2AHO"
FT                   /db_xref="PDB:2PLF"
FT                   /db_xref="PDB:2PMD"
FT                   /db_xref="PDB:2QMU"
FT                   /db_xref="PDB:2QN6"
FT                   /db_xref="PDB:3CW2"
FT                   /db_xref="PDB:3I1F"
FT                   /db_xref="PDB:3PEN"
FT                   /db_xref="PDB:3QSY"
FT                   /db_xref="PDB:3SJZ"
FT                   /db_xref="PDB:3V11"
FT                   /db_xref="PDB:4M0L"
FT                   /db_xref="PDB:4M2L"
FT                   /db_xref="PDB:4M4S"
FT                   /db_xref="PDB:4M53"
FT                   /db_xref="PDB:4NBS"
FT                   /db_xref="PDB:4QFM"
FT                   /db_xref="PDB:4QHY"
FT                   /db_xref="PDB:4RCY"
FT                   /db_xref="PDB:4RCZ"
FT                   /db_xref="PDB:4RD0"
FT                   /db_xref="PDB:4RD1"
FT                   /db_xref="PDB:4RD2"
FT                   /db_xref="PDB:4RD3"
FT                   /db_xref="PDB:4RD4"
FT                   /db_xref="PDB:4RD6"
FT                   /db_xref="PDB:4RJL"
FT                   /db_xref="PDB:5DSZ"
FT                   /db_xref="PDB:5JB3"
FT                   /db_xref="PDB:5JBH"
FT                   /db_xref="PDB:6H6K"
FT                   /db_xref="PDB:6I5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A5"
FT                   /protein_id="AAK40740.1"
FT                   /translation="MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGM
FT                   TIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATM
FT                   LSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQY
FT                   RQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFD
FT                   VNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRF
FT                   GDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVV
FT                   GAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISR
FT                   QIAGRWRMIGWGLVEI"
FT   gene            360575..361012
FT                   /locus_tag="SSO0414"
FT   CDS_pept        360575..361012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0414"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40741"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:Q980A4"
FT                   /protein_id="AAK40741.1"
FT                   /translation="MENDRMGFSRDLKVLVDTNILLYVYDGLDPFNKVLEFLDYKPSFF
FT                   IHSTVLRELDILFEKNKKGFIISSRIKIARKYLEVYKNLWNLINDYDDLPTDEALIRTA
FT                   LKHNMFIFTNDKELKNDAIKKGIGVLFLQNRSKIIKSLYPI"
FT   gene            361016..361558
FT                   /gene="rpoE1"
FT                   /locus_tag="SSO0415"
FT   CDS_pept        361016..361558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE1"
FT                   /locus_tag="SSO0415"
FT                   /product="DNA-directed RNA polymerase, subunit E' (rpoE1)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40742"
FT                   /db_xref="GOA:Q980A3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q980A3"
FT                   /protein_id="AAK40742.1"
FT                   /translation="MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLV
FT                   LAILNVKTSEEGILVFGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGIFVNLGPM
FT                   DGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASTVTGRLPRIALT
FT                   MRQPYLGKLEWITQTKK"
FT   gene            361565..361765
FT                   /gene="rpoE2"
FT                   /locus_tag="SSO5798"
FT   CDS_pept        361565..361765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE2"
FT                   /locus_tag="SSO5798"
FT                   /product="DNA-directed RNA polymerase, subunit E'' (rpoE2)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5798"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40743"
FT                   /db_xref="GOA:Q980A2"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:Q980A2"
FT                   /protein_id="AAK40743.1"
FT                   /translation="MAKKSVFKACKNCKALVDTDKETCPVCGSTSFTDEWDGMIIIINS
FT                   ESEIAKITEAPKPWKYAIIIK"
FT   gene            361738..362277
FT                   /locus_tag="SSO0416"
FT   CDS_pept        361738..362277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0416"
FT                   /product="Conserved hypothetical protein"
FT                   /note="A.fulgidus homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40744"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A1"
FT                   /protein_id="AAK40744.1"
FT                   /translation="MEVRNNNKVNLCFSFDNLRNELSRPYGILFINNKIFLEFISKSIQ
FT                   RGSRIITVGDYVSRVLEENGIVPFLEVIDGKTKRTITQNRAITRNKEYKVTNEAGKIRF
FT                   EIFEIMENILKDREGGVVFVDGEEDLLVIPVTLSANHGDIVIYGQPNAGAVVIIVNEMI
FT                   RWRVRDILEKAIVKEC"
FT   gene            complement(362362..363606)
FT                   /locus_tag="SSO0417"
FT   CDS_pept        complement(362362..363606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0417"
FT                   /product="Phosphonopyruvate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40745"
FT                   /db_xref="GOA:Q980A0"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q980A0"
FT                   /protein_id="AAK40745.1"
FT                   /translation="MKQYKILLIVADGLGDRPVSKLNGLTPLEAANKPAITDLLKNSMI
FT                   GLMDPISPGIIPGSDTSHLSIFGLDPHVYYRGRGAFEALGAGATLSHGDVAFRGNFATV
FT                   NNDLVVVDRRAGRKLEEGEQLVKELNEKIKEINDVKIKFYKGTEHRIAVVLSGKGISDK
FT                   VSDTDPHHEGLKVLESKPLEDSNEAIRTAEIINILTRKVFDVLNSSEINKRRIEQGEKP
FT                   ANIVLLRGAAHYVKLPPFSSYTKLKAAAVSATALIKGICRELGMNVITPSGATGGIDTN
FT                   YNAKAKAAIELLKENDFVFLHIKATDAASHDGLVEEKVKAIERIDRVIGAIIDNIGRDN
FT                   LILMFTGDHVTPVEIKEHTGDPVPVLLYVPYPIINDNVGDFNEKEARKGSLRIRGLDVT
FT                   NILLNYSNRAEKYGS"
FT   gene            complement(363603..365912)
FT                   /locus_tag="SSO0421"
FT   CDS_pept        complement(363603..365912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0421"
FT                   /product="AAA family ATPase"
FT                   /note="Similar to confirmed SAV protein (S.
FT                   acidocaldarius); Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40746"
FT                   /db_xref="GOA:Q97ZZ9"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ9"
FT                   /protein_id="AAK40746.1"
FT                   /translation="MSTSQSRIVLMSKTYFKRFGKMNNMSQQLKLRVVEARQRDVGRKV
FT                   ARITDYTISRLGIENGDYVEIIGPSGSALAQALIGDGIADNEIRVDGYIRRSIGVGIGD
FT                   EVTVKRAQVQDATKVVLAPTQPISFSQSFVEYVKDWLMDKPISRGETISVPTYVGSIDF
FT                   VVVSTQPSQSVRITGRTSLEIRQEPVKESAAVPKVTWEDIGDLEDVKEKIREIVELPMR
FT                   HPEVFQHLGIEPPKGVLLYGPPGVGKTLLARALANEIGAYFTSINGPEIMSKFYGESEQ
FT                   RLREIFEEAEKNSPAIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGIKGRGKVIV
FT                   IGATNRPDAVDPALRRPGRFDREIEIRPPDAKARKEILQVHTRNMPLAEDVDLDKISEQ
FT                   THGYTGADLAALAREAAMNALRRFINERKINLEQEQIPVDVLKELKVTMQDFIDAMKFI
FT                   QPTLLREVYVEVPKVKWEDIGGLEEAKQQLREAVEWPLKFPEMFEKLGIRPPKGILLFG
FT                   PPGTGKTMLAKAVATESGANFIAVRGPEILSKWVGESEKAVREIFRRARQTAPCVIFFD
FT                   EIDSIAPMRGFTHDSGVTERIVNQLLSEMDGIQSLNRVVVIAATNRPDILDPALLRPGR
FT                   FDRLIYVPPPDEKARIEILKIYTRTLPIDSSVNLEELAKKLEGYTGADIEALARETTMK
FT                   VLRQKYYDCLNKAKKECKDQECTDKTIKSCMSNLEIKITMQDFLDTMKIVTPSLTKADI
FT                   MRYENMVKEIKRSVIG"
FT   gene            365906..369634
FT                   /gene="topR-1"
FT                   /locus_tag="SSO0420"
FT   CDS_pept        365906..369634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topR-1"
FT                   /locus_tag="SSO0420"
FT                   /product="Reverse gyrase (topR-1)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to confirmed topR gene (Sulfolobus
FT                   acidocaldarius); Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40747"
FT                   /db_xref="GOA:Q97ZZ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034142"
FT                   /db_xref="InterPro:IPR040569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZZ8"
FT                   /protein_id="AAK40747.1"
FT                   /translation="MTSINKVPPSIYTRSCPNCGGNISSQRLFNGSVCESCLKDDREFS
FT                   NLSDLINILSENSNLKNLTQIRDVLEEYKKVEEIFGKLLNNSKPIGPQRSWTIRFLRGE
FT                   SFAIIAPPGLGKTTFGLIMSLYNATRNRKSIIIFPTRTLISQTVDKLAKFSELYSYSPR
FT                   ILYNKQSPTQTENILDQLKSGNFDIFISTNRFVIQNLSELSNIKFDFIFVDDVDAALKS
FT                   GKSAKAILRLVGFTDEDIQTTMKLLRENIGEEEKFGKIQEIRESRLKDKIVIFSSATIS
FT                   RGNPILSSLMGFRPGSSVIYLRNIYDSYIDLTQTCKGQDFEECTLGTVIKLLKRLNDGT
FT                   LIFVPIDKGAQYADYLASNLRDHGINVESVASSSISKLEKFERGEVSSLVGVATHYGVL
FT                   VRGIDLPWRVKYSIFVGIPKFKFKIGEYMHPLALTRLLSLVYLVKNDDKVRGLLSYIRK
FT                   RLRKISPAALAMLAKDIREGKIDDERLKEAYNLVNEYLKDNEFLKKVSDVGDLVIEGDY
FT                   ILMPDYLTYIQASGRTSRLYGANLTTGLSVLLIDNSRLFELLNKKLNLILDEVKWYSLD
FT                   IDADKLGQVSLSDISAKITEERESLSKIKKEGNVESSSLSVKTTLFIVESPNKAKTISN
FT                   FFSRPSTRSYGKLRVYETVLGDRVLIVAASGGHIYDLITEDESEKQDDNYVYGVLVKDS
FT                   KFIPIYSTIKKCEKGHQIVKDLSQNKCPICGSRIVTDKTEVVDILRKLALEVDEVLIGT
FT                   DPDTEGEKIAWDIYLAIRPFNGNIKRAEFHEVTRRAILNAIKNPREFNDNLVKSQIVRR
FT                   IEDRWIGFKLSRKLQTEFWEQHCTSISKKNSKDEECKENRNLSAGRVQTPVLDWVVNRY
FT                   QKYNENKKKYLIIESQDKSIFPFSVLALKKNGLSKNTQIIIHLEDINIKEEEFGPLPPY
FT                   TTDTLLSDAANLLRIPASDTMRVAQDLFELGLITYHRTDSTRVSNVGISVAETYLKSKQ
FT                   VDISKIFRPRSWGEGGAHEAIRPTKPLDETMLKASIEQGDLELSKQLTFNHFRVYNLIF
FT                   RRFITSQLPPLVVTKQIVRIRAYTKDNIELELDENKKEFVIGYKLKEGDEFRQTLQDAI
FT                   YTLFRLYQPLDEKMKGKELSATITGTLNKSDVQLYTEGELISEMKSKQIGRPSTYAVII
FT                   STLKKRRYIIESKNLKKIIPTKLGMAVKEYLMENYKQIVSEKRTVKLLEKMNEVEEGKV
FT                   DYLVLLKELYNEIQTIS"
FT   gene            369637..370518
FT                   /locus_tag="SSO0422"
FT   CDS_pept        369637..370518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0422"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APE1343. Possibly a nitrilase."
FT                   /db_xref="EnsemblGenomes-Gn:SSO0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40748"
FT                   /db_xref="GOA:Q97ZZ7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ7"
FT                   /protein_id="AAK40748.1"
FT                   /translation="MVKKFMLIALVHLRLKELSRKHNLEKAKKLIRQAKDKGAKLVILP
FT                   SLFPSGNMFEIYDNDKKLRSFIKNLAEKIPGNNTDTLINLAMDGEVHVIVGPILEQAGP
FT                   KIFLTSLIISPQGEIIGKYRKTVLSEKDIRLGISAGKEPVNVVLDRKYGIIAEDDIFSP
FT                   EISRLLAMGGSEIVIGTMKALGKEQQVIKHLAIARTIENGIPYLIVGESIEDEEGEIIG
FT                   YSPTFITSPDNLISKEAEEDDSLLFVESSILSSSKQTSLTYLEPIINGLCKGVKKIKGE
FT                   AKKRSASTMEEE"
FT   gene            complement(370522..370854)
FT                   /gene="rps25E"
FT                   /locus_tag="SSO0425"
FT   CDS_pept        complement(370522..370854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps25E"
FT                   /locus_tag="SSO0425"
FT                   /product="SSU ribosomal protein S25E (rps25E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40749"
FT                   /db_xref="GOA:Q97ZZ6"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZZ6"
FT                   /protein_id="AAK40749.1"
FT                   /translation="MGGASKKPISTMEKRLKKEAEKQQKAEEKKKGPSKTGKEIISRAV
FT                   TIDEETKKKVLDEIKKESIITPYALATKSGISISVARKILKELENQNVVKLYSKNRRLE
FT                   IYIAAS"
FT   gene            370903..371634
FT                   /locus_tag="SSO0426"
FT   CDS_pept        370903..371634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0426"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40750"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ5"
FT                   /protein_id="AAK40750.1"
FT                   /translation="MSSELLEETISRVSKFASIFGISKSELKVYSYLLIYGRATAREVS
FT                   NKLSLPYTKVYNVLSKLEGRGWVIKIDKRPAVYEAIPLRDVWNKIKITFQEKLDEFEKQ
FT                   FIEPISSIFSSNMAYNIVVIPRDNIMDNALRLLKDYSKMYLVAISYQEFVRSDIIDILR
FT                   ANSLKAETKIIVDKSVNLPDISSAQVKRAQSLFGSGIITSDSILLVIKNNDILTGLFSN
FT                   HKYLIDIGTVYFNHLWSTLPG"
FT   gene            371678..371830
FT                   /locus_tag="SSO5826"
FT   CDS_pept        371678..371830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5826"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APES055, PHs024, MJ0549"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5826"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40751"
FT                   /db_xref="GOA:Q97ZZ4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ4"
FT                   /protein_id="AAK40751.1"
FT                   /translation="MKIITVKLPEQFLEAIDELVNTGRYGSRSEVIRAAIGDFIRKELW
FT                   ITTEE"
FT   gene            371931..372701
FT                   /locus_tag="SSO0427"
FT   CDS_pept        371931..372701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0427"
FT                   /product="Protein L-isoaspartate methyltransferase"
FT                   /note="Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40752"
FT                   /db_xref="GOA:Q97ZZ3"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ3"
FT                   /protein_id="AAK40752.1"
FT                   /translation="MMPLNEGDPVVIWIDPKRVYISKLERGKRLDTDKGVVFYDNLIGL
FT                   EYGTSLTLKTGVKAYLLKPTIQDLYSKGLKRPSQVLYPKDIGYILTTLSLNQVKTVIEA
FT                   GTGSGFLTISLALSLSENAKIYTYDIREDMQKVAKFNANVLGVQDRIVFKLKDIREGID
FT                   EKEVDAIFLDMPDPWNAIPKLYESLKPSSTIIIFVPTVNQIEKTYFAMKNSGIIDIHVE
FT                   ELILREYQVKENAIRPRNIGIMHTGFIIRGRKSI"
FT   gene            372723..373058
FT                   /locus_tag="SSO0428"
FT   CDS_pept        372723..373058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0428"
FT                   /product="Hypothetical protein"
FT                   /note="One domain may have homology to hsp90"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y8K9"
FT                   /protein_id="AAK40753.1"
FT                   /translation="MMSEVKFNAYSKAIMEFEDEIKRIKKEIADDSKRLITLSDSYLSE
FT                   LRATAEKSLGDVQKLLNDEKKRQLDEIRNKYISEREKQLEEIRKEAEKNIDKVVNEVIR
FT                   QLLGVFK"
FT   gene            373055..374035
FT                   /locus_tag="SSO0429"
FT   CDS_pept        373055..374035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0429"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40754"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ2"
FT                   /protein_id="AAK40754.1"
FT                   /translation="MSYAIYSFIHSISRTQKVSLLTKGLVNELISSESWNNVASLLKER
FT                   GIIEEQPASLEDFEYMLKSRSLTLLEKIRNYFSIFRVTYNIVDLYIYMISLDELKNIIV
FT                   SIVNGTGNGNSNKIRFFRKYFDQIPSSLEELMNSFKGNVYANALSYAIKDGQGKNISYL
FT                   LSLLDIYFIKKLSEIIEGFKGDWKSLAENIICYYKDYYSISLAIKHKTVENTVCKIGTE
FT                   ILKDLSSSTSDAETLDILRRTQYSKLLNVNSTYGALASMYRIARINARKNSELVFMSSP
FT                   FNPALALALAELIRLDTEDIISIANAKSLRLKEEKIKNMLSFEII"
FT   gene            374318..375382
FT                   /locus_tag="SSO0430"
FT   CDS_pept        374318..375382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0430"
FT                   /product="Oxidoreductase"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40755"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZZ1"
FT                   /protein_id="AAK40755.1"
FT                   /translation="MLFVYLNSHNYHLYFYYLKCNDNNGRYYMLYRRIGDTNITVSEIG
FT                   IGVWSLVTDWWGADTNKAEDIIRRAYEVGINFYDTADTYGEGKGEEIIAKVLETKRDNI
FT                   VILTKIGYDFYHKEGGKIRQRFDIPYLEFALKRSLERLRTDYIDILMIHNPKMNAIKNL
FT                   EILSFLRSLKKDGIIRMYGVALGPTLGWEEEGIEAINMGYESLEYIYNIIEQRPGNKFL
FT                   KYEKVGHIIRVPHASDVLNEDKWPLISDPKLHRSLKDIKWLNEGIKRSLKLKEFASSKG
FT                   MTLSDLALKFILSNKNVSTVIPNITSINELEKYVKVENLSILTEDDLKYIGEYYRKYYE
FT                   DLNEDSIKETLRYK"
FT   gene            complement(375411..375989)
FT                   /locus_tag="SSO0432"
FT   CDS_pept        complement(375411..375989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0432"
FT                   /product="HAM1 protein"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40756"
FT                   /db_xref="GOA:Q97ZZ0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZZ0"
FT                   /protein_id="AAK40756.1"
FT                   /translation="MLRRGVKIGVLTNNENKFIELKEIAKNFNIELEHLRGEKIEIQSD
FT                   DLEEISRTAANLAYLIFRRPLIVDDSGLFVQALQNFPGPYTNFVKNTIGLKGILKLLEG
FT                   IKDRSAYFMTALTFTDGKIIKTFIGIVKGAISEEIRGNLGFGFDPIFIPEGEKRTFAEM
FT                   SLEEKNRYSHRARAFAKFAEFLESYTEKE"
FT   gene            complement(375949..376620)
FT                   /locus_tag="SSO0433"
FT   CDS_pept        complement(375949..376620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0433"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40757"
FT                   /db_xref="GOA:Q97ZY9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZY9"
FT                   /protein_id="AAK40757.1"
FT                   /translation="MEKLRLIKRGAESNIYEGYFLGIHAIFKQRIKKSYRNPELDHKIN
FT                   YERTILEAKIIYTALKNDVNVPAVLFIDPNNYLLVIEYIEGEIVKDIINTNNPTQLLPN
FT                   IGKRIGELTGKLHNIGIAHGDLTTNNLILSSTNDDIFIIDFGLSRRTQDEEDFATDLHV
FT                   FLRSLESVHSDFKDIIYDAFIEGYRKIMGRKTDEILELVKDIRMRGRYVEERRKNRSIN
FT                   E"
FT   gene            complement(376608..377348)
FT                   /locus_tag="SSO0434"
FT   CDS_pept        complement(376608..377348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0434"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40758"
FT                   /db_xref="GOA:Q97ZY8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZY8"
FT                   /protein_id="AAK40758.1"
FT                   /translation="MRVGATLARAIALKYNKKLVPVNHGIGHIEIGYLTTEARDPLILY
FT                   LSGGNTIITTFYKGRFRVFGETLDIALGNMMDVFVREVSLAPPYIINGIHVIDICAEKG
FT                   NKLLKLPYVVKGQDMSFSGLLTAALRVVGKEKLEDICYSVREIAFDMLLEATERALALT
FT                   SKKELMIVGGVAASVSLRKKLEELGKEWNVQIKIVPPEFAGDNGAMIAYAGMLAASKGV
FT                   FIDVDKSYIRPRWRVDEVDIPWRN"
FT   gene            complement(377589..377816)
FT                   /gene="rps27AE"
FT                   /locus_tag="SSO5844"
FT   CDS_pept        complement(377589..377816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps27AE"
FT                   /locus_tag="SSO5844"
FT                   /product="SSU ribosomal protein S27AE (rps27AE)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5844"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40759"
FT                   /db_xref="GOA:Q97ZY7"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZY7"
FT                   /protein_id="AAK40759.1"
FT                   /translation="MLELNKRKEEAKVAKEQKVKAIVRTYYVIEGNKVKLKNKKCPRCG
FT                   SIMAHHLKPNERWSCGKCGYTEFIGASKKR"
FT   gene            complement(377758..378120)
FT                   /gene="rps24E"
FT                   /locus_tag="SSO0435"
FT   CDS_pept        complement(377758..378120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps24E"
FT                   /locus_tag="SSO0435"
FT                   /product="SSU ribosomal protein S24E (rps24E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40760"
FT                   /db_xref="GOA:Q97ZY6"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZY6"
FT                   /protein_id="AAK40760.1"
FT                   /translation="MESQAKVKISDKAEGIIERDMQNSVIGRREISLKVYHMGSGTPSR
FT                   KDIIKAIIQALGSQENLVVVRKISTSYGAGISNVKLHIYKSREILEKVEPKYLLDRDAG
FT                   TKQKKGGSKGGQGAKG"
FT   gene            complement(378187..378990)
FT                   /locus_tag="SSO0436"
FT   CDS_pept        complement(378187..378990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0436"
FT                   /product="Thiazole biosynthetic enzyme"
FT                   /note="Also good number of matches to Eukaryota Thiamine
FT                   Biosynthetic enzyme; Cofactor Biosynthesis, Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40761"
FT                   /db_xref="GOA:Q97ZY5"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZY5"
FT                   /protein_id="AAK40761.1"
FT                   /translation="MEVKIKQVDEVKISRYIIKETMEDWYQFVESDVVIVGAGPSGLSA
FT                   AYYLAKAGLKTLVFERRLSFGGGIGGGAMLFHKLIIEKPADEILREVNIRLKEVEEGVY
FT                   VVDSAEFMAKLATAAIDAGAKIIHGVTVDDVIFRENPLRVAGVAVEWTATQMASLHVDP
FT                   IFISAKAVVDATGHDAEVISVAARKIPELGIVIPGEKSAYSERAEELTVINTGKVAEGL
FT                   YATGMAVTEVKGLPRMGPIFGAMVLSGKAVAGEITKDLLKSEIRA"
FT   gene            379208..379837
FT                   /locus_tag="SSO0437"
FT   CDS_pept        379208..379837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0437"
FT                   /product="3-octaprenyl-4-hydroxybenzoate decarboxylase"
FT                   /note="Very close hit to phenylacrylic acid decarboxylase
FT                   as well; Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40762"
FT                   /db_xref="GOA:Q9Y8K8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y8K8"
FT                   /protein_id="AAK40762.1"
FT                   /translation="MLSTMVSGMVKEAGTKNRREKTKRIIIGISGASGTIYGIRTVQFL
FT                   NELGYEIHIIISKSAEKVAQKELGINLINELKKYSSYIYNQSQIEASPSSSSFSITSKG
FT                   MIIIPCSIKTLAEIANGIGSNLLSRTALNFIRTNKRLVLVIRETPLGAIELENALKLAR
FT                   LGVYIMPASPAFYILPKNIDDMINFIVGKALDLLGIKHDIYKRWKG"
FT   gene            complement(380199..380588)
FT                   /locus_tag="SSO0438"
FT   CDS_pept        complement(380199..380588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0438"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40763"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZY4"
FT                   /protein_id="AAK40763.1"
FT                   /translation="MRNGNRGFERQPSFTDEQKPMPLGDKCNYLCPYFRCNKRALLVQV
FT                   KYAKGNPYKVGYCRWVGDVCITGECQYAYCEKRALLPGNKCAFAINKKNERDNEIEKEL
FT                   EKEDYDDKMKEIISKKFGKKGLDVL"
FT   gene            complement(380629..381177)
FT                   /locus_tag="SSO0439"
FT   CDS_pept        complement(380629..381177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0439"
FT                   /product="tRNA intron endonuclease, putative"
FT                   /EC_number="4.6.1.16"
FT                   /note="M.jannaschii homolog; Translation, Translation
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40764"
FT                   /db_xref="GOA:Q97ZY3"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZY3"
FT                   /protein_id="AAK40764.1"
FT                   /translation="MVKALLVGSKVLVPSIDESRYLYSNGFYGKPIGISKPKGPKDIVR
FT                   PLELSLIESVYLTKKGLINVVDKNGDLLEYKKLYEYSAMKINKFEILYKVYEDLREKGF
FT                   IVRSGVKYGADFAVYTLGPGLEHAPYVVIAVDIDEEITPHELLSFGRVSHSTKKRLVLA
FT                   LVDRKSEGIRYIMFKWVKM"
FT   gene            complement(381178..381825)
FT                   /locus_tag="SSO0440"
FT   CDS_pept        complement(381178..381825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0440"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40765"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZY2"
FT                   /protein_id="AAK40765.1"
FT                   /translation="MGEGIATLAIEEQLQQISLKLLDETRVLYEFLSNTSNSNVNAMQI
FT                   YSKVNGIKNDIEVSKYRLGEYIFKIREGLLDKDLYVEILNNLEKVSQNLDAATYRLSVI
FT                   LSKQMNIDNVINRLLIVICEKIITSITYFIEALRLLSVNPKNSYENARNVIKLEQEIDE
FT                   LYRSLELALFEKKLADFSYIMLLKDIADRLEDSEDLLKSSADNITYIAYERM"
FT   gene            complement(381851..382255)
FT                   /locus_tag="SSO0441"
FT   CDS_pept        complement(381851..382255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40766"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZY1"
FT                   /protein_id="AAK40766.1"
FT                   /translation="MNESDMVISRVLFDFETIINDHTEYLNELENLVAFPNPDIGKATR
FT                   LVRRMRRVRKELFQGLEVIIQNIDKTTDNQIKEEALGLVNYLVIVGLKDEKELLNNLNN
FT                   YLKGKGVNIEIDKDLEQIEKIMNSVSHLNF"
FT   gene            complement(382252..382617)
FT                   /locus_tag="SSO0442"
FT   CDS_pept        complement(382252..382617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0442"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40767"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZY0"
FT                   /protein_id="AAK40767.1"
FT                   /translation="MIVMSSNENEKEEEKKVDIKTLVSVIPPASALKGNKAPPKEKRIK
FT                   IRKRNDVDKGFAIISSKLAKDLGITDNIEISVKGKRIRLKAILQEGIPELEVWANPQDL
FT                   VTLGIEDNSTVTARAYK"
FT   gene            complement(382601..384325)
FT                   /gene="glyS"
FT                   /locus_tag="SSO0444"
FT   CDS_pept        complement(382601..384325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SSO0444"
FT                   /product="Glycyl-tRNA synthetase (glyS)"
FT                   /EC_number="6.1.1.14"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40768"
FT                   /db_xref="GOA:Q97ZX9"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX9"
FT                   /protein_id="AAK40768.1"
FT                   /translation="MSEVIDKVLDLAKRRGIFWLSYEIYGGVAGFYDIGPVGVRIKNRI
FT                   VELWRKYFVKDNGDFVVEIESPMIGPAKVFEASGHVESFTDPIVECNNCKRIYRADHLI
FT                   EDILKKSVEGLKPEELTRIIKENNIRCQYCGGELGEVRLFNLLFTTNIGPYTGNLGYIR
FT                   PETAQGMFTAFKRVYEATRQRLPIGIAQIGKVGRNEISPRQGLIRMREFTIMEIEFFID
FT                   PEDNNIENIPLYRFKDTKLNILTASEKEKDGKPQEFKLEESVREKIIIQPWMAYWMAVA
FT                   SSFVKALGINEFYFEEKLPYERAHYSKQTFDQIAVINGIKVEISGHAYRGDYDLSRHMK
FT                   YSGQDLTIFRKYKEPKMIKKKTVIVNNTKLKDKELRKKIMELLNGKSAEEIEQMIRNNV
FT                   MIDDKPLSEFINIVEREEKVHGEHFIPHVVEPSFGVERTLFLTILSAYKEKEGRVLLSL
FT                   PRHLAPYDIAVFPLLEREELIRKSVEIRESLSEKYEVLYDDSGSIGRRYARADEIGIPF
FT                   AITVDPQTLVDNSVTIRDRDSWKQVRVKIDDLKISLEKLFRGEAFNKIGIEVNDSNE"
FT   gene            384378..385271
FT                   /gene="speB-1"
FT                   /locus_tag="SSO0445"
FT   CDS_pept        384378..385271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB-1"
FT                   /locus_tag="SSO0445"
FT                   /product="Agmatinase (agmatine ureohydrolase) (speB-1)"
FT                   /EC_number="3.5.3.11"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40769"
FT                   /db_xref="GOA:Q97ZX8"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX8"
FT                   /protein_id="AAK40769.1"
FT                   /translation="MSDGRLLYLNENSRKFAGFNKEKSPFVIIGIPMDITSSYRPGSRF
FT                   APSSIRESAQYIEFYSIRNDVDMGEIGFNDVGDIILHPSNVEENLSRISSVISYFQESG
FT                   KITISIGGEHTITAGIIKGTKREGLCLVSFDAHLDLRDEYMGYRYDHACVMRRISEYGV
FT                   KIIEVGTRAVSKEEIEYAKQKGILFFTPQQIRLLGVKETARRIITSTQECKSLYISVDM
FT                   DGIDPAYAPGVATPEPDGLDPTNLLDIINLIADKRVIGFDIVEVSPSYDTSGITSVLAS
FT                   RIILETAATVYKARSL"
FT   gene            complement(385258..385404)
FT                   /gene="rpoP"
FT                   /locus_tag="SSO5865"
FT   CDS_pept        complement(385258..385404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoP"
FT                   /locus_tag="SSO5865"
FT                   /product="DNA-directed RNA polymerase, subunit P (rpoP)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Conserved . Similarity with PAB3072, PHs056,
FT                   Vng0237h; Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5865"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40770"
FT                   /db_xref="GOA:Q97ZX7"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR023464"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="PDB:2PMZ"
FT                   /db_xref="PDB:3HKZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZX7"
FT                   /protein_id="AAK40770.1"
FT                   /translation="MAVYRCGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIV
FT                   KAI"
FT   gene            385500..385661
FT                   /locus_tag="SSO5866"
FT   CDS_pept        385500..385661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5866"
FT                   /product="Protein translation factor SUI1 homolog"
FT                   /note="Possibly a fragment. The protein represents only
FT                   amino-end of other homologs; Translation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5866"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40771"
FT                   /db_xref="GOA:Q97ZX6"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX6"
FT                   /protein_id="AAK40771.1"
FT                   /translation="MAENLCGGLPPDICEQLSKEEQFIKIKVEKRRYGKEVTIIEGIRE
FT                   VMILNLKK"
FT   gene            complement(385794..386723)
FT                   /gene="TFB-1"
FT                   /locus_tag="SSO0446"
FT   CDS_pept        complement(385794..386723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TFB-1"
FT                   /locus_tag="SSO0446"
FT                   /product="Transcription initiation factor IIB (TFIIB)
FT                   homolog (TFB-1)"
FT                   /note="Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40772"
FT                   /db_xref="GOA:P58111"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58111"
FT                   /protein_id="AAK40772.1"
FT                   /translation="MLYLSEENKSVSTPCPPDKIIFDAERGEYICSETGEVLEDKIIDQ
FT                   GPEWRAFTPEEKEKRSRVGGPLNNTIHDRGLSTLIDWKDKDAMGRTLDPKRRLEALRWR
FT                   KWQIRARIQSSIDRNLAQAMNELERIGNLLNLPKSVKDEAALIYRKAVEKGLVRGRSIE
FT                   SVVAAAIYAACRRMKLARTLDEIAQYTKANRKEVARCYRLLLRELDVSVPVSDPKDYVT
FT                   RIANLLGLSGAVMKTAAEIIDKAKGSGLTAGKDPAGLAAAAIYIASLLHDERRTQKEIA
FT                   QVAGVTEVTVRNRYKELTQELKISIPTQ"
FT   gene            386883..386955
FT                   /locus_tag="SSOt23"
FT   tRNA            386883..386955
FT                   /locus_tag="SSOt23"
FT                   /product="tRNA-Gln"
FT   gene            387197..387272
FT                   /locus_tag="SSOt24"
FT   tRNA            387197..387272
FT                   /locus_tag="SSOt24"
FT                   /product="tRNA-Gly"
FT   gene            387452..388036
FT                   /locus_tag="SSO0447"
FT   CDS_pept        387452..388036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0447"
FT                   /product="Hypothetical protein"
FT                   /note="Some homology to bacterio opsin activator"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40773"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX5"
FT                   /protein_id="AAK40773.1"
FT                   /translation="MLLYVVIKTPNLLQFPEFIPKKVTVNILDIRVDGEKGKLLLEIRG
FT                   DETSAKQVCEEPIKVSKYKFICTNYISSELLKILSQYTIMNGALTDDGIFWTLILNGYT
FT                   ELRELLNSLIDITKEVRVLKVVKAEKKDAITARQEQILRIALEAGFFDYPRRIGLKDLA
FT                   KKLNISPSSLSEIIRRAEKNVITAYFEEREL"
FT   gene            388033..389013
FT                   /gene="hisC-like"
FT                   /locus_tag="SSO0448"
FT   CDS_pept        388033..389013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC-like"
FT                   /locus_tag="SSO0448"
FT                   /product="Histidinol-phosphate aminotransferase, putative
FT                   (hisC-like)"
FT                   /EC_number="2.6.1.9"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40774"
FT                   /db_xref="GOA:Q97ZX4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX4"
FT                   /protein_id="AAK40774.1"
FT                   /translation="MKHGGYPWKNGKPALDVKDFSVNLNPMGVPKFIEELINEAVKLKV
FT                   YAYYPPQNLREIKGIIAEIYGVNEDLVGVFNGASEVISILDENFTVPQPNYSEYKFHSY
FT                   YFAEEHEDEFVFELNPGRILTSNPNNPTGSLIKLDEIEEFLINEKNELILDESFIDISL
FT                   AESATKLVNEFNNLTIINSFTKSLAIPGLRFGFSIGHKSKELEKRVPIWRINSITYYVI
FT                   SNLNPKEVRSFFVNSKIKVKEIYDKVDGVKKLFKMYKSYAPFFLVEFKIPTSLINDELI
FT                   RRCKCYIRDASNFLGLRNTHARIALKNEVIELINNINEIISEKES"
FT   gene            complement(389010..389447)
FT                   /locus_tag="SSO0449"
FT   CDS_pept        complement(389010..389447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0449"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with AF0615 and carboxy-end of some
FT                   dolichol phosphate mannosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40775"
FT                   /db_xref="GOA:Q97ZX3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX3"
FT                   /protein_id="AAK40775.1"
FT                   /translation="MSLLIRLAKFALVGGLGTIVNEVTYVLASKTIPIGVSLAIAIEIS
FT                   LIFNFVLNDIWTFKDKRNNSYLNRLLKFHGSSYLGNIVQYIVALVLLVYLLHISSISDA
FT                   VFILFFSKLAASTFTLVLTNFIGIVSGFVVRFITSLKYVWA"
FT   gene            complement(389485..390195)
FT                   /gene="alaS-like1"
FT                   /locus_tag="SSO0450"
FT   CDS_pept        complement(389485..390195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS-like1"
FT                   /locus_tag="SSO0450"
FT                   /product="Alanyl-tRNA synthetase truncated homolog
FT                   (alaS-like1)"
FT                   /EC_number="6.1.1.7"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40776"
FT                   /db_xref="GOA:Q97ZX2"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZX2"
FT                   /protein_id="AAK40776.1"
FT                   /translation="MTEELYLKDSYIKEFEGRVVRIEGNYVILDKTAFYPGGGGLDNDT
FT                   GFLVNEKGERISVTEVKRGENGEILHKIDQNGSLNVNEKVIGTIDWDRRYRMMRLHTAS
FT                   HIVAALAYRKFGALITGGHISPEQAKDDFNVENKDTLIELINEANEIIKKDIELKIYFL
FT                   PREEALMIPAIVKLAGRNPPQIPIWRIVEIPGIDIQADGGPHVKNTKEIGEIVLLKVEN
FT                   KGKGRKRVYYTVKP"
FT   gene            390329..391183
FT                   /locus_tag="SSO0451"
FT   CDS_pept        390329..391183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0451"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40777"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZX1"
FT                   /protein_id="AAK40777.1"
FT                   /translation="MFPSVFIFTLLYSSSFHLRSKYITTLSVDTKMSYSGSSSSLMNVF
FT                   GILLISDSNNLNSSHYVFDLIRVDEVRYILAMLGKDFQKMWGYEENKFKIKGSKEPLKY
FT                   KLVQAHYKISSMISRLDAYISRMQERDKILFERVVEAQMSKDTQRAAMYANEVAEIRKI
FT                   SRQLLTTQIALEQVQLRLETVTELGDVFVNLIPVLGVIGELKSALRGIMPEVSLELTEL
FT                   GEGLQEIVTESGEFTGMGSYAAASSPEARKILEEASVVAEQRMKEKFPDLPVGTGLASK
FT                   SNS"
FT   gene            391230..392390
FT                   /gene="trpS"
FT                   /locus_tag="SSO0452"
FT   CDS_pept        391230..392390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="SSO0452"
FT                   /product="Tryptophanyl-tRNA synthetase (trpS)"
FT                   /EC_number="6.1.1.2"
FT                   /note="Homology to human, rabbit and yeast versions of
FT                   protein; Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40778"
FT                   /db_xref="GOA:Q97ZX0"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZX0"
FT                   /protein_id="AAK40778.1"
FT                   /translation="MYFLTTMPDEFTVTPWEVKGKVDYDKLIVQFGTQKITEELKQRIK
FT                   NLAGDLHVMLRRNVFFSHRDLDLVLNDYEKSKGFFLYTGRAPSLGMHIGHLIPFIFTKW
FT                   LQEKFNANLYIEITDDEKYMRNPEFTLDQTRSWAYDNILDIIAVGFNPDKTFIFQDTEY
FT                   IRNMYPITVKIAKKLTFSEVRATFGLDASSNIGLIFYPALQIAPTMFEKKRCLIPAGID
FT                   QDPYWRLQRDIAESLGYYKAAQIHSKFLPPLTGPEGKMSSSNPETAIYLVDDPKTVERK
FT                   IMKYAFSGGQPTIELHRKYGGNPEIDVPFQWLYYFFEEDDNRIKEIEEEYRSGKMLTGE
FT                   LKQILIDKLNNFLEEHRRRREEAKELVHVFKYDGKLAKQMWEKIHE"
FT   gene            complement(392359..392811)
FT                   /locus_tag="SSO0454"
FT   CDS_pept        complement(392359..392811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0454"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40779"
FT                   /db_xref="GOA:Q97ZW9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW9"
FT                   /protein_id="AAK40779.1"
FT                   /translation="MSEEENIEKVKKMYEEGLSIREIANQLGLSYSKVRRMLIKAKVNF
FT                   RGKVPNDKIQKIIEMGKQGYSANRISRELNINFNTVLRILKKYNLGKKRRKLDAKEIEK
FT                   IREEYIKGNSIYRIAKELNISTNLVVYHLKKMGLYRPIRESSPTSA"
FT   gene            392792..393589
FT                   /locus_tag="SSO0453"
FT   CDS_pept        392792..393589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0453"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40780"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW8"
FT                   /protein_id="AAK40780.1"
FT                   /translation="MFSSSLTSYVYTKPIILIFSQNLCKMIKIGTCGFTRKHFNYFDVL
FT                   EVQETFYNFLSEERLNKLKELSIRNKVELTIKANQIITHEYNRITYKRFKKIIGDVKNY
FT                   GYFRPTKEVMQALEITLNEAKFLNSRIIIFQTPPSFAPNNENIKNLKDFFSILDKSFIY
FT                   GWEPRGEWNQNHEVLLKIFSQIDVIHVVDPFKNKSVDDKQIRYFRLHGLGSSEVNYRYK
FT                   YTKADLEKLKEYVLSERKELIYVLFNNVYSFDDALSFKRMIEG"
FT   gene            393598..394158
FT                   /locus_tag="SSO0455"
FT   CDS_pept        393598..394158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40781"
FT                   /db_xref="GOA:Q97ZW7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW7"
FT                   /protein_id="AAK40781.1"
FT                   /translation="MLLTYLGLGIILGLSMAAPPGPVNAMIANESMKSWLHGSSIGAGA
FT                   MTADLIFFIIVYFIQGYIPTPIRNALYIIGGIFMLYLSYLTIRAKMPSKSIKGNYFIGL
FT                   SMGLTNPYQISWWITVGISIIRSLSILIIPGFFVGILIWIIAFPKAVNMLGSKYVKYVK
FT                   VISSVILVIFGVYLLYEGILNVI"
FT   gene            394148..394873
FT                   /locus_tag="SSO0456"
FT   CDS_pept        394148..394873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0456"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Match is best in just one domain of protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40782"
FT                   /db_xref="GOA:Q97ZW6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW6"
FT                   /protein_id="AAK40782.1"
FT                   /translation="MLSKQEIRELIWRKLEEGNIALFPRPVYGRIPNFKGAEEAALNLV
FT                   KCKEFENAEIIKVNPDSPQYKVREIALRHKKKVLVPTPRLRGDFFLLDPSRISPSDIPR
FT                   ASRISGFEKYGIRISLEDIVRVDFMVAGSVAVDINGNRVGKGEGYSELEFAILRELGKV
FT                   DENTPIATTVHDVQIVDEIPSEPFDVPVDIIATPSRLIRVNRKREKPKGIYLEYLSKQK
FT                   IDNTPLLREYLKKRGYNSM"
FT   gene            complement(394844..395194)
FT                   /locus_tag="SSO0458"
FT   CDS_pept        complement(394844..395194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0458"
FT                   /product="Transcriptional regulator, putative"
FT                   /note="Similarity with SSO1108 transcriptional regulator
FT                   Lrs14; Transcription, RNA polymerase and transcription
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40783"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW5"
FT                   /protein_id="AAK40783.1"
FT                   /translation="MSIEISEKSFLLKRFLIVAYGLSEADVDAFIKIVSSETGKDVDAI
FT                   AGELGISKSRASLILKKLADAGLVEKEKTSVSRGGRPKFLYRINKEELKKKLIKRSEET
FT                   CKDLHTIISSFL"
FT   gene            complement(395505..396395)
FT                   /gene="mrp"
FT                   /locus_tag="SSO0460"
FT   CDS_pept        complement(395505..396395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="SSO0460"
FT                   /product="MRP protein homolog, conserved ATPase (mrp)"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40784"
FT                   /db_xref="GOA:Q97ZW4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZW4"
FT                   /protein_id="AAK40784.1"
FT                   /translation="MSSNPFRIQNPQPQPQRQPRDLRKVNQQVQAVDLKVQMKMKNIKY
FT                   KIGVVSGKGGVGKSFVSSNLAMAIAASGRKVGIVDVDFHGPSVPKMLGVRGQMLTADDK
FT                   GINPVIGPFGIKVVSIDFLLPRDDTPVVWRGAIKHSAIKQFLGDVNWGELDYLIIDMPP
FT                   GTGDEALSIAQLVPGITGFVIVTIPSEVSTLAVKKSINFARTVNTKILGVVENMSHFVC
FT                   PSDGKVYYIFGEGKGKKMAEEMGVDLLGQVPLDPSIAEANDAGEPFFLKHPDSPTSKEF
FT                   LNIADKVIKIVESNQ"
FT   gene            complement(396396..396959)
FT                   /locus_tag="SSO0461"
FT   CDS_pept        complement(396396..396959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0461"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40785"
FT                   /db_xref="GOA:Q97ZW3"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZW3"
FT                   /protein_id="AAK40785.1"
FT                   /translation="MIIIVTGTPGVGKTVASKKLSEALNLNYLSLSQFVIENKLYTEYD
FT                   ELRQSYIIDEDKVKEELEKIISTSHLVIETIYPSLVSTADLVVVLRKNPFSLYNELKGR
FT                   GWADIKVAENVEAEILGVISQEAREAFKDKVCEVDTTEMSTEQILNKILNKQCDGPIEW
FT                   LVDTKVQRFLEELDKIISSYENDI"
FT   gene            complement(397123..397767)
FT                   /locus_tag="SSO0463"
FT   CDS_pept        complement(397123..397767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0463"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40786"
FT                   /db_xref="GOA:Q97ZW2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW2"
FT                   /protein_id="AAK40786.1"
FT                   /translation="MEHDSVGSIDNHCIRTNISIMVNKVIIKKIIGISTFFLMFLVTLG
FT                   FMVGLLATFIDSTSLYYLEQLNYLVIKGYYSELFTSIFITNSFVDFIFNFISLYVIYLI
FT                   FGSRAGKHEYGIFILAGILGNLLTVIFYSPFTLSSGASGGIFGLLSYYTFYDFLKKDNL
FT                   GVYGLVFLVSVFGVSDLIFPNVNVVAHIGGILGGIMYAVVYYLIRSGRTIK"
FT   gene            complement(397707..398309)
FT                   /locus_tag="SSO0464"
FT   CDS_pept        complement(397707..398309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0464"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40787"
FT                   /db_xref="GOA:Q97ZW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW1"
FT                   /protein_id="AAK40787.1"
FT                   /translation="MSWDIRYLEWRFANLNEITSFLLAALSLAVAYIRPTSILSDPIGS
FT                   IIIPYIVALLAIIPHEIGHRQAARRYGCFSRFTLSFSGFWTTLILNIIGSFVGILVFFS
FT                   GYTSISCGLLNRDVEGKTALAGPLTNIIVGFVGLIGASLVPFSLVGLFFFELARFNFWV
FT                   AFFNLLPFWVLDGLKIFRWNMIVWAVLIIIAFALTFL"
FT   gene            complement(398312..398935)
FT                   /locus_tag="SSO0465"
FT   CDS_pept        complement(398312..398935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0465"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40788"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZW0"
FT                   /protein_id="AAK40788.1"
FT                   /translation="MRFEVTVDYLQGIGRKVLTSDGHVVELNPSLEKELSLIGVSSKLF
FT                   AEGLIDAVTQNNGTYSFFLPAKKISDECENVLRIFEIWISTTNQTRKMLVIIINVEGNA
FT                   QITLLRPELYNDFSKDLIEILAKRYICLKITMPFMYRSVIFDTFNSFKRLFDIIFEGII
FT                   NLSGNIYMATISNDKKALLWKIDSTNIRYVSNNLIPSELLRLIR"
FT   gene            399141..401654
FT                   /locus_tag="SSO0466"
FT   CDS_pept        399141..401654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0466"
FT                   /product="Integral membrane protein, putative"
FT                   /note="Cell Envelope, Membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40789"
FT                   /db_xref="GOA:Q97ZV9"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV9"
FT                   /protein_id="AAK40789.1"
FT                   /translation="MVTNVKLVFPQYFLLYIKSRNNVKNGLVSLVLWLLLIMILLHFAI
FT                   KTPSLFTYSDSPFLSSSVQSVRADKIVTNYFHIGNVDNLYIIINSSSYNQALQEIYSNL
FT                   YLLNNATVITPNGYVSMLKTEYLSYLGLNEKNFSSTISQLYENLTRLKLYLISNFQYFE
FT                   YQLNITFGLPLHNFTSNICPTYKENFDKVNGSLLEKARYAGYLTFKDPFLFYFGFNNYT
FT                   NYTLALKFLIQFNNYTSLIERILKTQNITSVNESNVIFNNITTAFNSSFHKGTLWLFII
FT                   NVPSNESLTNINQFTESLRNAYVIGHLAYYAQSAYYTQSNVEIIDITTIILVMILLILL
FT                   VRSIVPILILISSAGTSLLLAYGLMYMETLLGYKIYYISGLVAPPIVFGLNIDYGILLI
FT                   YRYFEEINKNNLDALLYALKNSIKGILLSGISITIGFSSFILSPSALLQNIGIALVTSS
FT                   ISALIPAVFFTYTLLLLIPQRYLSFPRRKLPSITDIRQRYLYKLSNFAVRHNKLLVILM
FT                   LVSIVIFIFYFPSIHTNVNIDEILPPHANSLVGTKVLNQLYNYSIDYIILYGSPKANYT
FT                   LIYNLTKTLIDQGNLVYGPMSLGSQIIVNNSNLYDHFHQGNYTLLIIYLKYPVFSNGAI
FT                   NLTNWLISKGFLVGGDNAQRIDIVNNTVSTYFSYTLPLTIILIVIYLFMILGSILLPLR
FT                   LSLTVGLSSLLGAFTVALVYNSPYWLSPLVIFALLFSLGIDYDMFIIIRLFDEMKNDDD
FT                   INSAIVRSVENTGLVVTTCGLILAGAFFSLMVANMRFLQEIGLGVGVSILFDTFVVRPI
FT                   LVPAIISILKKYNFWPFKARKFLYT"
FT   gene            complement(401626..402570)
FT                   /locus_tag="SSO0468"
FT   CDS_pept        complement(401626..402570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40790"
FT                   /db_xref="GOA:Q97ZV8"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV8"
FT                   /protein_id="AAK40790.1"
FT                   /translation="MFDLNLTIVLKSPLSIFDDIFITSIRVLEAKRLRELHMSQTRIAN
FT                   LLGVSQPAVKQYLDEDENSYIKRLQNLGLTREEIDDFLDKLTQLLINGDPKQVMQYISV
FT                   FFLSNLSRLKFCKYHKMIDSEIPVDCDICKSLYKENEEEMMELALSMLQNESVAELIPE
FT                   VLSNLAFAKANAKREEDVLAIPGRITKIRNLPTPASKPMWGGSKHLAKVLLSVMKNHPA
FT                   VRSVMNIKYDEKVEMILKEIGYKFKKVGPQNDLGNERIAETIAAVFDEGTDVVIHLGGT
FT                   GIEANTYVFGRDPLDVVKKIINISVKYKEIFSP"
FT   gene            402506..403264
FT                   /locus_tag="SSO0467"
FT   CDS_pept        402506..403264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0467"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40791"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV7"
FT                   /protein_id="AAK40791.1"
FT                   /translation="MNMSSNIDSGDFSTIVRLRSNKNYFLNRELTFAAIDGTFSDIILE
FT                   GEKGGYIVIGIIKGRIFKDFKFTIEDISVDDELCICEAEKRMRELEYYNIKENEVDLIF
FT                   FDRKLSFDKSLGISVPKNSIGIVKDFDIVKRENLNNVENPPWLVINEKHDETIYGYFKL
FT                   FPSSWVFYIESQVFVENPEELLSLIYNLGREPIPEALGYNYPLFLADKLVKYYRNKLSK
FT                   FINVTSLQSNIRYREFRSWIERLRNDGKYF"
FT   gene            403245..404993
FT                   /locus_tag="SSO0469"
FT   CDS_pept        403245..404993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0469"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40792"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV6"
FT                   /protein_id="AAK40792.1"
FT                   /translation="MMESIFEVEEGKLREAKIITRQTSDGRGTISFRNYIVEFPFSLKD
FT                   KLGIGKLLAVNTIKENYYLILEVADIIPMHYGMINLDSTIPKEIRNEIMKKVSESWYSN
FT                   DEKEIWIDSITYPLGYILEINSNNIQFKKGYFPPLLGSSVKILNKKAYASFVCANSNVS
FT                   LGNILHEQLSLDINLEKAIKYHLGIFAFTGSGKSNLASLIARKVLDNLPDTKVVIFDVS
FT                   MEYAILLLDKLLEVPSRVISLDRVPPNPADASRKFLRSHVIPDDIIDIRDKIKKSAEIL
FT                   HQNGKMKQLYVPPEGFTYLTYADLIDLVKKQIEDKYTAISQKPLLYTFLSKLDNFMRER
FT                   KLTVDDIIDDSINNLLDEIENLGKDAHLKENSSLFTFISGIRAYISLGIRETEDYDIEN
FT                   LAIEILDSSRDSPRLFILELPNLEEGRQVVATVINQIYNRRKRMYSDNPKVLFIIDEAQ
FT                   EFIPYDTKQKDKSEASSTAIEKLLRHGRKYHLHSLISTQRLAYLNTNALQQLHSYFIST
FT                   LPRPYDRQLLAETFGISDMLLDKTLELEPGQWLLVSFKSALPHDVPVFFAAENNLDLLK
FT                   DRINKL"
FT   gene            complement(405273..406178)
FT                   /locus_tag="SSO0470"
FT   CDS_pept        complement(405273..406178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0470"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Might have a GTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40793"
FT                   /db_xref="GOA:Q97ZV5"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV5"
FT                   /protein_id="AAK40793.1"
FT                   /translation="MYYGSIITVLSSDKNKLTGIAEKLGKLHETAKTKIYYRKKGEYIR
FT                   SILLTTEYPEKIIDLAEALSLSSTAILYIPETLTWMDGELALLIDSLNTHNKIVISNLD
FT                   QGKINNILGSLSSFTKFDLYNDIPDLSETEEEDKGIVYVDRVFTVKGVGTVVTGFSFTN
FT                   VEVHEKLVALPYNKEVEIKSIQVLDEDQKSVSTGVRIGFALKNVKEEEIEDLLYLVKPN
FT                   VKVVKEIEGQITNYKWSTINQGQNHIIVKGHGIAANIKVDNQKAKIMSSVPIPIVDNRI
FT                   LVLNVNVRQGKPRVAGYISL"
FT   gene            406229..406510
FT                   /locus_tag="SSO5909"
FT   CDS_pept        406229..406510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5909"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5909"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40794"
FT                   /db_xref="GOA:Q97ZV4"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV4"
FT                   /protein_id="AAK40794.1"
FT                   /translation="MKLIAAGLTLIFLGFILLFLGVVLQVQTPQTTTSSSPQFAGLVLL
FT                   GPIPIAFGNVPPSVLSNLIIVGVVFTIIMLIIYLIMFIIGRKTTRAPF"
FT   gene            complement(406507..407622)
FT                   /gene="adh-1"
FT                   /locus_tag="SSO0472"
FT   CDS_pept        complement(406507..407622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh-1"
FT                   /locus_tag="SSO0472"
FT                   /product="Alcohol dehydrogenase (Zn containing) (adh-1)"
FT                   /EC_number="1.1.1.1"
FT                   /note="Energy Metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40795"
FT                   /db_xref="GOA:Q97ZV3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV3"
FT                   /protein_id="AAK40795.1"
FT                   /translation="MIILYLILMKGAILYKYNEPLIIEDNIQIDEPKVGETKIRIEATG
FT                   LCHSDVNVFEGKTPVPPPVIAGHEIAGVIEEVGNNVTDFKPGDRVISAFIHPCGKCKNC
FT                   ITGKENLCEVFAKNRLNGTLLDGTTRLHFKDGTPIRAFLGGGFAEYAMVPYTALTKVPE
FT                   DLDLRKVAVLGCAGLTAYGAVNSAKIEPGETVAVIGVGGVGLSVIQMLKIAGAGRIIAV
FT                   GTRKWKLEKALELGASDVVNSKETDVVRAVKNITGGGPDVVIEVAGTTETVKMSLDMVR
FT                   IGGKVVLVGLPPTTAEIPIRIASIVRGGIKIIGDYGGRPRVDMPRLIELVKLGKYDPTA
FT                   LVTGKFRLEEINEAVKLLEQGEAIRSLIIPN"
FT   gene            407678..409012
FT                   /locus_tag="SSO0473"
FT   CDS_pept        407678..409012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0473"
FT                   /product="DNA repair protein rad25"
FT                   /note="Close hits to probable DNA repair proteins and
FT                   helicases; Replication and Repair, Helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40796"
FT                   /db_xref="GOA:Q97ZV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV2"
FT                   /protein_id="AAK40796.1"
FT                   /translation="MVRLRYFKCLLLSDFSAPGLSWNDEFKCYIGQANKYREVLYYYKR
FT                   SHVEVEDSVLELLPFPLIVDRIKLREYQQEALNAWLKSKLGIIVIPTGGGKTVIGLKAI
FT                   ALIRLATLIIVPTIDLLQQWYENIRELLGVEAGRVGGGYDELKGITVITYDSAYTQLEK
FT                   IGNKFGLVIFDEVHHLPSEGYSIIAQGLAAPYRLGLTATPERSDGRHKLYPSLVGPLVY
FT                   RITVSNLVGKYLSSFEIQRIYVNLTEDEEKLYRHYRGILKKFLSQRNLKLKSLNDFNRL
FT                   LRLAVKDKEAREALLAWHEALKIAVNSKAKLEKLKDLLKELNGEKIIIFTRNTSMVYEI
FT                   SRLFLIPAVTYKTNKQERIEILEKFRSGKYNVIVTSSVLDEGIDVPDASIGIVLGGYGT
FT                   SRQFIQRLGRILRKKENKKARLIEIITKGTSDYNLSKRRRQNANL"
FT   gene            408999..410456
FT                   /locus_tag="SSO0475"
FT   CDS_pept        408999..410456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0475"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some homology to B.burgdorferi predicted coding
FT                   region BB0212"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40797"
FT                   /db_xref="InterPro:IPR008508"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV1"
FT                   /protein_id="AAK40797.1"
FT                   /translation="MLTSDLARFKIENQRIIPLFATDSDIDVAKEVIDMFKIGAKVGDI
FT                   LEDLKYLSKIYDYKLVKGLGKIYLRYCIVESATKIDYIELRRQLFSRGPVLEENDKERV
FT                   LKEVGDLFHVDPIKAMYEDLDVEKKIVELPKFSPEDLLKIYNLSLLQTIIFNAYKVTVS
FT                   VSDGWKEIARRIKMLGLMYLAYENPLRIEIFGPLSLVKMTEKYGRNLAALVPFLVSKNK
FT                   WTIIADIVLGKNKRRTYRLELSSGYSKLFKYINDEEMEKRFDSSIEEKFYEEFRRVIRD
FT                   WNIVREPEPIVIEKRLYFPDFVLSKGNIKVYVEIMGFWTKEYVNSKIEKLRNFKYPILV
FT                   LLNEELSYENYIPDTLNVIKFKKKIDIGKLYSALRGFQANVNEDIDLSDVNDDIILIKE
FT                   LSAKYNVNEKIVRSKLMQRPDYIVLKNYAIKKTFIEELKKEDFSNTQLSSLVNKYGNYI
FT                   VDIIDYLGYKIVWKNISDAIVEKIKEV"
FT   gene            complement(410443..412068)
FT                   /locus_tag="SSO0477"
FT   CDS_pept        complement(410443..412068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0477"
FT                   /product="Conserved hypothetical protein"
FT                   /note="P.horikoshii homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40798"
FT                   /db_xref="GOA:Q97ZV0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZV0"
FT                   /protein_id="AAK40798.1"
FT                   /translation="MNTFYSRKVKYNIMAWEIILTADKGSFTDYGGSSVLGYVACMPSR
FT                   LIPKFFMDRFFTPDVPVDSEGRAIVAPYALRKVESTLVHAGFDSVVVIPPHRLEKAINQ
FT                   KTKVVGLTVHDPFGLNPVSFKLSMIFGGGPTWTAKYFEEFGEKISKLKSKYNFKVIVGG
FT                   PGSWELTKENKDWADVIFIGEAEADLPRVVKSIIDGQEVPKVVYGKNPKVNEIPPIINP
FT                   ARLGEVQITRGCPRGCQFCPITPETFRTIPLDVVKKEVEVNMRAGVKRVEFITDDVLLY
FT                   GSQKLRVNHEAITKLFTETMNMGVDGIWFPHISAPAVRSSPQTVKAMSEIARYDEDRAA
FT                   APVVGLESGSEKILSKYMRAKPFPWTPREWKDVILDATAIMNDNYIYPCYTMTIGYPEE
FT                   TNEDVDQSIDLVQSIIDHKLKAWIFPLPVIPMGVSYIRNNPFPVLEKMPTRYWDVLYIS
FT                   WKYDLQITREMIPILTGGIKNKFAQRTVQYMIDKIFYSIEWVFKQLKETQGKYAYTFAS
FT                   INLNNTTGVIKAIYWLFRLAFKPL"
FT   gene            412196..413338
FT                   /locus_tag="SSO0478"
FT   CDS_pept        412196..413338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0478"
FT                   /product="Hypothetical protein"
FT                   /note="Hits to probable TLDD proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40799"
FT                   /db_xref="GOA:Q97ZU9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU9"
FT                   /protein_id="AAK40799.1"
FT                   /translation="MRKLKREAYKLNNIKMLQQDVKYSEEVIEAEFSVEGYSLIDYKRS
FT                   YTLSRALVNGKWIVYDGNRLESSQKIKEFEICEDFYHESVKAWPNKEKYSRLFTNIKLN
FT                   EDDQLKVISKKISKSILIHDVKECREEKVVNYVEYNDLNFSYAGNPKDIPSIVEYLRAS
FT                   QSQLTSPSRQVLTESGRLTFILDSEIVASIFHYVLRNFLNGNSPKLKLNEKISSEITIY
FT                   DNPLNSFSSSFSVFDDEGVKTKKKEIIGDGIITNYLGTLTSKYGEAGNARGILPKPDYF
FT                   SLEVKQGDWSLNELIDESRGAYIAMGVKKSELIRNSIRITPRSVVKIGQGQIFFREIAI
FT                   PLQELVTIDAVTRENRGVFIDEEHGGVTPYVRMKVRAILY"
FT   gene            413371..413919
FT                   /locus_tag="SSO0479"
FT   CDS_pept        413371..413919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0479"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40800"
FT                   /db_xref="GOA:Q97ZU8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU8"
FT                   /protein_id="AAK40800.1"
FT                   /translation="MYRRKPNPYVKLINGDKIIDVGCGSGQNCDQFKGRLVICLDLSLN
FT                   QLNQARKKGCQNLVQADMEYLPFRDSSVDSLAYIASLHHLRDPSQALGEAQRVLKDKGE
FT                   ILVTVWLVQLKFFFLRRYIIKRSLINGKEVRRFYRLYYPWELKRIMESKGFVTKIYKLY
FT                   RVNSLLPNNSLYYGIKSTA"
FT   gene            complement(413903..415324)
FT                   /locus_tag="SSO0480"
FT   CDS_pept        complement(413903..415324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0480"
FT                   /product="Histone acethyltransferase, putative"
FT                   /note="Also a hit to C.elegans ZK863.3; Translation,
FT                   Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40801"
FT                   /db_xref="GOA:Q97ZU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU7"
FT                   /protein_id="AAK40801.1"
FT                   /translation="MQVIRKPTRMLSGVTIVSIMTHPHSCPHGKCVFCPGGVDVDTPQS
FT                   YYGREPTLMRAIENDYDPFHQVQSRLRQYVENGHTPSKVELIIMGGTFLSLPIDYQDWF
FT                   VTYALEAMNRFPSYDKPSFVYLEDAQVKNEKAEVRCVGMTIETKPDWAKEWHADQMLRL
FT                   GATKVELGVQTVYDDILKFTNRGHTVKDSIESTRILKDSGFKVVYHVMLGLPKSDPDKD
FT                   LEAFKTIFSDPNFRPDMLKIYPTLVVETAPLANLWRRGLYKPYGTETLIELISEMYRYI
FT                   PKWVRVMRIQRDIPANVILDGNKKGNLRELVEKKVLEKGIKINEIRFREVGMMWQHRGL
FT                   LPDHTKIHLYKEVYEASEGTEIFLSFEDEKEILIGYLRLRITSNKAHRKEIDGKTAIVR
FT                   ELHVYGIEVPIGSWDELGFQHRGYGSKLLSEAEKIAREEFDMRKISVLSGIGAREYYAK
FT                   RGYVKEGPYMSKQLI"
FT   gene            415401..416033
FT                   /locus_tag="SSO0481"
FT   CDS_pept        415401..416033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0481"
FT                   /product="Hypothetical protein"
FT                   /note="Phosphoglycolate phosphatase homology"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40802"
FT                   /db_xref="GOA:Q97ZU6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU6"
FT                   /protein_id="AAK40802.1"
FT                   /translation="MRKAVIFDLDGTLANTDEVHKLAWEIALRKLGYDVKVDIRYLLGR
FT                   KTIDIAKILIGESHAEKLASVKTEIYNELVKTLAKPKPCVMELINRLRDVEIPIAVVTS
FT                   SMRNSAVQVLKVINVEPDVLITGDDVKLGKPNPMPVIEAIKRLNVDPNESVGVGDTIYD
FT                   VMAYYSAGIREIIVVRSSVPLNVEEARKYDAKILDSLCEISDWFELF"
FT   gene            416056..416394
FT                   /locus_tag="SSO0482"
FT   CDS_pept        416056..416394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0482"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40803"
FT                   /db_xref="GOA:Q97ZU5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU5"
FT                   /protein_id="AAK40803.1"
FT                   /translation="MKTKFLISQYDFSYKDGKMLTNPYDWIIILVVIAVLFFGASKIPE
FT                   LFRSMGRAVGEFKKGRVEAEMELQQMQAQNLQQPLVQQQQPNVQDLEKQIAELQKQLEE
FT                   LKKSKQNQ"
FT   gene            416431..416748
FT                   /locus_tag="SSO0483"
FT   CDS_pept        416431..416748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0483"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40804"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU4"
FT                   /protein_id="AAK40804.1"
FT                   /translation="MISNLSDFLVVVVVFILLMAGDKNAGNTTKSIGRFLGEIRKRQNE
FT                   FKNELMRELNSVEATNNTPFTGSNFKYVKVTNQERVKELEAQIKRLQEELERLKASDGK
FT                   N"
FT   gene            416732..417616
FT                   /gene="tatC"
FT                   /locus_tag="SSO0484"
FT   CDS_pept        416732..417616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="SSO0484"
FT                   /product="tatC protein (tatC)"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40805"
FT                   /db_xref="GOA:Q97ZU3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU3"
FT                   /protein_id="AAK40805.1"
FT                   /translation="MTERTREVEKLEERPLIEHLRELAYRLRRILIALAITFMIYFMLG
FT                   LELVRVYLPYPFFGLKYVLAEVPVLYPSLFDSISVQLTQLFIYNELPKGVKLIIINLFD
FT                   PLFASFYISLYLAIFTTIPIIVREIWAFVAPGLYEHEKKLFKSIIFPAFLLFALGSAFA
FT                   YFLLIPLMLRIILLYATALGSAVEPTLGLRSFVSTVMTLLIATGLSFELPLIMGGLTGV
FT                   GVVKSITWLKNWRWGVLVSFIIAWIISPGTTGGIIETVIGITLSTLYFIGALISKFMEK
FT                   GRKKESQKTLERI"
FT   gene            417750..418706
FT                   /locus_tag="SSO0485"
FT   CDS_pept        417750..418706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0485"
FT                   /product="ABC transporter"
FT                   /note="Putative periplasmic-binding protein; Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40806"
FT                   /db_xref="GOA:Q97ZU2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU2"
FT                   /protein_id="AAK40806.1"
FT                   /translation="MPSVKAIGTIVAIIIVVSVISVYYYYKSSSTLQPATVNNNLRIVS
FT                   LAPSDTQILISLGLGKYIVGTDYYSYQLLQSLNLTKDIPSNITVFSQISPPNISGLLLL
FT                   HPTVIVVEKGLIGSYIEQMKEAGLNVLITNNDFASTYSQIENCILKVGEYFNVTSKAQQ
FT                   LIDWMNQKISDFSTAGNVSVAYLLWICPDLSFYTAGGNVFINSIIVQAGGINVFANYSG
FT                   YPLLTPSPLLIIKPSVVIAQEVYNLTYTNYLISQYKGINSSNLYIIGNLATNLLNEPGP
FT                   LSVYSIQVIKLIIEGKAPHFISDNWVINNLNVTLPVF"
FT   gene            418707..419693
FT                   /locus_tag="SSO0486"
FT   CDS_pept        418707..419693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0486"
FT                   /product="Iron (III) ABC transporter, permease protein
FT                   (HEMU 1)"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40807"
FT                   /db_xref="GOA:Q97ZU1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU1"
FT                   /protein_id="AAK40807.1"
FT                   /translation="MVRLSGIFLIIGFIISFLLGLLYGDVTIPISEIFHPSGVYAYILL
FT                   NIRLPTLTVAILIGAILSTSGAVLQMLLRNPLVDPYISGTASGGAFGAVLTYLLLMLNL
FT                   PFSWIIYFQPLVAFFTATLATLITIMIGKKSGYLGLVIGGVLVSFIFSSLVTVILSVMS
FT                   AKYPQIPPLTFWLLGDISVVGWFNAIILSLFAILLLYFSLSNSRLIDLLSISDEISYSQ
FT                   GVNPNKQRVFWLLFISLVVAYCVSIAGIIGFLGIIVPHIIRRLIGGNTSQLVMYSSLLG
FT                   STILILSNILSHGIFGYFIPLTALLSIMGAPIMIFALVRKDVNVEEY"
FT   gene            419671..420330
FT                   /locus_tag="SSO0487"
FT   CDS_pept        419671..420330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0487"
FT                   /product="Iron (III) ABC transporter, ATP-binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40808"
FT                   /db_xref="GOA:Q97ZU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZU0"
FT                   /protein_id="AAK40808.1"
FT                   /translation="MLTLRNISVRLGGKLILSSISFSAVKGINVILGPNGSGKTTLLRA
FT                   IIGMIKYDGEIRVDGEISYVPAEFFSPSMKVLDVLKAGRKRANYESYIKELNVEKFLER
FT                   DFSTLSSGERKLILVTKALAEGDNVIMDEPLSNLDVKNKFFVMNILKKFNHKTFLITSH
FT                   ELETLRYADKAIVINKGKLEYDGGVSDLSDDLLSNVYGIKFKKIQVDGKTFFNVTG"
FT   gene            complement(420471..421244)
FT                   /locus_tag="SSO0488"
FT   CDS_pept        complement(420471..421244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0488"
FT                   /product="Phosphate ABC transporter, ATP-binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40809"
FT                   /db_xref="GOA:Q97ZT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZT9"
FT                   /protein_id="AAK40809.1"
FT                   /translation="MEAGKSAEDVFNISRLYLYINDKAILKDITIKIPNNSIFGIMGPS
FT                   GSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDIFQIDAIKLRKEVGMVFQQPNPFPH
FT                   LSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQRLT
FT                   IARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYV
FT                   AFLYNGELVEWGSSNEIFTSPKNELTEKYVIGRIS"
FT   gene            421390..422607
FT                   /gene="pstS"
FT                   /locus_tag="SSO0489"
FT   CDS_pept        421390..422607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="SSO0489"
FT                   /product="Phosphate binding periplasmic protein precursor
FT                   (pstS)"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40810"
FT                   /db_xref="GOA:Q97ZT8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT8"
FT                   /protein_id="AAK40810.1"
FT                   /translation="MKGFSTLAVVIILIIVVIAVAGIFFVINSQGGHNTTTTSTSSSFS
FT                   TSSQASSSQTTASSQISASIIAGGSTFVNPLMQVWIKDFQSNYNGIQVTYSAVGSGAGV
FT                   NNFLQGAYDIGATDVPPPSNLYQQLTQKYGEVLTIPDVVGAVDIIYNIPSFSGTLNLTA
FT                   DVLAKIYLGQIQYWDDPAIKALNPHFNFTHQKIIAVHRSDGSGTTFIFTYWLYTSSQSW
FT                   RSSNVSYGYTVNWPVDKLGNGLGGKGSDGVTAYVSQNPYSIGYVEAQYAIAKNLTPAAV
FT                   LNPSTGDYVLPTQASIETAIQNANLSSLPSSLTRDLSQYLSVFLNVKAHNAYPIVTFSW
FT                   LVIKVNYTDKSKAEAIYLFLKYIATTGQTELPSGYIELPSNIQQLILQNLKLISYNNTS
FT                   VYTLVS"
FT   gene            422610..423494
FT                   /gene="pstC"
FT                   /locus_tag="SSO0490"
FT   CDS_pept        422610..423494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="SSO0490"
FT                   /product="Phosphate transport system permease protein
FT                   (pstC)"
FT                   /note="Transport, Cell membrane transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40811"
FT                   /db_xref="GOA:Q97ZT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT7"
FT                   /protein_id="AAK40811.1"
FT                   /translation="MITIKRKREKFFYFLLIPSSVVVFTFILILSVLVYNSIPILEKVG
FT                   LSIYTKNIWNPIYDQYGGLAAIYGTIVTSVLSVMISIPFATAFSIFVNDISPKKVKSFL
FT                   VNLSDLLAAFPTVLYGFWGLLSLGPFLSRTLFTFLSSHVGLHQTTNGPSILLASIILAI
FT                   MITPFASSLIREVYFQVPRSFEEAVYSLGLGKWELITLKLSYIKKAFLGAYALAFGRAV
FT                   GETVAVSLTIGNVLNISPNLFEPGYTISSLIISQFGTAYGIQYNAMFALALFLVVIGFI
FT                   FVIISKLIVRMRS"
FT   gene            423491..424309
FT                   /gene="pstA"
FT                   /locus_tag="SSO0491"
FT   CDS_pept        423491..424309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="SSO0491"
FT                   /product="Phosphate transport system permease protein
FT                   (pstA)"
FT                   /note="Transport, Cell membrane transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40812"
FT                   /db_xref="GOA:Q97ZT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT6"
FT                   /protein_id="AAK40812.1"
FT                   /translation="MRRKDTVIVSLITLLVILFLLPITFLLYTVVVNGSKVIISYGPRF
FT                   FIDLPPNPGEGLGGIGPALEGSLYMVSLAVLISAPISIFTGVFLSFFERSKIASLIRAS
FT                   LELMVEFPTIVIGIVIFTILVVEIGLGLNGITAAMALAIVMLPYSTIQISEALRIPKKL
FT                   YEEVAYSLGLTTWQVIKLVMYIGRRGIINGLLIGFAKIIGETAPIIFLTSSTANLYIKT
FT                   FNTAVTGIPVMIYNYAFSGYSNLNEVAWGASFVLIILVTIIFVVVRKMAK"
FT   gene            424521..425558
FT                   /gene="thrC-1"
FT                   /locus_tag="SSO0493"
FT   CDS_pept        424521..425558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC-1"
FT                   /locus_tag="SSO0493"
FT                   /product="Threonine synthase (thrC-1)"
FT                   /EC_number="4.2.3.1"
FT                   /note="Amino Acid Biosynthesis, Aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40813"
FT                   /db_xref="GOA:Q97ZT5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT5"
FT                   /protein_id="AAK40813.1"
FT                   /translation="MISSMVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSE
FT                   RGFPYSEKIFPYIKHFISLGEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAE
FT                   KGVKQISEDSSGNAGSAIAAYSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSR
FT                   EDVAKAAENSGYYYASHVLQPQFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGV
FT                   YKGFKHLLDSGVISEMPKIVAVQTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFL
FT                   LDYMVKASSECIVVSDNEIVEAWKELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGS
FT                   GLKVL"
FT   gene            425555..426217
FT                   /locus_tag="SSO0494"
FT   CDS_pept        425555..426217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0494"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40814"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT4"
FT                   /protein_id="AAK40814.1"
FT                   /translation="MKIFVGTSGWTYDWNDDDTLEWYVKNSGLNAVEVNMSFYRYPTRK
FT                   QVERWSKFKEIRWIVKVNRRITHMKRLKDFQSWKEFQQIVDSLNPDFYLFQLPPTFKRN
FT                   SENEKRVFQFAEVLKDKMAVEFRDIQWYLKPLNVTCVIVSIDSPIGTYVIKNNDYIYLR
FT                   LHGRDVWYTYDYSEKELKELADKIISLNPKYVYVFFNNNHWMLDNGRYMLKILTEKS"
FT   gene            426293..427126
FT                   /gene="proC"
FT                   /locus_tag="SSO0495"
FT   CDS_pept        426293..427126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SSO0495"
FT                   /product="Pyrroline-5-carboxylate reductase (P5CR) (P5C
FT                   reductase) (proC)"
FT                   /EC_number="1.5.1.2"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40815"
FT                   /db_xref="GOA:Q97ZT3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT3"
FT                   /protein_id="AAK40815.1"
FT                   /translation="MKIMEDLTIGILGAGKIGSAIVRAIRLKYPSIHVIATARKDETLR
FT                   NVKDLEVETTKDNNYAVNKSDVIILSVKPQHFPTVLRQVGIESWRDKVVISIMAGVKLS
FT                   TLSTLLNNAEVYRAMPNINAIVYKSTTTIAENNGKSRELVENIFKTLGNVYWLPEEYLD
FT                   IWTALVGSGPAFISEIIDALSLGAVACGMQREIAYNAVLDMISGTIIMLKEGKIDHPML
FT                   LRDQVTTPVGTTIRGLMVMEAKSVKSALIETIEASYKRAVEIGNEIDKSIRNNSK"
FT   gene            427181..429337
FT                   /locus_tag="SSO0496"
FT   CDS_pept        427181..429337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0496"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40816"
FT                   /db_xref="GOA:Q97ZT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT2"
FT                   /protein_id="AAK40816.1"
FT                   /translation="MDKRIATIILSIVNIIGIFEFPLYESFIGFFFISSALSILYESQL
FT                   SLIVPTVLFASLVLLHIITIQLQKLIILSILMLISIIGKNNKWIYSILITLAPGLIINN
FT                   LYLLLIVLALLIPLLIKLGGEPRAIIISGILYLIYSGIIFPNNEALANQISQISYFYLM
FT                   FGIIGIIVEDKRITRITLRKILPYLSFIPASFASIMLGYPSDSSFIYWSASSFYFSHLY
FT                   LPWIYEIGYNSNQHLIASWFLAYLLTLIIKNPLITAEVFLGIFTFLSGLISYYVFKRLN
FT                   LKYPLLFSLLYQINIFNPIISHSISVFSYAFLPLVLFFAYNKNKVLYSILTLTAASSIP
FT                   IFISTLVIPLVYRRYYFLLYALGVNAFWLIPFLIFGYDKFTFNVSNIEILISIILVSIS
FT                   VLLYQLRFKNIEILYMIFISFVLLILGINTGPLILLATILTLGSLRDISILYLTLLSGL
FT                   IILSATSFSYGVISGYANTTFYTYNLPNLPKPGEYGFGITTLVNDLNLTASGMPTESIS
FT                   YNVRYFIYNSRVIENPLYFGFPIPAIPNYTPQLTFSYIYSNSSVKVIYSPFNKPLGLMV
FT                   YSNVTPSKISIVFPTRIENISGIKGLVKNYTIQIITNTSLTIIGGKVTVDNKSIFSSYY
FT                   KPKIVTSIMIGEITEVIDSNYSIYLPIHESLTINGKVVNHPIILPPGKYTIVISDEKIE
FT                   YVSYASIFLTIVSLVLLIRRGMKV"
FT   gene            429334..430944
FT                   /locus_tag="SSO0497"
FT   CDS_pept        429334..430944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0497"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40817"
FT                   /db_xref="GOA:Q97ZT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT1"
FT                   /protein_id="AAK40817.1"
FT                   /translation="MKALLAFIVLLLSLSALITSSFSIVIISPNIVKILSYAQVGNNIY
FT                   SSPLWSNGTATVIHNTTYELVVGSSYSYTVQEVNFSNYYNFNYSTKYSYLSGVQAGAII
FT                   LGGNVDLKKPANQQPYVLIYSVTSGQLLVKTPNTKLRIVLNNLPISVSGFLSIQFSNVN
FT                   GNLTVVYISLNGNISRLVYITPIPWSEVKYAGWFQNYGLSYIYYITLGKFAESQPMIAG
FT                   ETYLSPDIVSSPTWKLGVAKIINITPNYETVEGLVSGSYVIQFYNMSRLNYLILTVNFT
FT                   YYNGSNVGIELLGSNLNLTKPDLSQKVYALLYSVNNGELQVKLPNSAFKIINNTLPVIR
FT                   GGLLNIVFLNNNNNISLYEIINGSRTYYLNITTPIPWSNISYIGWRTDNGISRIFFVSP
FT                   NFIIGLQSLLTFEFLGNNGTTVPNQEFYIYIGDNLSSLQLYYKGYTNSDGQFSLPLPII
FT                   FPSSTSYEYVRIVWINSSTNITLIIPLIKGGSNFYIPANIISVEEKSMDVNINYYTLFL
FT                   FIVLAFLLGAYIFTKGKRF"
FT   gene            complement(430925..432187)
FT                   /locus_tag="SSO0499"
FT   CDS_pept        complement(430925..432187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0499"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40818"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZT0"
FT                   /protein_id="AAK40818.1"
FT                   /translation="MKEESYRLLEYVVEHGLEGTLTALETNKGIPIVLVKEDPHTLTTI
FT                   LCIDGIARRITKRFTRTTVHKAIYELIDEIESMISQPIEELRISQKVSFENCIEERGEE
FT                   KPKRKKRETPRLPSIDEYKRIEIPQKHVIPLLYLGDRKYLSLILELGIIDIIESLSSSP
FT                   IIIENNQVTPYKIRDMRAVYNVLSLFKLDRFNNSNPFSTISLNRKFLTFFTALYNDVEV
FT                   LGQTSISMLQRNLKLVKHRVKMFSASKKGNLHTEEVEILNNKNSLERNDIRVGLFLRSN
FT                   DGNTVQIGDINLGELHEKNVFTVNEYIYSSLYMMEDDDYLFFDNILMKLLNTYIAKSNY
FT                   SKLTRDIIERETNINYSIPIVMRTMANRIELANPILYWYSKEILNSDEICINCPIIEYV
FT                   NKFNEFLNNYVRLGYFRSVFL"
FT   gene            432474..433139
FT                   /locus_tag="SSO0500"
FT   CDS_pept        432474..433139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0500"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40819"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS9"
FT                   /protein_id="AAK40819.1"
FT                   /translation="MYTILAYTDTIVFNVIRKAAYENFCTVYTIRSYSPSKLVASVGNI
FT                   MIIVSRNNKSATISVKCGNAKKSFYIKVNENRINFDGNEMDTNLFIYHISSIENELYEY
FT                   VKIISEKCNMQEICHKQKKGIKEILVEGKKINIGEEIKHSLEQLLTILYKREVSVECSK
FT                   SSLCIKKVILTRRKVYIQLVDSEKENYWYLELNDLINKMPEHAQEILNIEGQIRAQSI"
FT   gene            complement(433155..433844)
FT                   /locus_tag="SSO0501"
FT   CDS_pept        complement(433155..433844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0501"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40820"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS8"
FT                   /protein_id="AAK40820.1"
FT                   /translation="MQILVELHPKKKPEKLLNEIKILSSFDGFDIPDSPMGMPSPIPTF
FT                   VASLIRYSLSLDRKTIIINQRLLDVNELFIRSLSITAKMLDAQIAFTKGDKPKYGKEVG
FT                   YLSSDEAVNLAKEYGVKSGMMISLRKNENEIMARLDSNADFFLVLRMKDVDQIKYYGPK
FT                   LIERAIPYLIVMTDKNRELVKSLDQPSFVENEIFSIINSLDSIGVKTVLISSLGDLSFF
FT                   ERLHARL"
FT   gene            433904..434368
FT                   /locus_tag="SSO0502"
FT   CDS_pept        433904..434368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0502"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40821"
FT                   /db_xref="InterPro:IPR040865"
FT                   /db_xref="PDB:4WYH"
FT                   /db_xref="PDB:5OF3"
FT                   /db_xref="PDB:5OFN"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS7"
FT                   /protein_id="AAK40821.1"
FT                   /translation="MSQEKKAKKIILHYPDDTPAGYIEYAEGSSSIYDNEGNFLFKVEG
FT                   KFPPQPKKSSDYSWIEKVLEMGLQDSRKRFILYVASRYLVNVKGVNEDEALQTLKEFYY
FT                   KLQSGKVYESWLKSVINGVKKKGLLPWSLKRIEERDKEMYNEIIRVLKNS"
FT   gene            434783..435706
FT                   /locus_tag="SSO0503"
FT   CDS_pept        434783..435706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0503"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40822"
FT                   /db_xref="GOA:Q97ZS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS6"
FT                   /protein_id="AAK40822.1"
FT                   /translation="MISISTLLNPPEGLTISEILLISVILGMLHGATPDEHTWPITFSY
FT                   AIGKYSSKGGMKAGFLFSLGFTIQRAFLTTIGFIGLAAIYEKYNLDGPVYTIVGIVMAI
FT                   AGSYILKGRYLHLPIDVLFKSKYHNTKTTGAELHDVPLKMTIVHGLIAGFGFGAYASII
FT                   TFVLAPQLPSIVYAPLPGLMFGIGTMIMQIIFGAIFGNILRAKKLTEEKISYVARKTAG
FT                   RTLYYGGLVFTIVGLLIIGFPIIDNFAISTGNPIPNLDAIDIGFLLVISVVGIIGISSI
FT                   ILGIKEATRLSGTNQKPGSLSGYKKS"
FT   gene            435745..438549
FT                   /gene="leuS-1"
FT                   /locus_tag="SSO0504"
FT   CDS_pept        435745..438549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS-1"
FT                   /locus_tag="SSO0504"
FT                   /product="Leucyl-tRNA synthetase (leuS-1)"
FT                   /EC_number="6.1.1.4"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40823"
FT                   /db_xref="GOA:P58176"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58176"
FT                   /protein_id="AAK40823.1"
FT                   /translation="MYSDFFNSIAFKWQAEWEKSKVFETNMDYSKPKFFITVPFPYTNS
FT                   PMHVGHGRTYITADIYARYLRMKGYNVLFPFAFQFTGTPVLAIADSIRRGEVDVIEFFK
FT                   NVYEVPQDKIKELEDPYKLAEYFKEEMKNTAKSIGMSIDWRRTFTTTDPRFEKFIHWQL
FT                   GKLKELGYLVTEDDVVGYCPNDGFPVGMHDTRGDIEPEITTMNVIMFEGSDSYNFMVAT
FT                   SRPELIFGVVALMVNHDANYVVVEYEGKNFIISEKAYKKLSFQKNMKLVKTITTSDIVK
FT                   LYAINPITGRKLEIIKNKYVDPSLGTGVVMSYPAHDPFHYLAMTETNKEFEVIPVVETE
FT                   ELDEIPGESAVLQTKNPYALKDFMESIYKTEYYKGYMKDIILSLVPDFLKQYVKENIVG
FT                   KQVQEARKNTIELLKSLNIYDTIYEISNGPIYCRCGSEIVPKRIKDQWFIAYDNPKWKA
FT                   SALKAINNIELIPNPTKTELEKIVFNARKEPIGRSRGIGVKLPWDESQIVESLSDSTLY
FT                   TLLYTVIYKMPINIEKEIFDFIFLGKGDAKELERKYGTDLIQLREEFLYWYPVDQRHTG
FT                   RDLIQNHIPFYIYNHLAIFGEKYLPKRIVINGFVRVGGRKMSKSLRNIYTLSKAIKEFG
FT                   VDPVRIALTSTSDLLQDLDFNENLVNPIAEQLKKIYDLIDRLLSINTEIKELRTADEWI
FT                   SSKVRDIIEKVNNNITSFKYRDAVNLLLYEIYEILRDYFDLVEIPNQEVIRKILSIWIR
FT                   ALAPFVPHIAEELWHKISSTFVSLEKYPEPNELNLYPDAILEISYINKIIENVRELEDI
FT                   VHKKAEKVIIYINESEKVKELMKNAIKAVNEEIPLREFTANTEDKIAEKVYVVVSKLDK
FT                   AIRDYLLNNEIDEEQIIVKNMNFLLRRLGVSEIVIYNAEDPTVPDVKGKKSQALPLSPA
FT                   IVVE"
FT   gene            438552..439487
FT                   /gene="iunH-1"
FT                   /locus_tag="SSO0505"
FT   CDS_pept        438552..439487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH-1"
FT                   /locus_tag="SSO0505"
FT                   /product="Purine nucleosidase, putative (iunH-1)"
FT                   /EC_number="3.2.2.1"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40824"
FT                   /db_xref="GOA:Q97ZS5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="PDB:3T8J"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS5"
FT                   /protein_id="AAK40824.1"
FT                   /translation="MRHFIIDCDTAEDDVLSLYLLLKNNIDVVAVTIVEGNISYEQEVK
FT                   NALWALEQVNREIPVYPGANKPLLKNYITVEKVHGKGGIGDVTVEPKRLKAQEKHAALA
FT                   IIDLANEYAGELEFLAISPLTNLALAYLLDNSIVKKIKKVWVMGGAVFGIGNITPVAEF
FT                   NIWVDPDAAKIVFNAGFDITMIPWDVIINYPVTDEEWNVIKNMKTRMSELYVSMYLHYR
FT                   QYSSTVQKINGHPHPDAITTAIAIDGSIATRREKRFVVIDNTDNITRGMTLVDRFDADT
FT                   SWSDKPNAEIVYEINKKSFMEKIYDLLNWF"
FT   gene            439598..439738
FT                   /locus_tag="SSO5983"
FT   CDS_pept        439598..439738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO5983"
FT                   /product="Hypothetical protein"
FT                   /note="Putative SSV1 virus ORF B-129 fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSO5983"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40825"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS4"
FT                   /protein_id="AAK40825.1"
FT                   /translation="MIVTRNLYNFFNWHKNVLVKEGLNILSNSKKRQYLKLLRTIKYIE
FT                   R"
FT   gene            439809..440795
FT                   /locus_tag="SSO0506"
FT   CDS_pept        439809..440795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0506"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40826"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS3"
FT                   /protein_id="AAK40826.1"
FT                   /translation="MERIVELEEQIKKERNKEKRNTLYISLIQEYHNLYKKYKNTEFLD
FT                   RALSIANKIEKKNPTVLNILGLIYLEKRRPDIAILTFKELLSNYNLNNEDKNVILYNLS
FT                   LAYFQKGELLNAYNTLKGLVLNSRGEINVLSKKLLVKVCLALGEIRYIEEARELLEEFN
FT                   IPSEELAIAYAALAKYYNDNKLLKKAKDIAIVLGNEKILADILSISDDEEDLRKAIQIY
FT                   EKLGDHNSELKPLYKLSNKDPSLFAQILEKIGNLEDSKDKLVILYDIYRRTKILQFLKE
FT                   AIKTAEKLQDYLFLARAYSELANYEEEVTNLRKAISFYEKYIEKSQK"
FT   gene            440776..441159
FT                   /locus_tag="SSO0507"
FT   CDS_pept        440776..441159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0507"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40827"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS2"
FT                   /protein_id="AAK40827.1"
FT                   /translation="MRKAKSKNIFTLSSYYFMIKHAEYTRHGITEPLMLIMLYKKVEDG
FT                   KIISAFRFSVYKNMIIIVYEEDKLSGGEVLDFDIYNMTNLINKIKKYYDESIDDIVIFG
FT                   EKQYVDEFLNKFLSDEEEETEKR"
FT   gene            complement(442549..442869)
FT                   /locus_tag="SSO0508"
FT   CDS_pept        complement(442549..442869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0508"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40828"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS1"
FT                   /protein_id="AAK40828.1"
FT                   /translation="MRTLPTRTSCISAPAFRDIDPHLVVHHQIILCDFFILTYINFTVY
FT                   RKLLITAETQEIEELTKLIRVYFQLDEVLSFVLEELEDDEVIAELSATKDKIRKAIERM
FT                   IS"
FT   gene            443033..443440
FT                   /locus_tag="SSO0509"
FT   CDS_pept        443033..443440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0509"
FT                   /product="First ORF in transposon ISC1173"
FT                   /note="ISC1173 is split by ISC1217 second part is SSO0511"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40829"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZS0"
FT                   /protein_id="AAK40829.1"
FT                   /translation="MNLVALAQLILFVLRNLNLKPRKHKPEEIALAIAAYVMGVQITKL
FT                   NIPPSTLYYYTKKLGVKRRKDARPRCPSCNSDSTLRFSPPLEQFFDPTRLTVNTFYQSG
FT                   QPFGPEYQTRGVLEVLDNEEREPSRPRSLSS"
FT   gene            complement(443316..443687)
FT                   /locus_tag="SSO0510"
FT   CDS_pept        complement(443316..443687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0510"
FT                   /product="Second ORF in transposon ISC1217"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40830"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR9"
FT                   /protein_id="AAK40830.1"
FT                   /translation="MVDPYPLASSPQGEYLVEYLGTPIKLLVIDDYKGYGRRYFFSTDL
FT                   NDTAEDIITTWENRWDIEVLIRELKALGLEGGSFLTWVRNSGFVALKALSPRCPILQVL
FT                   HGSGTRGQKVGQIDKKYLP"
FT   gene            complement(443596..444333)
FT                   /locus_tag="SSO0512"
FT   CDS_pept        complement(443596..444333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0512"
FT                   /product="First ORF in transposon ISC1217"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40831"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR8"
FT                   /protein_id="AAK40831.1"
FT                   /translation="MTKELTREEYYKALEKAVNEVILSMTGTRKDVAKRLVLGAVVGRN
FT                   ATEIAQEAEMDYETVLNNLDKAAQAKLIEVVKKLVGDHPVLLIVDDIHDHKLYARAMPV
FT                   SRNGAQIFYCRAHKRFEPAIQLLVIGIKDLVNNQIYVIHIIAYIPRKVEEELKRRGEEV
FT                   KFRTKIDALLEFLSSLSGLNVKSKVFDSWYVNSRTLQGNTVGELKSSARVVEGGRSVPV
FT                   SEFPPRGVPGGVLGDSHKVTCYR"
FT   gene            444326..445135
FT                   /locus_tag="SSO0511"
FT   CDS_pept        444326..445135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0511"
FT                   /product="Second ORF in transposon ISC1173"
FT                   /note="ISC1173 is split by ISC1217 first part is SSO0509"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40832"
FT                   /db_xref="GOA:Q97ZR7"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR7"
FT                   /protein_id="AAK40832.1"
FT                   /translation="MVIPKLKALILKSFYGPLELPGFSDKCYSDRVIKNGSSRGKSKYK
FT                   CKVCGRTFYRTASHRMSREQRERILREYTNRMSLRGISKVEGRPLTTVYSSVKRAALKA
FT                   YVDLSILQAQLKAFRSKFAVLDESWTYVRVRRGPRRQNLWIWNALIDGVPFFVTGDRDY
FT                   NTFRLLWLSLPKCEVHYTDDYPIYQVLYHHVVGKKYTHTVESYNSFCRSHLVRLARDTK
FT                   AVNRSRAMIDYSLDLLNVMYPQAFTDEKTPLNLAYLSGVQYIRDHLI"
FT   gene            complement(445284..445697)
FT                   /locus_tag="SSO0514"
FT   CDS_pept        complement(445284..445697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0514"
FT                   /product="Third ORF in transposon ISC1229"
FT                   /note="ISC1229 split by another IS element"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40833"
FT                   /db_xref="GOA:Q7LXX5"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX5"
FT                   /protein_id="AAK40833.1"
FT                   /translation="MKEVRKMIEGNVPQDHVLLTIPGIGKLAAGIIIGIVGDIRRFPRP
FT                   ESFVAYCGLDPVVERSGRIEVRKGISKRGNKYLRSLFYFLAETQYSRNPTLLKFYEAHK
FT                   DKLKGRKLYTALARKLPKYRWSVWYNNKPYEVK"
FT   gene            445862..446953
FT                   /locus_tag="SSO0515"
FT   CDS_pept        445862..446953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0515"
FT                   /product="Transposase ISC1359"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40834"
FT                   /db_xref="GOA:Q7LXX4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX4"
FT                   /protein_id="AAK40834.1"
FT                   /translation="MKHENTTKPAKFNRDFARSALKIIYSVLTKILFPEELLSALLKAS
FT                   GSYLSRLGKDGRRALRKLNAVQVEDVRDALRKMGRMTLRGVRDRRVAVDFHAIPQYHAD
FT                   KSFLSRIKPTKGTSWGLVQAAIFLLGRTRSFLDVIPVTVKNVAEGFKAVMEVIVKELEE
FT                   DKLRLVMVFADREFAVNEVIRFLLELGLDFVISAKAQMYKKYKGMLQDVDVSFGGVRYT
FT                   GFLCVRHGSGAYLIILRKEDGKIIAFLVRKEMDLYDAIVLAEMYRERWGIENAFRSLEE
FT                   FRIRTRTCDVRKELVLVLLSYLLLNVWFLIRSWRKVKLWEFSVSLSNLLDREVRVEQER
FT                   AFREVKTSFPQTPANPMHLLPAT"
FT   gene            complement(447076..447333)
FT                   /locus_tag="SSO6008"
FT   CDS_pept        complement(447076..447333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO6008"
FT                   /product="Second ORF in transposon ISC1229"
FT                   /note="ISC1229 split by another IS element"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40835"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR6"
FT                   /protein_id="AAK40835.1"
FT                   /translation="MVNNAREYVNNPLKELVSLYLFMKDAQTKQENRLRRALFLVSDEE
FT                   KLSEERLEKFSKGDFSDVKLYQLEYTGTVLRQYGNLIFLI"
FT   gene            complement(447338..447715)
FT                   /locus_tag="SSO0518"
FT   CDS_pept        complement(447338..447715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0518"
FT                   /product="First ORF in transposon ISC1229"
FT                   /note="ISC1229 split by another IS element"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40836"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX3"
FT                   /protein_id="AAK40836.1"
FT                   /translation="MVDLVTEAKSSGEGVTSPYSQTEHCENIHEYRCDTRVGVIGIDVS
FT                   KEHLVTSKGRVRKFTNNEKGYEEILTMKPNIIVIEPTRVYSTRPCQYFKERGVKVLLVS
FT                   TTLLWKEKDVRGKRFLRRRKT"
FT   gene            complement(447894..448625)
FT                   /locus_tag="SSO0519"
FT   CDS_pept        complement(447894..448625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0519"
FT                   /product="Hypothetical protein"
FT                   /note="Putative SSV1 virus ORF C-792 fragment"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40837"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX2"
FT                   /protein_id="AAK40837.1"
FT                   /translation="MKWFLLLLLVFGVLGIIPITNGVITGPHPQFDSGGGFAGPFFTYS
FT                   KTMTIQSGQSQTKNNGSTLSSAQWLNPSYVSIYNTYYLQILPNQEYISNNVSFSLSASQ
FT                   IAINVTFLLASSSNSGAFGSLAIGYGTYIPSTFTNAFAPSVPSSGITVYLMKGGMNTYH
FT                   LFVYFDGVKQLNVSVGSISIGEQIGLGFYYLPASNQLYVYYYNGSVKTFSLTPSQVVGT
FT                   NVLGVFSNSHEIRKTFVKILE"
FT   gene            complement(448668..448982)
FT                   /locus_tag="SSO0520"
FT   CDS_pept        complement(448668..448982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0520"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40838"
FT                   /db_xref="GOA:Q7LXX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX1"
FT                   /protein_id="AAK40838.1"
FT                   /translation="MKKSVLTTLVIALVLLGTSLYLYSVNHPEKTVITIPSPYTYTVSI
FT                   NTTTLTAPIGVPFEGPIIATTFIHTNYTPPPYYASLWLETLAVGIVLLLISILLLRRKF
FT                   "
FT   gene            complement(449346..449660)
FT                   /locus_tag="SSO0521"
FT   CDS_pept        complement(449346..449660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40839"
FT                   /db_xref="GOA:Q7LXX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXX0"
FT                   /protein_id="AAK40839.1"
FT                   /translation="MKRSIVLLSMVSIVLIVLGGYLFAIDKPTVVYPEIKGQIITETGV
FT                   PNAYWWGYPAIIVTPQELAQLKQLAPHIVPPPWYATLWPIPLVGGIVGLIYSVVRLLKK
FT                   "
FT   gene            complement(450009..450920)
FT                   /locus_tag="SSO0522"
FT   CDS_pept        complement(450009..450920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0522"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40840"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW9"
FT                   /protein_id="AAK40840.1"
FT                   /translation="MKRHLLLVAPLFLLLISLNALAVTANQLGASTILTTYNSDNWAGV
FT                   AYADEWRSGVTNYWAVVQWASESIYVGNLSFAYAGYTNPNAVSIWVGLSPAKIGVGTDA
FT                   STSEVTNTFAQAGYVIHVYSNGVVTAEYFVMVLNNGQILPNFVEAPVPAGVPAYLDVFL
FT                   DNLFNYTELAQFYVFYKNGSYWSTSVYISTPFNTTGSAMSIVEAPQPTENGNNHFELPL
FT                   MQGGMIHFTFGYVGPNKNDYSGPGNAPSGTTMYAVLFNLNEASYYNTAEAVIANGWANS
FT                   LGGWDYLYQFIYPDLGITTTGL"
FT   gene            complement(450970..451329)
FT                   /locus_tag="SSO0523"
FT   CDS_pept        complement(450970..451329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0523"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40841"
FT                   /db_xref="GOA:Q7LXW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW8"
FT                   /protein_id="AAK40841.1"
FT                   /translation="MRILKIVWVLFILLNVYDVVISAIYAIPGTITDGAVWETNLIISL
FT                   YAYYEGSISFVLAVLMLISLKLLLFTGVYWYTKLFDLLKVSKYKWLSLLPFIAVSFLVD
FT                   LGSTSVLISQHIPPF"
FT   gene            complement(451340..451531)
FT                   /locus_tag="SSO6024"
FT   CDS_pept        complement(451340..451531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO6024"
FT                   /product="SSV1 virus orf B-129 fragment homolog"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40842"
FT                   /db_xref="GOA:Q97ZR5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR5"
FT                   /protein_id="AAK40842.1"
FT                   /translation="MTAKAVSPFVCPICLTPFSSSSALKQHIRYEEHGKECQICKKRFT
FT                   TTDATLDHICKKHNICVK"
FT   gene            451779..452717
FT                   /locus_tag="SSO0524"
FT   CDS_pept        451779..452717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0524"
FT                   /product="Transposase ISC1234"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40843"
FT                   /db_xref="GOA:Q7LXW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW7"
FT                   /protein_id="AAK40843.1"
FT                   /translation="MTRTLRNVPNLMYYPLPPIEDMPWREKWLTEIKPVLDTMDLERVL
FT                   GEGALVYLKLLVVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVGRLYGVRK
FT                   KLLEISFKLEEKCLPSYLPASAHLVDFMAWLVDSFLLDLPPGKRSVETFREKAELERRE
FT                   GNLERARKLLSLGRTKRRFEGRWTKKRGVSHYGLKAVAVISVSLFVRSITVKPANFSDK
FT                   RFKSPLKGIKIADRGFSPSPTQLIAREKPFTTLRVHVEFFGTYLNAFWRPYGTTTWRND
FT                   VFLHVLGVIYNIKMFLAIQRRTPPGRRAVQL"
FT   gene            complement(453232..453321)
FT                   /locus_tag="SSOt25"
FT   tRNA            complement(453232..453321)
FT                   /locus_tag="SSOt25"
FT                   /product="tRNA-Glu"
FT   gene            454795..455271
FT                   /locus_tag="SSO0525"
FT   CDS_pept        454795..455271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0525"
FT                   /product="First ORF in a partial transposon ISC1439"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40844"
FT                   /db_xref="GOA:Q7LXW6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW6"
FT                   /protein_id="AAK40844.1"
FT                   /translation="MQGFSYKCYWKRKGIKMRSLDFVYPLRLPLLVEIADLRSDSPSQF
FT                   LLRSVREVSQYMEIDYVVADAGFLNLDAIKEMPVKTIVRGKSNLKRSKELSNVPLVEKR
FT                   YEVKDKVYVAYRVLKFEGLYYYDVVYVKGKPRHFIFVTNFEGDPYELAELYRLK"
FT   gene            455268..455459
FT                   /locus_tag="SSO6050"
FT   CDS_pept        455268..455459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO6050"
FT                   /product="Second ORF in a partial transposon ISC1439"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40845"
FT                   /db_xref="GOA:Q97ZR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR4"
FT                   /protein_id="AAK40845.1"
FT                   /translation="MIEESFKVRKARIRYVRKLSNKIFLFLYYTVLDSAWNLVNYLLFN
FT                   FKSTCKKVLSFDSFVKLL"
FT   gene            456133..456918
FT                   /locus_tag="SSO0526"
FT   CDS_pept        456133..456918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0526"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40846"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW5"
FT                   /protein_id="AAK40846.1"
FT                   /translation="MLLEAQKLIFDIFKKDKNDEIKEPFYADEYGEWLIVSHNKPLVYI
FT                   SNILQKSIKKAGLKNHDLYVIQYIEDEKIRNLASIKGMICGNGNIKELDLATTIKNSLS
FT                   DTLTVGEIKIFKLKICGILFIFFYIDVVVRNLKETRGSVKLLFPPIGVSLYEIPYTLQS
FT                   LIKSVIEKTLGVNCSVSEIDTGDGTRLKAVAECRIQQTLESIEPLKKALEYFSFSEPKI
FT                   SLNRSNIRQIELQIFINQLKTKALIPLIWDRFIIDSLRC"
FT   gene            456948..458195
FT                   /locus_tag="SSO0527"
FT   CDS_pept        456948..458195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0527"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Energy Metabolism, Gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40847"
FT                   /db_xref="GOA:P50317"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50317"
FT                   /protein_id="AAK40847.1"
FT                   /translation="MGIFLIKVGDLTIPTMDDIDIQSKKVLLRIDINSPVDENGKIIDD
FT                   SRIKAHIGTIKELINKGNSVVLISHQGRPGDKDFTSLEEHAKLISKYLDREVIFVDDVI
FT                   GPYAREMIKKLENNGILLLDNIRLISEELIEAPPQQHVKSFLVKKLAPLFDIYINDAFA
FT                   TAHRSQPSIVGFPLALPSAAGRVMEREVSALAKIFNAEDTPKIFTLGGGKVHDTIRIIE
FT                   NLVRKRIADRILTGGLVAELFSVAKGMNLNPKNMEILEKLGILSLIPRARKLLLSGAPI
FT                   EIPVDYKVEINGNVIEEPASKVTGIIKDIGSTTAEIYSSFIKDAKVVVLRGPMGVIEDE
FT                   RFKSGSKSVLKASLEGQGYVIIGGGHMISALDEDMKIDSSKVHISTGGGALLLFLSGER
FT                   LPALEALSMSVVNSGD"
FT   gene            458188..459210
FT                   /gene="gap"
FT                   /locus_tag="SSO0528"
FT   CDS_pept        458188..459210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="SSO0528"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
FT                   (gap)"
FT                   /EC_number="1.2.1.12"
FT                   /note="Energy Metabolism, Gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40848"
FT                   /db_xref="GOA:P39460"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:1B7G"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39460"
FT                   /protein_id="AAK40848.1"
FT                   /translation="MINVAVNGYGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHR
FT                   RGIRIYVPQQSIKKFEESGIPVAGTVEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNA
FT                   IFQGGEKAEVADISFSALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVSKVEKVRAT
FT                   IVRRAADQKEVKKGPINSLVPDPATVPSHHAKDVNSVIRNLDIATMAVIAPTTLMHMHF
FT                   INITLKDKVEKKDILSVLENTPRIVLISSKYDAEATAELVEVARDLKRDRNDIPEVMIF
FT                   SDSIYVKDDEVMLMYAVHQESIVVPENIDAIRASMKLMSAEDSMRITNESLGILKGYLI
FT                   "
FT   gene            459207..459617
FT                   /locus_tag="SSO0529"
FT   CDS_pept        459207..459617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0529"
FT                   /product="Hypothetical protein"
FT                   /note="Related to UspA stress proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40849"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW4"
FT                   /protein_id="AAK40849.1"
FT                   /translation="MSEPSYFVSFWLRKILVPVDGSENSLRALDLAVDFGMRYGSKITI
FT                   IHVCSDCNNMNDIQSLIEKRINNKIEYDLKIVKINIKESSVSNEILKVINEEPYDAIIM
FT                   GARGTSLNSDINIGSTALAISINAPVSVILVR"
FT   gene            complement(459610..460911)
FT                   /gene="glyA"
FT                   /locus_tag="SSO0530"
FT   CDS_pept        complement(459610..460911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="SSO0530"
FT                   /product="Serine hydroxymethyltransferase (glyA)"
FT                   /EC_number="2.1.2.1"
FT                   /note="Amino Acid Biosynthesis, Serine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40850"
FT                   /db_xref="GOA:Q9UWT5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWT5"
FT                   /protein_id="AAK40850.1"
FT                   /translation="MSLPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMS
FT                   DFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITNSKDCDLRPTSGTIANAAVFRV
FT                   LAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVK
FT                   PKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYGLIEGKVWSNPLKDGADIMT
FT                   VSTHKTFPGPQGGAIFSDGSEVFKQVSKTIFPWFVSNHHLHRLPATAVTAIEMKYFGES
FT                   YANQILRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANII
FT                   VNKNLLPYDKPEDVSDPSGLRIGVQEMTRYGMKEGEMEEIAELFKKVIIDKKDVNEVKK
FT                   EVIEMRRNFLEVKYTFDDMKDLEKYSSKSLKLII"
FT   gene            complement(460955..462184)
FT                   /locus_tag="SSO0531"
FT   CDS_pept        complement(460955..462184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0531"
FT                   /product="3 hydroxy 3 methylglutaryl coenzyme a reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40851"
FT                   /db_xref="GOA:O08424"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08424"
FT                   /protein_id="AAK40851.1"
FT                   /translation="MKIDEVVEKLVKGEISFHEVDNLLEANAAMVARRLALEKIVGVGL
FT                   PSIGSTVIDYSEIKNKNAENVIGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIA
FT                   SVNRGIKAVTLSGGVRAKVLKDEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANST
FT                   SHHGKLKSITPFVLGNNVWLRFSFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVS
FT                   GNMCSDKKQTNVNSLFGRGKTVVAEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARA
FT                   GSLSQFNAHFANIVTAIFIATGQDVAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTV
FT                   GGGTRLPTQKEALSIMGVYGSGNPPGSNAKKLAEIIASTVLSGELNLLAALSNKELGKA
FT                   HAKLGRAMKV"
FT   gene            complement(462181..462582)
FT                   /locus_tag="SSO0532"
FT   CDS_pept        complement(462181..462582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0532"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Unknown protein in pyrococcus furiosus aca operon"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40852"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW3"
FT                   /protein_id="AAK40852.1"
FT                   /translation="MKIAPPQVWRNKRFMYKLTASRCERCGHISFPYSSYCTKCGSKNV
FT                   KKIEISGKGVLESYTVSYQSRDGHEKGLPSVIGLVRLDEGVEIVAPIVDADLDKLKEGV
FT                   KVEATLRRVYTDSYNGLIQYGIKFRVAEG"
FT   gene            complement(462588..463667)
FT                   /gene="acaB-1"
FT                   /locus_tag="SSO0534"
FT   CDS_pept        complement(462588..463667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acaB-1"
FT                   /locus_tag="SSO0534"
FT                   /product="Acetyl-CoA c-acetyltransferase (acetoacetyl-CoA
FT                   thiolase) (acaB-1)"
FT                   /EC_number="2.3.1.9"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40853"
FT                   /db_xref="GOA:Q7LXW2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW2"
FT                   /protein_id="AAK40853.1"
FT                   /translation="MVEVYLNSSSMIPIDRYYEYDIYDLVIEAYKNFEGEYDVNSIDLI
FT                   VVANAYSQKLNNASLIAPKIAEKIGKPNVPSIKVDNADASGGAALLTAYSLIKSNMVNS
FT                   VLIVGVEKQSDYPSKYLYDAISTNLDDYMFYNGISSHSVAALLMRQYMKRYGVDRNYFA
FT                   NWAIKMHKNATENPFAYLRFQVDLNTVINSQIISDPVRLFDVGARADGAAILLLSNNKT
FT                   ESAVKINKILSAQARYDFSPSLPSVRMLRDKLELKFSERTGIDIHDSYSIMAALMLEEA
FT                   GIFESGKSLHNLDSVNVNLGGGLKARGHVGGASAIYQLAEAHMQLIGSFKGKKASVDNY
FT                   IVISSDDLGMVSYGINLSR"
FT   gene            complement(463667..464719)
FT                   /locus_tag="SSO0535"
FT   CDS_pept        complement(463667..464719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0535"
FT                   /product="Acyl carrier protein synthase"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40854"
FT                   /db_xref="GOA:Q9UWU0"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWU0"
FT                   /protein_id="AAK40854.1"
FT                   /translation="MLSGILGWGAYIPRYRIKVEDIAKMWGYDEAVVKSLGLTEKSVPG
FT                   HDEDSTTIAWESSINAIKRAQVDTSKIRLVLFGSESKVYAVKPTSTILIDALGINNYSA
FT                   TADMEFACRAASVGLRLASSFVLHNNDSYALVIGADTAQSNPGDVLELSSAAAGVAFVV
FT                   GKTDEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYFHHIISAVNDLLQ
FT                   NSGLKISDFDYFVFHQPNGKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAK
FT                   VLDIAKPGERILVAPFGSGAGSDAFSILVSEGILAKQKLAKTVEYYINNKKLVSYAEYA
FT                   KYTNKIKVYE"
FT   gene            complement(464828..465232)
FT                   /locus_tag="SSO0536"
FT   CDS_pept        complement(464828..465232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0536"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40855"
FT                   /db_xref="GOA:Q9UWU1"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="InterPro:IPR027549"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWU1"
FT                   /protein_id="AAK40855.1"
FT                   /translation="MSEREVLQKINSPEGKEDRIIGKHVFGNLYDIDAERLNDKEFLEK
FT                   LVLEAVDIAHMKLVEIKAWSFGGKKGGVSVIALVEESHIALHTWNEYNYATLDVYTCGE
FT                   DSDPQSAFAHIVNALNPKRYQMFYADRSSQ"
FT   gene            465344..466165
FT                   /locus_tag="SSO0537"
FT   CDS_pept        465344..466165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0537"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40856"
FT                   /db_xref="GOA:Q7LXW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW1"
FT                   /protein_id="AAK40856.1"
FT                   /translation="MAKSIGIGSILIIISIIIIGSVATIFYLENVDVNISVNPIYWRIY
FT                   SNNYEVIAFAITATNNAPLTQTLNITLLSRYLVPGSNGVLKIIANSTTITLKSHSSSTA
FT                   IVYLTFSSSTLFPEIEEFKVLVHGLYGYSKQFGDVNTIYTTGLTRNIALLMGINQNQLP
FT                   TFSLVGSFTPSANFNYSYSIVYYQYNYTSNTSFLFTKFTISPLANQYLQPGKYNVTLSY
FT                   LDHANSFLINIPRNTPVYFYLFVPMANFNMTVILQGQGVKYQGYFTVSIIS"
FT   gene            466224..466315
FT                   /locus_tag="SSOt26"
FT   tRNA            466224..466315
FT                   /locus_tag="SSOt26"
FT                   /product="tRNA-Met"
FT                   /note="1 intron"
FT   gene            complement(466421..466963)
FT                   /locus_tag="SSO0538"
FT   CDS_pept        complement(466421..466963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0538"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40857"
FT                   /db_xref="GOA:Q7LXW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXW0"
FT                   /protein_id="AAK40857.1"
FT                   /translation="MEEKRLSFFKWLGLALLFIVLPSAVAVVLSFSVPYYILHDMTLAN
FT                   ALSTIIFILGFGVSAIYFNRYLESRGLITPFMKRVSITILPDSGQPIDEKYIKSFEARL
FT                   KFAKGEEYIKLLAMLGMMYLQNAVAYDNKDFYLRAKEYLSRAEEAMQEKSVSFETKALV
FT                   DNLRSKIETYKYRFGER"
FT   gene            complement(467074..467478)
FT                   /locus_tag="SSO0539"
FT   CDS_pept        complement(467074..467478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0539"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40858"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV9"
FT                   /protein_id="AAK40858.1"
FT                   /translation="MPQSLKPKSIKLLHYEEKKDDKRIFRQGVTLIEYEGQPSKIIQWS
FT                   QLIEGDPFGDHEITYRINYGSESELRSFKVKYLGREGDKHRVLIKEGVSGCGTKTKRIE
FT                   NKEVLISDKLYQPYPLQQKNEEGRDPNPIE"
FT   gene            complement(467825..468256)
FT                   /locus_tag="SSO0540"
FT   CDS_pept        complement(467825..468256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0540"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40859"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV8"
FT                   /protein_id="AAK40859.1"
FT                   /translation="MSREIEVPFVKVNDTYLPLLKVEMECPKLGSEYLVYALPDTGSRF
FT                   SIIRNDTFLKCFDESSLKNRLVDKVIISNLLTTKERYNIKFHFVELNETLQIPVTSLDF
FT                   VNLGEGIYPSLILGREDFFSRIMICFERNVRLIIKANDL"
FT   gene            470914..471864
FT                   /locus_tag="SSO0541"
FT   CDS_pept        470914..471864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0541"
FT                   /product="Transposase ISC1173"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40860"
FT                   /db_xref="GOA:Q7LXV7"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV7"
FT                   /protein_id="AAK40860.1"
FT                   /translation="MNLVALAQLILFVLRNLNLKPRKHKPEEIALAIAAYVMGVQITKL
FT                   NIPPSTLYYYTRKLGVKRRKDVRPRCPSCNSDRVIKNGSSRGKSKYKCKVCGRTFYGTA
FT                   SHRMSREQRERILREYTNRMSLRGISKVEGRPLTTVYSSVKRAALKAYVDLSILQAQLK
FT                   AFRSKFAVLDESWTYVRVRRGPRRQNLWIWNALIDGVPFFVTGDRDYNTFRLLWLSLPK
FT                   CEVHYTDDYPIYQVLYHHVVGKKYTHTVESYNSFCRSHLARLARDTKAVNRSRAMIDYS
FT                   LALLNVMYPQVFTDEKTPLNLAYLSGVQYIRDHLI"
FT   gene            complement(473189..474277)
FT                   /locus_tag="SSO0543"
FT   CDS_pept        complement(473189..474277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0543"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40861"
FT                   /db_xref="GOA:Q7LXV6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV6"
FT                   /protein_id="AAK40861.1"
FT                   /translation="MNVMKKYVLTYRSIISFFVGFMSFAFIALMKISGLSGFQIGLILS
FT                   TISISQFIAYIILIAFSIRRNILVSAALELLIPIILIIQRSAFTFTLSAIFMGIVNSIN
FT                   SSVIIIQKEFTRKDYSIMMTLTYALSLAGLGIFYLSKIIGINTTLLLLFIPLLSLNLIL
FT                   TLMLRYEEKKESLSELYSWLKNVGKSVLVFGFFASLRRVLITSYIPLILLTLFYTYTPQ
FT                   EISLYLMIIQVPLIIFFYLGHKISVRIFITLSIVELILFLSLSIFYRESILLFLSLILL
FT                   ANMSSSLRAPVVEETVNKLLNFSTKISSFYHLMDTIFSALASILLAFMVKLDLFYGIFV
FT                   IAGLSSLLPSLFVYKVMLQQRK"
FT   gene            complement(474274..475011)
FT                   /locus_tag="SSO0544"
FT   CDS_pept        complement(474274..475011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0544"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40862"
FT                   /db_xref="GOA:Q7LXV5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV5"
FT                   /protein_id="AAK40862.1"
FT                   /translation="MVEEAIIQLTGGIDSTVLAYYLKKDKYVLHGTFIHYGYPPQIKEL
FT                   ELVKELSKKLDIPLKIIDFSSYIKSFDLPPIDSIQYIIKYQFVVEILASFSAYPNLNTM
FT                   FVGWLKDEWNNRISLLKDIESLMGFKVIAPFHTMVKSEVIKLGNELGVDFTKTHSCIVS
FT                   GKMHCGICMACRSRRRAFEEVKVKDPTIYYYNLPPAEVDKLSRELSLEEFVERFFKPFL
FT                   QYTGEYPKEFVDNLAHILRKYNG"
FT   gene            complement(475014..475874)
FT                   /locus_tag="SSO0545"
FT   CDS_pept        complement(475014..475874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0545"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40863"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV4"
FT                   /protein_id="AAK40863.1"
FT                   /translation="MKYSTQIKVEISSKVEYITGKNLIPKIKSIFSNIEIKIENSELED
FT                   KQFKDFLKSYYNFYDSSKIDTIFIIEVNLIDETYRGLGIGSYDTKTNISSLYFEWESTT
FT                   KYEVQAASGGSIICWDYSTYSKAYHGAVNISSVAGTLEGFPLEANVTYLTLNDEGEIVF
FT                   QGYQKGIVKTINGIRVGKVKLVGLIDEKFRLNTSPGYAVYLTQKNDNIMYGVYNQIQVD
FT                   PMGRMYYETAIREYKIYSGRKLPFDEVMIFKYKDANFNQIKSNKRIDSMSHIAYYMPAK
FT                   DPYGK"
FT   gene            477077..478162
FT                   /gene="pqqE-1"
FT                   /locus_tag="SSO0546"
FT   CDS_pept        477077..478162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE-1"
FT                   /locus_tag="SSO0546"
FT                   /product="Coenzyme PQQ synthesis protein E (pqqE-1)"
FT                   /note="Cofactor Biosynthesis, Quinones"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40864"
FT                   /db_xref="GOA:Q7LXV3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV3"
FT                   /protein_id="AAK40864.1"
FT                   /translation="MINRKPFFIELELTYKCSQQCIYCHNPPKDLKFYIADKVPKPRSV
FT                   IEMNELNLSEWISVINQIKRLDEKYEGIMDVVITGGEPLLRSDLEEILSYVTRQKLRHM
FT                   LLSSGEPISDDRITKLLESGLEKIRINLTSHKYVFNIQSPIMHIKNEVAKKINIAKKFK
FT                   DFGVKEVGGNIVLTSYYLDFLEEIAELAYKSNLDWIEIHSVIKVGHGYINQKFIVPDPN
FT                   DERTIQEKLKRLIEIYGENFIQNYVDTDILYSRIPIPTNWGEVGLVIAPNGDIYPSSEA
FT                   TSIPLSKLGNIKNDSLVEIWFNNLLLNKIRSLSFLREPCKSCEVKKLCRGGFRFNAYIT
FT                   KNDLFAPDPSCQIVKDYIGKS"
FT   gene            478181..479362
FT                   /locus_tag="SSO0548"
FT   CDS_pept        478181..479362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0548"
FT                   /product="Multidrug resistance related protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40865"
FT                   /db_xref="GOA:Q7LXV2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV2"
FT                   /protein_id="AAK40865.1"
FT                   /translation="MGLKQTLKEIYYIVADKRLLYFSLSLGISTFAYSLLTYYFPIIMT
FT                   NLDITTFTIGIIYSIISFLYVVFNIPLGAIVDKIGSKNAVTLSALMAVPLFLLMGTLNP
FT                   LLFIISLVIFESVIRIVNSLGAHRFMLNYTNAGKAFGVFSLITSILAAIGIMLGGYLLQ
FT                   HSVSTLLFTIIAVLFGISGIIRFLELPKDENKVEVKRSLRLGFKYLKEDKKLLLYLLVS
FT                   ILSSGLSLETYYVTIYFVKDLLLPLTFVGVLYSSYALIMAFLPLLFSVILSKRSNFKNL
FT                   SILIFSNSVIFFLVPLFTNVYILFLLFYAWTVIVAMESIVDYNVAQSVTKPEIRGTQVA
FT                   LISTFVRIFSVFYNAIVGLLFQITPLYSFYFTGFLGILAIFTIKFAEFIGVLK"
FT   gene            complement(481138..482103)
FT                   /locus_tag="SSO0549"
FT   CDS_pept        complement(481138..482103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0549"
FT                   /product="Transposase ISC1439"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40866"
FT                   /db_xref="GOA:Q7LXV1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV1"
FT                   /protein_id="AAK40866.1"
FT                   /translation="MQTMILPKTELKSLAITLATNNINVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDRVYVAYRVLKFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            482449..483393
FT                   /locus_tag="SSO0550"
FT   CDS_pept        482449..483393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0550"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40867"
FT                   /db_xref="GOA:Q7LXV0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXV0"
FT                   /protein_id="AAK40867.1"
FT                   /translation="MRMSLRIAILLFLLFLAFSLGFVIQYFLQVFGITNQSTINSVIFY
FT                   LRIALYVFIGLWIVSSISEAIRVYSQRRLGIRANVIANSVRYFGYVIVFLLVLLPLGVG
FT                   SSTLIAGSTFAGLIIGLALQPVLSNFFAGLLIMLTGYIVVGDKIRVLSTQVPFFPAQFP
FT                   AYKYFSTDFIEQGYKGTVVEIDLFYSRVLLENLRELRVPNIVLLNSAVLDYTSKYSEEH
FT                   VINVRVEFPLAFIDINKLEDIVKEELKDFNVVEGPYINEQSDKDHVIVLARLKVGVSED
FT                   WRKIKSNALKRLLRLRQELIDKKSQDSQQTKIS"
FT   gene            complement(484290..484916)
FT                   /locus_tag="SSO0551"
FT   CDS_pept        complement(484290..484916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40868"
FT                   /db_xref="GOA:Q9UWV6"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="PDB:5AP8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWV6"
FT                   /protein_id="AAK40868.1"
FT                   /translation="MKPKPLKCITSHHYIIKFYDKSNLRTSLYLLIFKEHKDYREQMKV
FT                   YIIDYHKDDPKRCTGKKLVKLKIAEFTRVGKGVVLDPFAQITLSNKDKDIVRRIGITIV
FT                   DTSWNNTSQSEFKNIRGEHRRIPILFAGNPIHYGIAYKLSSIEALIATLYIVDEVEEAI
FT                   KLSNVVKWGHTFIELNKELLEAYKNKTEEDIKKIEREIIEKILEK"
FT   gene            complement(485808..485882)
FT                   /locus_tag="SSOt27"
FT   tRNA            complement(485808..485882)
FT                   /locus_tag="SSOt27"
FT                   /product="tRNA-Arg"
FT   gene            486104..488752
FT                   /gene="dpo1"
FT                   /locus_tag="SSO0552"
FT   CDS_pept        486104..488752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpo1"
FT                   /locus_tag="SSO0552"
FT                   /product="DNA polymerase I (DNA polymerase B1) (dpo1)"
FT                   /EC_number="2.7.7.7"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40869"
FT                   /db_xref="GOA:P26811"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="PDB:1S5J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26811"
FT                   /protein_id="AAK40869.1"
FT                   /translation="MTKQLTLFDIPSSKPAKSEQNTQQSQQSAPVEEKKVVRREWLEEA
FT                   QENKIYFLLQVDYDGKKGKAVCKLFDKETQKIYALYDNTGHKPYFLVDLEPDKVGKIPK
FT                   IVRDPSFDHIETVSKIDPYTWNKFKLTKIVVRDPLAVRRLRNDVPKAYEAHIKYFNNYM
FT                   YDIGLIPGMPYVVKNGKLESVYLSLDEKDVEEIKKAFADSDEMTRQMAVDWLPIFETEI
FT                   PKIKRVAIDIEVYTPVKGRIPDSQKAEFPIISIALAGSDGLKKVLVLNRNDVNEGSVKL
FT                   DGISVERFNTEYELLGRFFDILLEYPIVLTFNGDDFDLPYIYFRALKLGYFPEEIPIDV
FT                   AGKDEAKYLAGLHIDLYKFFFNKAVRNYAFEGKYNEYNLDAVAKALLGTSKVKVDTLIS
FT                   FLDVEKLIEYNFRDAEITLQLTTFNNDLTMKLIVLFSRISRLGIEELTRTEISTWVKNL
FT                   YYWEHRKRNWLIPLKEEILAKSSNIRTSALIKGKGYKGAVVIDPPAGIFFNITVLDFAS
FT                   LYPSIIRTWNLSYETVDIQQCKKPYEVKDETGEVLHIVCMDRPGITAVITGLLRDFRVK
FT                   IYKKKAKNPNNSEEQKLLYDVVQRAMKVFINATYGVFGAETFPLYAPAVAESVTALGRY
FT                   VITSTVKKAREEGLTVLYGDTDSLFLLNPPKNSLENIIKWVKTTFNLDLEVDKTYKFVA
FT                   FSGLKKNYFGVYQDGKVDIKGMLVKKRNTPEFVKKVFNEVKELMISINSPNDVKEIKRK
FT                   IVDVVKGSYEKLKNKGYNLDELAFKVMLSKPLDAYKKNTPQHVKAALQLRPFGVNVLPR
FT                   DIIYYVKVRSKDGVKPVQLAKVTEIDAEKYLEALRSTFEQILRAFGVSWDEIAATMSID
FT                   SFFSYPSKGNS"
FT   gene            complement(488848..489288)
FT                   /locus_tag="SSO0553"
FT   CDS_pept        complement(488848..489288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0553"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40870"
FT                   /db_xref="InterPro:IPR017006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU9"
FT                   /protein_id="AAK40870.1"
FT                   /translation="MKILIVKSENGKVTSEKVAEGEISKVLRDVAKEALEEWNELASDF
FT                   IIMRDNQEVRLPLPLKPEVYEAIKTFLIGKDKKEAIAKIPVYIISYENEWKESDFQDKK
FT                   IYVVSFYINDEIKKDVLNDAAQMTSEQKQEELKEELEEEEEE"
FT   gene            complement(489285..489770)
FT                   /locus_tag="SSO0554"
FT   CDS_pept        complement(489285..489770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0554"
FT                   /product="Ribosomal protein L11 methyltransferase,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40871"
FT                   /db_xref="GOA:Q7LXU8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU8"
FT                   /protein_id="AAK40871.1"
FT                   /translation="MSYVPHVPYVPTPEKVVRRMLEIAKASQDDIVYDLGCGDGRIIIT
FT                   AVKDFNVKKAIGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLL
FT                   TNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVVKVEDGNMNHTVYLYVIGEHK"
FT   gene            complement(489798..490109)
FT                   /locus_tag="SSO0555"
FT   CDS_pept        complement(489798..490109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0555"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40872"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU7"
FT                   /protein_id="AAK40872.1"
FT                   /translation="MTAKKLILVTSESHPLHKVFMETLEELSKELNLEKEVKIEDYAFL
FT                   ADYGEKDEFDMPFLPQLLAQTDDGKIIPVLTKMPFDASLKPDKKAGKEEAIKKIKNLG"
FT   gene            490144..490731
FT                   /gene="pgsA"
FT                   /locus_tag="SSO0556"
FT   CDS_pept        490144..490731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="SSO0556"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase, putataive (pgsA)"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40873"
FT                   /db_xref="GOA:Q7LXU6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU6"
FT                   /protein_id="AAK40873.1"
FT                   /translation="MVSMLTRIRRQIKRVIEPLAKTLAQLKVSANFITMLGLIFAIVYY
FT                   FEIMRSNTTLGIIFLVFSALMDAIDGEVARVSKTVSPLGSFLDSTLDRIEDILYISAFI
FT                   FLGFSSYLVAIAVGLSLTISYIRAKAESLGLKMEGRGIIERGERIIFVFVILLLYIIVS
FT                   KQVSLYLFYLFMLLTAITVIQRFYAVYSLLRK"
FT   gene            complement(490710..491633)
FT                   /locus_tag="SSO0557"
FT   CDS_pept        complement(490710..491633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0557"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40874"
FT                   /db_xref="GOA:Q9UWW1"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="PDB:1ZT2"
FT                   /db_xref="PDB:5OF3"
FT                   /db_xref="PDB:5OFN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW1"
FT                   /protein_id="AAK40874.1"
FT                   /translation="MALDVKKYPFIKSLDDELKKYGGGITLTDLLLNSTTLIDQAKDRI
FT                   QKTKSGDELPHYVSYNEPVLVFYTTLLSLAILNDVKLIRRYAYAEAKQFRSLLHTENEE
FT                   NLLEISKLLDLKINRCDPIKFYLEKKRRIIQKEFCVHFIDYLKYTKDLKEDWKLSGQIL
FT                   HKGYVYLDKNQLIGLIAESIKSKIVEMIRPLNLKEIPEKLKSLIERRGIIPPCIENILA
FT                   KEKLNEEEIRTLITFYIDIGKGLSGIVSIMKKYNVSNVEDLYRKYRGDKGTRYIVYSCA
FT                   KMKQLGLCVSSCNVKNPLQLYFLSNE"
FT   gene            491695..493416
FT                   /gene="metS"
FT                   /locus_tag="SSO0558"
FT   CDS_pept        491695..493416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SSO0558"
FT                   /product="Methionyl-tRNA synthetase (metS)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40875"
FT                   /db_xref="GOA:Q9UWW2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW2"
FT                   /protein_id="AAK40875.1"
FT                   /translation="MKVLVTAAWPYVNSVPHLGNLIGSILSADVFARYARLRYGKENVL
FT                   FVSGSDEHGTPIEIEAIKRKVNPKELTDQAHEYDRHLFLNVWKISFDNYTRTESEIHKK
FT                   FVREFLLKLTKYIKVSEDEIPYCENDKLYLPDRFVKGTCPYCGFEDARGDQCDNCGKLL
FT                   TPSLLVNPKCSICGKTPVFKKTKHWFFDLSEFNDKIRGWISSSNEMPDNVKSVALSWVG
FT                   EGLKPRSITRDNKWGIPAPFEGAQDKSIYVWFEALLGYISAVIEYFERKGDQEKWKEYW
FT                   FGPNIKSYYFIGKDNIPFHAVILPAMLMASEEEYHLPDVIAATEYLLYEGQKFSKSRKI
FT                   GVWIDEAPELMDVEYWRFVLIRLRPEEKDTNFTWRETVRIVNTELNDDIGNYVNRVLSM
FT                   VNRYYSGIVPEFKIDILDDNDRKIISLINETPKVVGDLFEKGKLKAGTEEMLKFVRECN
FT                   AYLNMKAPWDLYKSGKEIELKNTLYIGTNSVKTIAILLYPLMPSHAQKIYEMLNMGNIE
FT                   NEKWDVASTLSVNPGHKIGKVNVLFKKLEPEFESKIKDKLEKIRKDIEKIRPTLLK"
FT   gene            complement(493405..495510)
FT                   /gene="atpI"
FT                   /locus_tag="SSO0559"
FT   CDS_pept        complement(493405..495510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="SSO0559"
FT                   /product="ATP synthase subunit 1 (atpI)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40876"
FT                   /db_xref="GOA:Q9UWW3"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW3"
FT                   /protein_id="AAK40876.1"
FT                   /translation="MLLPENMVRLQIISDKSAIDPIITKLLKLGMFQPEDPLYPLGNER
FT                   IEDARRLITAVQDHVSKLKIIMELGGLVIEPLGSIKVSSWIKAAQDVSEEASKLEERYK
FT                   ELLEEIGRLRSEKDLYQQQLKELEPIKSITVELSKLYSLELFDVILAQVDEDKLRLINQ
FT                   IIGDSNFVYYTRFGEERYIVLIIAEKNINVDKKLREAGVRRYELQEGKSPFQLYNEILE
FT                   RINQINIILERTREELAKKVKTEENYIKNVYGKLLTVRDALNIMNKARVSEYYLQIEGY
FT                   FPEKHVKKVQNEINNLAFMDYIRPRRYGEKEEPPTLVELPKSIKVLESLVEIYGSPSYW
FT                   EISPIVFLVFTFPILFGLMFPDFGNALVLLLFSIWFYRYGKKRGSENIPKLSIILIYSS
FT                   IVAIITGLLARDFFGPLPVGGLREILNNGNYSAGPLYNLWPIPASVSEAIKFLLPFGEY
FT                   STSVSIENTMIFSVLLGALALFVSSLLGVIDAIRKKDPEFLFLEKLPLFLLYVVPIFIF
FT                   MYGITDPANFFTVDQQILGQILNAVLMKSFSENIVGYGIVWWTSFALLYNWAAHAILVK
FT                   RHDNATWGSAIAMGFIEGGFEGALLLLSNTISFIRVLVFALSHYYILYAFSYMAYLVAP
FT                   STTTIGVLINPIAIIILIIGNLLAIGLEGLVVFIQDLRLHFYEMFSKFYEGRGRKFEPV
FT                   MAYVSLE"
FT   gene            495585..495887
FT                   /gene="atpF"
FT                   /locus_tag="SSO0560"
FT   CDS_pept        495585..495887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="SSO0560"
FT                   /product="ATP synthase subunit F (atpF)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40877"
FT                   /db_xref="GOA:Q97ZR3"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR3"
FT                   /protein_id="AAK40877.1"
FT                   /translation="MGKVFVVGDKYTVSLFRMVGTEGDFIDDPYNLPDIISKLKKREDI
FT                   DLILITKDMYEPIRGKIDPLIADQRKPLITIIPSPFSESKPLDVRKMIMKALGFG"
FT   gene            495893..496477
FT                   /gene="atpE"
FT                   /locus_tag="SSO0561"
FT   CDS_pept        495893..496477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="SSO0561"
FT                   /product="ATP synthase subunit E (atpE)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40878"
FT                   /db_xref="GOA:Q9UWW5"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW5"
FT                   /protein_id="AAK40878.1"
FT                   /translation="MDFEQLLDKSLNKVREEIKTELSKSLDEAIKLLNEGHNKIVQEYS
FT                   QRINELIVKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLGKIGEVVKTKEYKD
FT                   AIENIISKEIKEIREEKVTIYCSPNDKLMIEKIVGNNKNVTVKTDEKMLGGIKIYFERS
FT                   GLTRDFSLKLILDQVFDSMRGKISDMLFGGK"
FT   gene            496480..498258
FT                   /gene="atpA"
FT                   /locus_tag="SSO0563"
FT   CDS_pept        496480..498258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="SSO0563"
FT                   /product="ATP synthase subunit A (atpA)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40879"
FT                   /db_xref="GOA:Q9UWW6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW6"
FT                   /protein_id="AAK40879.1"
FT                   /translation="MDNGRIVRINGPLVVADNMRNAQMYEVVEVGEPRLIGEITRIEGD
FT                   RAFIQVYEDTSGIKPNEPVYRTGAPLSIELGPGLIGKIFDGLQRPLDSIKELTKSPFIA
FT                   RGIKVPSIDRKTKWHFVPKVKKGDKVEGGSIIGIVNETPLVEHRILVPPYVHGTLKEVV
FT                   AEGDYTVEDPIAIVDMNGDEVPVKLMQKWPVRIPRPFKEKLEPTEPLLTGTRVLDTIFP
FT                   IAKGGTAAIPGPFGSGKTVTLQSLAKWSAAKIVIYVGCGERGNEMTDELRQFPSLKDPW
FT                   TGRPLLERTILVANTSNMPVAAREASIYVGITMAEYFRDQGYDTLLVADSTSRWAEALR
FT                   DLGGRMEEMPAEEGFPSYLPSRLAEYYERAGRVKTIGNPERFGSVTVASAVSPPGGDFT
FT                   EPVTSQTLRFVKVFWPLDVSLAQARHYPAINWLQGFSAYVDLVANWWNTNVDPKWREMR
FT                   DMMVRTLIREDELRQIVRLVGPESLAEKDKLILETARLIKEAFLKQNAYDDIDAFSSPQ
FT                   KQARIMRLIYLFNTYASKLVERGIPTKKIVDSMGQLLPEIIRSKAAIKNDELNRYDELE
FT                   RKLITVFENLEKEAGT"
FT   gene            498258..499649
FT                   /gene="atpB"
FT                   /locus_tag="SSO0564"
FT   CDS_pept        498258..499649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="SSO0564"
FT                   /product="ATP synthase subunit B (atpB)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40880"
FT                   /db_xref="GOA:Q9UWW8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW8"
FT                   /protein_id="AAK40880.1"
FT                   /translation="MLSVREFSNISMIKGPLVYVQGVTDASYNELVEIEMPNGERRRGL
FT                   VIDSQMGIAIVQVFEGTTGVSPTGTKIRMLGRGLEVKISEEMLGRIFNPLGDSLDNGPP
FT                   VIKGEKRDINGSPLNPAAREYPEEFIQTGISAIDGLNALLRGQKLPIFSGSGLPANMLA
FT                   AQIAKQATVRGEESNFAVVFAAIGARYDDALFFRKFFEETGAINRVAMIVSLANEPPVM
FT                   KTLTPKTALTLAEYLAFEQDMHVLAILIDMTNYCEALREISAAREEVPGRGGYPGYMYT
FT                   DLATIYERAGKVIGKKGSITQMPILTMPNDDITHPIPDLTGYITEGQIVLDRALYNKGI
FT                   YPPINVLMSLSRLAKDGIGEGKTRDDHKDVSNQLFASYARAVDTRGLAAIIGEDSLSEV
FT                   DRKYLLFGELFERKFVSQGFNENRSIETTLDIGWEILSVLPESELTNIKTQYIQKYHPN
FT                   YRGKK"
FT   gene            499646..500287
FT                   /gene="atpD"
FT                   /locus_tag="SSO0566"
FT   CDS_pept        499646..500287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="SSO0566"
FT                   /product="ATP synthase subunit D (atpD)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40881"
FT                   /db_xref="GOA:Q9UWW9"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWW9"
FT                   /protein_id="AAK40881.1"
FT                   /translation="MSQKVLPTKINLIQFRRQLRLITVIKRLLENKREVLLLYLRTYAS
FT                   QYEKIYNEVNEEMKKVYESYLQAVASEGISNIEEMALSQKPSLEVNSAIKVIFGVKVPT
FT                   IRLDKSTIPAKPFSDVETSPYLSESYEEMTEALNKIIELVELESTIRSLVSELRKTQRL
FT                   INSIDNYILPFYRGSIKFIKQILEDRQREEFSRLKIIRRILQRRRESGSR"
FT   gene            500274..500432
FT                   /gene="atpG"
FT                   /locus_tag="SSO6175"
FT   CDS_pept        500274..500432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="SSO6175"
FT                   /product="ATP synthase subunit G (atpG)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40882"
FT                   /db_xref="GOA:Q97ZR2"
FT                   /db_xref="InterPro:IPR012508"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR2"
FT                   /protein_id="AAK40882.1"
FT                   /translation="MDQDKYLQILRNSLEEKKSEILKNINMEYEKLLKNRLSQLDEVKR
FT                   KVLKELS"
FT   gene            500453..500761
FT                   /gene="atpK"
FT                   /locus_tag="SSO0567"
FT   CDS_pept        500453..500761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK"
FT                   /locus_tag="SSO0567"
FT                   /product="ATP synthase subunit K (atpK)"
FT                   /EC_number="3.6.3.14"
FT                   /note="Energy Metabolism, ATP-Proton Motive Force"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40883"
FT                   /db_xref="GOA:Q7LXU5"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU5"
FT                   /protein_id="AAK40883.1"
FT                   /translation="MKRASLILAFLIPVLVSSVIAAAQAPSDTAQGFAGINIGAGLAVG
FT                   LAAIGAGIAVGMAAAAGVGVLTERRDMFGTVLIFVAIGEGIAVYGILFAVLMLFGKF"
FT   gene            500806..502251
FT                   /gene="proS"
FT                   /locus_tag="SSO0569"
FT   CDS_pept        500806..502251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SSO0569"
FT                   /product="Prolyl-tRNA synthetase (proS)"
FT                   /EC_number="6.1.1.15"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40884"
FT                   /db_xref="GOA:Q9UWX2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWX2"
FT                   /protein_id="AAK40884.1"
FT                   /translation="MQITREKWSKNFSEWFDWVLREGEFYDYGRYPIKGMGVWMPYGFK
FT                   LRQNIIGIIRNFLDSTGHEEVLFPLLIPEDLLRRESTHIKGFEEEVFWVTKGGSTDLDV
FT                   KLALRPTSEVAITTMENLWLKSYKQLPKKYYQIVSVFRYETKATRPMIRLREITTFKEA
FT                   HTVHETYDDAQKQVEEAIEIYKKIFDTLTIPYVLSERPEWDRFAGALHTYAFDTIMPDG
FT                   RAMQIGTVHHLGQNFSKALDFKIQKKDGSLDYPHQTSYGISDRAVASVIAIHGDDHGPV
FT                   LPPSVAPIKVVVIPIPAKNEEETQQVMKYSIEICEMFNKNNITCLTDQDTEKTPGEKFY
FT                   IWEIKGVPIRLEIGPRELISGTVFIKRRDNFKSYTVRKEEAINKIKELLNEIQEDLRRK
FT                   AWEDLKSRIEYSNDIEKAKKILGNNSGIVEVPWCGSNECGLKIEELTNARVLGYPIEKR
FT                   EVNDKCVICKMNAKTVLRIAKTY"
FT   gene            502286..502573
FT                   /gene="rps26E"
FT                   /locus_tag="SSO6179"
FT   CDS_pept        502286..502573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps26E"
FT                   /locus_tag="SSO6179"
FT                   /product="LSU ribosomal protein S26E (rps26E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40885"
FT                   /db_xref="GOA:Q97ZR1"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR1"
FT                   /protein_id="AAK40885.1"
FT                   /translation="MPKKRENRGRRKGDKGHVGYISCDQCGARVPEDKAVCVTKMYSPV
FT                   DASLASELEKKGAIIARYPVTKCYCVNCAVFLGIIKIRAENERKQKARLR"
FT   gene            502607..503623
FT                   /locus_tag="SSO0570"
FT   CDS_pept        502607..503623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0570"
FT                   /product="Ethylene-inducible protein"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40886"
FT                   /db_xref="GOA:Q9UWX3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWX3"
FT                   /protein_id="AAK40886.1"
FT                   /translation="MRLYELSFAQIEDFFYKLAEVKDIIKDHGLLEFLPEFKKLDSTVH
FT                   TGTTRVKHAFPIFQKGGVVMDITNVQQAQIAEEAGAVAVMVLDKLPYDVRKSGGVARMA
FT                   DPKIIEEVMSSITIPVMAKVRIGHYYEAKLLEALGVDMIDESEVLTPADEEHHINKWEF
FT                   SVPFVNGARNLGEALRRTSEGASMIRTKGEAGTGNVSEAVKHMKIINSEIRSLISMSEE
FT                   DRVKKAREYQVPYQIVELTAKIKRLPIVNFAAGGIATPADAALMMWLGADGLFVGSGIF
FT                   KSQDPDERAKAVVLAAACWEYPEIVLEAQKMISEQKSMMGIDIKSLKPEELLQVRGL"
FT   gene            503620..504222
FT                   /locus_tag="SSO0571"
FT   CDS_pept        503620..504222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0571"
FT                   /product="Glutamine amidotransferase, putative"
FT                   /note="Close homology to imidazoleglycerol phosphate
FT                   synthase, subunit h, putative; Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40887"
FT                   /db_xref="GOA:Q9UWX4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWX4"
FT                   /protein_id="AAK40887.1"
FT                   /translation="MKIGIIAYQGSFEEHFLQLKRAFDKLSLNGEIISIKIPKDLKGVD
FT                   GVIIPGGESTTIGLVAKRLGLLDELKEKITSGLPVLGTCAGAIMLAKEVSDAKVGKTSQ
FT                   PLIGTMNISVIRNYYGRQKESFEAIVDLSKIGKDKAHVVFIRAPAIAKVWGKAQSLAEL
FT                   NGVTVFAEENNMLATTFHPELSDTTSIHEYFLHLVKG"
FT   gene            504260..505792
FT                   /locus_tag="SSO0572"
FT   CDS_pept        504260..505792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0572"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some homology to twitching mobility (pilt) related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40888"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXU1"
FT                   /protein_id="AAK40888.1"
FT                   /translation="MGIRILNDLMLDKSALLFGVSKYLEKGIITGNILIHKSLLAELEK
FT                   ESNDGLVSAEIALDEVKKLKDITERILVNFEIVGENSKKGEANELSREYCLEKGCIMVT
FT                   ADETQKKICDVMGIQYSFLQPLEQSLSFESFFDDETMSLHIKEDTVPRAKKGKPGNWKF
FT                   VNLSNKPMLSVDVKRIANEIINGVRFIKGSFIEIERKGSLIIQLGNYRVVITRPPLSDG
FT                   WEITITRPVVRKRLEDYGLDERLIKRLEERAEGIIIAGAPGMGKTTFAQALSEYYMRLG
FT                   KIVKTIESPRDMHLPPEITQYSKNYAEIGELHDILLLSRPDYTVYDEMRNDEDFKLYID
FT                   LRLAGIGMVGVVHATSPIDAIHRFVNRVDIGTIPNILDTIIFINSGNVSKVYTLEITVK
FT                   VPAGLKEADLARPVVEIKDLVTGNTEYEIYVFGEQTMIVPVNRGITLNNMEFKISKIVN
FT                   NIIPKATVKYEDGEYVIVIPKEEIGKYNRKLVQRLKRLEKKNNIKIKIKLSD"
FT   gene            complement(505789..506220)
FT                   /locus_tag="SSO0575"
FT   CDS_pept        complement(505789..506220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0575"
FT                   /product="Holliday-junction resolvase"
FT                   /note="Replication and Repair"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40889"
FT                   /db_xref="GOA:Q7LXU0"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="PDB:1HH1"
FT                   /db_xref="PDB:4TKD"
FT                   /db_xref="PDB:4TKK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7LXU0"
FT                   /protein_id="AAK40889.1"
FT                   /translation="MNAKKRKGSAVERNIVSRLRDKGFAVVRAPASGSKRKDPIPDIIA
FT                   LKNGVIILIEMKSRKDIEGKIYVRREQAEGIIEFARKSGGSLFLGVKKPGVLKFIPFEK
FT                   LRRTETGNYVADSEIEGLDLEDLVRLVEAKISRTLDNFL"
FT   gene            complement(506253..507260)
FT                   /gene="ilvC-1"
FT                   /locus_tag="SSO0576"
FT   CDS_pept        complement(506253..507260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC-1"
FT                   /locus_tag="SSO0576"
FT                   /product="Ketol-acid reductoisomerase (ilvC-1)"
FT                   /EC_number="1.1.1.86"
FT                   /note="Amino Acid Biosynthesis, Pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40890"
FT                   /db_xref="GOA:Q9UWX9"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWX9"
FT                   /protein_id="AAK40890.1"
FT                   /translation="MKCTSKIYTDNDANLDLIKGKRIAVLGYGSQGRAWAQNLRDSGLN
FT                   VVVGLEREGKSWELAKSDGITPLHTKDAVKDADIIIFLVPDMVQRTLWLESVQPYMKKG
FT                   ADLVFAHGFNIHYKLIDPPKDSDVYMIAPKGPGPTVREYYKAGGGVPALVAVHQDVSGT
FT                   ALHKALAIAKGIGATRAGVIPTTFKEETETDLFGEQVILVGGIMELMRAAFETLVEEGY
FT                   QPEVAYFETINELKMLVDLVYEKGISGMLKAVSDTAKYGGMTVGKFVIDESVRKRMKEA
FT                   LQRIKSGKFAEEWVEEYGRGMPTVVNGLSNVQNSLEEKIGNQLRDLVQKGKPKS"
FT   gene            complement(507232..507624)
FT                   /locus_tag="SSO0577"
FT   CDS_pept        complement(507232..507624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0577"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT9"
FT                   /protein_id="AAK40891.1"
FT                   /translation="MTQERVVRILAYYRDPGLIERIASNFRKLFMDIEWIYGWKVNDEN
FT                   LYEFYVGVKDHNNFNTAVLLLSKTVDVSKVEILDDAQLKRVIIRDGKVIENQSEGVKEG
FT                   DIIIYVPVFNKVKGYSWGEVYVKDLH"
FT   gene            complement(507602..509320)
FT                   /gene="ilvB-2"
FT                   /locus_tag="SSO0579"
FT   CDS_pept        complement(507602..509320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB-2"
FT                   /locus_tag="SSO0579"
FT                   /product="Acetolactate synthase large subunit homolog
FT                   (ilvB-2)"
FT                   /EC_number="2.2.1.6"
FT                   /note="Amino Acid Biosynthesis, Pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40892"
FT                   /db_xref="GOA:Q7LXT8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT8"
FT                   /protein_id="AAK40892.1"
FT                   /translation="MPTGARILVDSLKREGVKVVFGIPGLSNMQIYDAFVEDLANGELR
FT                   HVLMRHEQAAAHAADGYARASGVPGVCTATSGPGTTNLTTGLITAYWDSSPVIAITGNV
FT                   PRSVMGKMAFQEADAMGVFENVTKYVIGIKRIDEIPQWIKNAFYIATTGRPGPVVVDIP
FT                   RDIFYEKMEEIKWPEKPLVKGYRDFPTRIDRLALKKAAEILINAERPIILVGTGVVWAN
FT                   ATPEVLELAELLHIPIVSTFPGKTAIPHDHPLYFGPMGYYGRAEASMAALESDAMLVVG
FT                   ARFSDRTFTSYDEMVETRKKFIMVNIDPTDGEKAIKVDVGLYGNAKIILRELIKAIITL
FT                   GQKRDKSAWIKRVKEYKEYYSQFYYTEENGKLKPWKIMKTIRQSLPRDAIVTTGVGQHQ
FT                   MWAEVFWEVLEPRTFLTSSGMGTMGFGLPAAMGAKLARPDKIVVDLDGDGSFLMTGTNL
FT                   ATAVDEHIPVISVIFDNRTLGLVRQVQDLFFGRRIVGVDYGPSPDFVKLAEAFGALGFN
FT                   ATTYEEIEKSIKSAIKEDIPAVIRVPVDKEELALPTLPPGGRLKQVILRDPRKSS"
FT   gene            complement(509529..510065)
FT                   /locus_tag="SSO0580"
FT   CDS_pept        complement(509529..510065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0580"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40893"
FT                   /db_xref="GOA:Q7LXT7"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT7"
FT                   /protein_id="AAK40893.1"
FT                   /translation="MLIILFLLVYTEMIRAIVFDADKTLWDHHNISEFEEPLRLIDSNT
FT                   LEDSKGRVLHLFPDVKETLKELKNRGYILGLATWNFEDKAIKVLAALDLLQYFDIIVAK
FT                   PYPYKFLMLSQIIVEINTKANQKIKPSEVLFLDDRRGHFGNIWLYLGNVKCLEMWKDIS
FT                   KYSEIFSVLSHVNNE"
FT   gene            complement(510007..510810)
FT                   /locus_tag="SSO0581"
FT   CDS_pept        complement(510007..510810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0581"
FT                   /product="GTP binding protein, hypothetical"
FT                   /note="Regulation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40894"
FT                   /db_xref="GOA:Q7LXT6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT6"
FT                   /protein_id="AAK40894.1"
FT                   /translation="MLGKVIQLIKRSDLVVEVLDAREPSLTRSKKIEDIIVKNYKNILL
FT                   VLNKGDLVPLWVLKAWKDYFKTEENIESVYVSATSHLGTKILRDTMKSLLKGNKGIVVF
FT                   VGYPKSGKSSVINALKGRHSAQTSAHPLEYGYTKSIQLFKIDNKIYAWDTPGVIPPDGN
FT                   ELEKTIRGYNADLLEDPVKPALMLINRVIEFSKESLISVYKVDFNNPYELLERIAIRRG
FT                   WFYKSTKEPNIDMAARAVIRDYHEGKIAYYTLPPSLYRDDKSNSI"
FT   gene            510845..511822
FT                   /locus_tag="SSO0582"
FT   CDS_pept        510845..511822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0582"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT5"
FT                   /protein_id="AAK40895.1"
FT                   /translation="MPKGELAIFDEGDFEGSIDYQSFTKSIKLSNINKEASFSIDIASK
FT                   PTKFYLIIQAKREKTYLPRWRLWFDNFSLTKEFKPNLETEINDAQVISTIVYDITPIIK
FT                   EGKHQIAVYHPSIQVLELLNISLISFYRTEGFSTKYRLSAGSLIFNRNDSVSFHLMKKS
FT                   YFVIRNESKEGMVKISDIDGKTIYTILPSSDSDEIEIENNDAITTTLQSNNEKDYGVIL
FT                   ASYNLLEKAPKINFSVDSKVSDNIIYLYLKNESEISLDKLLINVMINGVPAHFKTFTNI
FT                   DVSSTIDLKLPISVPQSKKAPIINVRVVGVKGGYRKIIDKQISL"
FT   gene            complement(511812..512660)
FT                   /gene="ubiA-2"
FT                   /locus_tag="SSO0583"
FT   CDS_pept        complement(511812..512660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA-2"
FT                   /locus_tag="SSO0583"
FT                   /product="4-hydroxybenzoate octaprenyltransferase, putative
FT                   (ubiA-2)"
FT                   /note="Cofactor Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40896"
FT                   /db_xref="GOA:Q9UWY6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023547"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWY6"
FT                   /protein_id="AAK40896.1"
FT                   /translation="MSLKSYMQLVRIHNVIGAALGAIMGFLVSSQWYLELKGILLSALV
FT                   VGLIAAGGYVINDVYDVEIDKINKPYRPIPSGKISVNKAKALSIALFIIGIALSILLNI
FT                   YALVIALVTAIGLIYYAKDLKKTGFYGNLLVATTTALSIFYGGLAFFSDNWLLRIIIPT
FT                   LYAFFLTLIREIVKGIEDYNGDSLNNVKTLATTLGINKSWRIAKILLVLLLIISPLPFF
FT                   IGFNLIYLILLILVFIPFTILSIIQKETIEGASKARTYLKISAISGIIAFLLGSLPFFK
FT                   G"
FT   gene            complement(512873..513745)
FT                   /locus_tag="SSO0584"
FT   CDS_pept        complement(512873..513745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0584"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40897"
FT                   /db_xref="GOA:Q7LXT3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT3"
FT                   /protein_id="AAK40897.1"
FT                   /translation="MDFDPIVFDRRRFPGKKCTGIISRRTFLTLGVSREFIDREFKTIE
FT                   IRYDRKYTIYISTDVIRLNREKLEIWLDSEVKTKRPRDAIINGNTVISGNEKYEGIVVD
FT                   SSGWKGNAKWIKAIEYLTEPVNEENIIVYIDSKNVGGFSWIVPLPYGTLVGAISYNDPK
FT                   VFLPNINKRVFDTHGGAIPRVLPISSIKTLKFGDSTGLIKTFTGGGMFGIASLLYPLVN
FT                   GIRNGKFSEYYSMYKILAKEVRKQYYITRLLESTWRFLPILFKLYNDKTLNISEEFDLH
FT                   SLLVSRFPH"
FT   gene            complement(513790..514164)
FT                   /locus_tag="SSO0585"
FT   CDS_pept        complement(513790..514164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0585"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40898"
FT                   /db_xref="GOA:Q9UWY8"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UWY8"
FT                   /protein_id="AAK40898.1"
FT                   /translation="MMMGVELAFPKVVGKQVYGSLYECDEDVLKDTKRLEQIIKEAADI
FT                   GNMNILDIKSWKIGEGVSVVAIILESHITIHTWPEYRFATVDVYSCGPHTSPLNAFRYI
FT                   VEKLGAKRYTINEADRSSEF"
FT   gene            514276..514563
FT                   /locus_tag="SSO6206"
FT   CDS_pept        514276..514563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO6206"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with APES031, Ta1183, MJ0319, PH1931,
FT                   PAB1228,MTH889, AF1549"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40899"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="PDB:2X3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZR0"
FT                   /protein_id="AAK40899.1"
FT                   /translation="MAIRRLVLDVLKPIRGTSIVDLAERISKLDGVEGVNISVTDMDVE
FT                   TMGLMIIIEGTSLNFDDIRKMLEEEGCAIHSIDEVVSGNRIIEGKIKDDL"
FT   gene            514553..515524
FT                   /locus_tag="SSO0586"
FT   CDS_pept        514553..515524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40900"
FT                   /db_xref="GOA:Q7LXT2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT2"
FT                   /protein_id="AAK40900.1"
FT                   /translation="MICDNCKTREAVILQPHTGRKLCKECFIEDIRKRVEMEARKQEIV
FT                   NSNKILLAVSGGKDSLVLADTLSQFIHPSRLIAFNINEGIKGYNRNEYVKKLEEYLKDL
FT                   GIELIKSGFKEEVGFSLDEMLEASLKKKLNVSACTFCGGFRRKLINEAGIKVAADYVAT
FT                   GHNLDDEVQTIVINLIRGDLLRLIRFGDKPLMVSSKFVMRVKPLRKIYEWETTMYAHLK
FT                   GFEFQETECPYISQKPTLRAKVRDLLYKLEEKKPGTLLRILEQFDEISEKIKKEYRLTN
FT                   ELPNCVICGEPTTPGRMICKNCELLIRSGLMPQEYQKYLPIS"
FT   gene            complement(515500..516024)
FT                   /locus_tag="SSO0588"
FT   CDS_pept        complement(515500..516024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0588"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to SSO0377"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40901"
FT                   /db_xref="GOA:Q7LXT1"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT1"
FT                   /protein_id="AAK40901.1"
FT                   /translation="MFTRTGDDGNTNVISKRVGKDSPVVNLLGDIDELNSFIGLALTKI
FT                   EWEDMQSDLMRVQTELFILGEEIIQDKGRINEETIKWLESRTVEYRKESGPVKLFVIPG
FT                   GSEQASYLHVVRSIARRVERNAVAYSKELNFNKWIIVYLNRLSSLLFSMAIVANKRKNV
FT                   KERIYDIGKYF"
FT   gene            516107..518941
FT                   /gene="leuS-2"
FT                   /locus_tag="SSO0589"
FT   CDS_pept        516107..518941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS-2"
FT                   /locus_tag="SSO0589"
FT                   /product="Leucyl-tRNA synthetase (leuS-2)"
FT                   /EC_number="6.1.1.4"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40902"
FT                   /db_xref="GOA:O33768"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33768"
FT                   /protein_id="AAK40902.1"
FT                   /translation="MNNIAYKWQTRWEEDKIYESNPNPSKPKFFTTVAFPYPNSPWHIG
FT                   HGRTYVTGDILARYKRMRGYNVLFPMAFHYTGTPIMAMADAIAKGDKELIETFKDIYEI
FT                   SPDVIPRMSDPLFMANYFKEDIKASMREIGLGIDWRREFTTIDPEFSSFVTWQFHKLQS
FT                   KGYIVKDTHPVGWCPVHHIPVGMHDTKGDVEPEIGEFVLIYFNSEKGIFPAATLRPETI
FT                   FGATALWINPSEMYVVASMLGKKMILSEKAAAKLSFQIDDIEIEEKIKGSKLVGLKVEN
FT                   PITGKHIAVLGADFVDVSLGTGVVMSVPAHAPFDYYYSKKTFKNNNIEIIPVITVEGLG
FT                   NALAKDVVEKNNPKSDEDLKKLTEYVYRTEYNKGVLRSDLGNLIREEYRNELKSLGGLP
FT                   VPKGRELITNFLISKGLGRKIFEVMNKPVYCRCGTEIVVKILKDQWFLDYSNKEWKELA
FT                   RKSLSKINVIPEESRKDFEFTIEWLEKRACARTRGLGTPLPWDKKWIIESLSDSTIYMA
FT                   YYTISHKIKQYKLSPSKLTQEFWDYVMLGIGNLEEISEKTGIPSNIIKEFREEFLYWYP
FT                   LDIRHSGKDLIPNHLTFFIFNHAAIFQENLWPKAIAVNGLVLYEGKKMSKSLRNIIPLR
FT                   KGLKMYGVDVMRIAVSSTADMGSDVNFSESLVKTVGETLRKMYELFKSLDNYTGDILGF
FT                   PEKWLLSRIYEITSSTTRHMEALELRDAVNELLFVFSSDLDEYFGMVSAEGREANNKVL
FT                   REVLTIWLKLITPFAPHLAEEIWHEILKQKTYIVNEGWPEVEGSKMDELTLLEHEYMKR
FT                   IVEDIRSILNIFKGTPKLIKIYALNDSRYMELLRDAIVANGQMKKFMDIHKPKSREDAR
FT                   ILQKIFNESLEIDDKMKKLVTNYNINEVDVLNKLSKYIRRKLNVDILIEPYDEEVKKTY
FT                   NKEAMPLRPAIIIE"
FT   gene            complement(518925..519524)
FT                   /locus_tag="SSO0591"
FT   CDS_pept        complement(518925..519524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0591"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40903"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXT0"
FT                   /protein_id="AAK40903.1"
FT                   /translation="MNLLDYLMSLRNRKILLQSYHINAKIVLIYNITQRLYKENISVCI
FT                   INYEKFLKLSIREIDQRCVEGSYVIVFEAEEASDLPIRYNLVTSFVKINKDFDDILRID
FT                   KISTNLYKAQNNAGDLFIFSVINGKVIDRKLRPIHEDIINFLREYGGEVEIRDLVNIIS
FT                   KKYETNRDNVRVELAFLKELGIIEVKDRKVILTQLL"
FT   gene            519526..520656
FT                   /gene="hisC"
FT                   /locus_tag="SSO0592"
FT   CDS_pept        519526..520656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="SSO0592"
FT                   /product="Histidinol-phosphate aminotransferase (hisC)"
FT                   /EC_number="2.6.1.9"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40904"
FT                   /db_xref="GOA:O33770"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33770"
FT                   /protein_id="AAK40904.1"
FT                   /translation="MRFSLKLIYLFYVAYLGFYIAPTKLVRNKIKSWLLNASEYDFTDI
FT                   KEGIRLHLNESPFEPPQFIIDAVKMYLSKGNRYQHPDLLEKYRELAAEYSKVEPENIYP
FT                   SVGADGSIRAIFYNLVEPGDTILTNYPSYSMYSVYSSVRGTKVIKVNLKEDNEWWKENT
FT                   DDLLAQAEKVELVIIDDPNNPTGSPMLNGKKELIGQLAENTKGFVVIDEAYYEFGGYTV
FT                   SPYIYDYPNVLVVRTLSKAFSLASYRLGYTIANEEIVKALMKSSTPFDIPLPSLIAGIT
FT                   ALENPSYIKDVVNIVNRNREILYQGLKNLNLKVYKSITNFLLIKDNRNLQEMLMRHGIA
FT                   IRKLYDNFYRITIGTEDQCKMVIDKLGEELENSNSK"
FT   gene            520622..521494
FT                   /gene="hisG"
FT                   /locus_tag="SSO0593"
FT   CDS_pept        520622..521494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="SSO0593"
FT                   /product="ATP phosphoribosyl transferase (hisG)"
FT                   /EC_number="2.4.2.17"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40905"
FT                   /db_xref="GOA:O33771"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33771"
FT                   /protein_id="AAK40905.1"
FT                   /translation="MVRNLKIAIPNKGRLQQPTLQFLQSVGIKPLASDDRALIVPTSWE
FT                   GVQLVMIRTEDIPNIVETGATELGITGHDYVIESSADVEELIKLDFGRSKIVLAVPQTW
FT                   RENSVDELKGKEFRVATKYYNIAKEYVRRRELNAKVVKISGAAEVMPSLGAAEAIIDVM
FT                   STGTTLKLHGLKAIDVIMDSYAVVIGNRNWIKNDEADRINLLLTMMKGAIAAKGKKMIF
FT                   MNVPDNKLDGVINSLPAMLAPAITRLSRSDIWEVITVAEEDILPEVIAKVKAAGARDIV
FT                   VIDIEKVVK"
FT   gene            521496..522194
FT                   /gene="hisA"
FT                   /locus_tag="SSO0594"
FT   CDS_pept        521496..522194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="SSO0594"
FT                   /product="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase (hisA)"
FT                   /EC_number="5.3.1.16"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40906"
FT                   /db_xref="GOA:O33772"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33772"
FT                   /protein_id="AAK40906.1"
FT                   /translation="MNEIIPSIDISFGKAVKRIRGVRGTGLVLGNPIELANKLYNEGYS
FT                   RIHVVDLDAAEGVGNNEMYIKEICKIGFDWIQVGGGIRDVEKAKRLISLDVNALIFSTI
FT                   VFTNFNLFYNIVREIGNNRVIVSIDYDDTKRVLISGWKERSMEIIDGIKKVNELELLGI
FT                   ILTYVTNEGTVKGIDYSVKDYAKLIRGVKEYAGGVSSDSDITFLKNVGFDYIIVGMAFY
FT                   LNKIRGTNVV"
FT   gene            522187..522768
FT                   /gene="hisB"
FT                   /locus_tag="SSO0596"
FT   CDS_pept        522187..522768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="SSO0596"
FT                   /product="Imidazoleglycerol-phosphate dehydratase (hisB)"
FT                   /EC_number="4.2.1.19"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40907"
FT                   /db_xref="GOA:O33773"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33773"
FT                   /protein_id="AAK40907.1"
FT                   /translation="MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLITLL
FT                   TYMNSTAIVSATDKLPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMDDALV
FT                   LVSLDISNRGMAFVNLNLKRSEIGGLATENVPHFFQSFAYNSGITLHISQLSGYNTHHI
FT                   IEASFKALGLALYEATRIVDNEIRSTKGII"
FT   gene            522765..523520
FT                   /gene="hisF"
FT                   /locus_tag="SSO0597"
FT   CDS_pept        522765..523520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="SSO0597"
FT                   /product="Imidazoleglycerol-phosphate synthase, cyclase
FT                   subunit (hisF)"
FT                   /EC_number="2.4.2.-"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40908"
FT                   /db_xref="GOA:O33774"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33774"
FT                   /protein_id="AAK40908.1"
FT                   /translation="MTTKRIIACLDVKDGNVVKGVNFLNLQLKGDPVSLASLYEEEGAD
FT                   EIVFLDITATIEARKALYNVIKDTASVLSIPLTVGGGIRTPDDVSMALRSGADKVSINT
FT                   AAVESSQIVKKSAEEFGSQAVVVAIDVKKVSGNWIVFTKSGTYNTRLDAIKWAKKVEEL
FT                   GAGEILLTSIDRDGTRLGYDLELTRKIVDSVNIPVIASGGAGKMEHFYEVFSLAKADAA
FT                   LAAGIFHDGIIKIKDLKSYLSQKGIEVRM"
FT   gene            523517..524713
FT                   /gene="hisD"
FT                   /locus_tag="SSO0599"
FT   CDS_pept        523517..524713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="SSO0599"
FT                   /product="Histidinol dehydrogenase (HDH) (hisD)"
FT                   /EC_number="1.1.1.23"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40909"
FT                   /db_xref="GOA:O33775"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33775"
FT                   /protein_id="AAK40909.1"
FT                   /translation="MISYSLPNERPNDFSRVIPVVKDIIESVKTKGDNALYELTEKLDK
FT                   VKIDNIKAREEELKTQASKLDPKVKQAIDTAYEQLKAFHEMLVPPNIGGGYQGISFGVI
FT                   WRSIEKIGIYVPSGKYSYPSTLLMAGIPAKVAKVKEIYVASPPTQEGTVNPALAYVAIK
FT                   LGVNEVYKIGGAQAIAALAFGTESVKKVYKIVGPGNVYVQAAKYLVSSVVGIDGIEGPT
FT                   ELVIIADETAKAEYVALDMKAQAEHGPDTYIVLLSNDDELIRRVEEKIKNDKKIYYIIK
FT                   TKNLDEAIEIANKIAPEHLSLYVKDAYTLMDKIVNAGAISLGNTPPAIIDYVAGPNHIL
FT                   PTNGWAKIRGGITVYDFIKPTMYANVRDINKQLLEASISLANYEGFIIHGKSIGARYE"
FT   gene            524697..524990
FT                   /gene="hisE"
FT                   /locus_tag="SSO6223"
FT   CDS_pept        524697..524990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="SSO6223"
FT                   /product="Phosphoribosyl-ATP cyclohydrolase (hisE)"
FT                   /EC_number="3.6.1.39"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40910"
FT                   /db_xref="GOA:O33776"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33776"
FT                   /protein_id="AAK40910.1"
FT                   /translation="MHDMSNEIVDELYKIILDRIEKRPTGSYTAEIVNKGKPYVARKVG
FT                   EESVETIVASLAENKERFISEVADLIYHLLVLMALEGVTPEDIYRELERRRK"
FT   gene            524987..525586
FT                   /gene="hisH"
FT                   /locus_tag="SSO0600"
FT   CDS_pept        524987..525586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="SSO0600"
FT                   /product="Amidotransferase hisH (hisH)"
FT                   /EC_number="2.4.2.-"
FT                   /note="Amino Acid Biosynthesis, Histidine"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40911"
FT                   /db_xref="GOA:O33777"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33777"
FT                   /protein_id="AAK40911.1"
FT                   /translation="MKALVINYGVGNLYSISSALKRVGFEVTIDNKPRNDYDLIVFPGV
FT                   GAFSAVAEFILRYRELFNDLRRSGTNFLGVCLGMQIMFEKGTEGKESNGLGWFKGIVDK
FT                   INANVKLPHIGWDLVFEVKDSCELTYGLDKKYVYYVHSYVAYPTSGDYVYMKSQYGIEY
FT                   PALVCDKNVVGTQFHPEKSSNTGKIFLENLKGWIKR"
FT   gene            525694..525951
FT                   /gene="hisI"
FT                   /locus_tag="SSO6227"
FT   CDS_pept        525694..525951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="SSO6227"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase (hisI)"
FT                   /EC_number="3.5.4.19"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40912"
FT                   /db_xref="GOA:O33778"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33778"
FT                   /protein_id="AAK40912.1"
FT                   /translation="MVGNMNREALFKTLTTGYLHFWSLSRKKLWLKGETSGNFQIIEEF
FT                   KVDCDADAVLFKVTSLGPICHTGNYTCFYRSYDELVNSKS"
FT   gene            525978..526376
FT                   /locus_tag="SSO0601"
FT   CDS_pept        525978..526376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0601"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some similarity with APE1979, PH0311,PAB1087"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40913"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS9"
FT                   /protein_id="AAK40913.1"
FT                   /translation="MSSQQQKVDKEEWKKKIMEALKDVYDPEIPVDIVNLGLIYDLKIN
FT                   DDGDVYLRLGLTAPGCPVVDDLIYTVEQVIKESVPAKSVEVDIDLDTQWTPLKMTAEGR
FT                   EKFKQLYGYDIVEMWVQTYGLPADEQKS"
FT   gene            526402..527775
FT                   /gene="serS"
FT                   /locus_tag="SSO0602"
FT   CDS_pept        526402..527775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SSO0602"
FT                   /product="Seryl-tRNA synthetase (serS)"
FT                   /EC_number="6.1.1.11"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40914"
FT                   /db_xref="GOA:O33780"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33780"
FT                   /protein_id="AAK40914.1"
FT                   /translation="MSWSILELLRKNPEDLKNNLKRRAIDVSLVDKAVELDKKWRQVLQ
FT                   EVEKLRHQHNVLSSQISKLSGEERKKKIEESKNLLKILEEKEKELEEIENERDRLLSSL
FT                   PNLVADDVPNGPDDSYNVPIKFWGKFKVYEGDVQEFLKQIKDAKVNYEVIKWKPKGHAE
FT                   MLEDVLHLGNTLKAAEIAGSRFYYLFNDIVWLDFSLLLFAIDYITQQGYTLVLPPYMLR
FT                   GEVIQSVIDLDTFKDAIYKIENEDLYLIATAEHPIAAMFFKEEIEKDKLPLKFAGISPA
FT                   FRKEASAANKDLKGIFRVHQFHKVEQFIFSTPEDSWKYHSELITNAESIFQQLELPYRI
FT                   VNIASGDLGACAAKKFDLEVWMPAQAKFREMVSCSNCTDWQAFRMKIRYVDRKNNRRGY
FT                   VHTLNSTAIASTRTITAILENYQREDGVVEVPKVLRKYLEAFPKAPKDYIYPLKNKII"
FT   gene            complement(527778..529298)
FT                   /locus_tag="SSO0604"
FT   CDS_pept        complement(527778..529298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0604"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Related to family 2 Fe-S oxidoreductases. Similarity
FT                   with PAB1143, PH1949, Ta0906, Ta0288"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40915"
FT                   /db_xref="GOA:Q7LXS8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS8"
FT                   /protein_id="AAK40915.1"
FT                   /translation="MSFLEQTFDFILTTDRCLMTNHHGKEFLGFLGTGPAVGVPEAVWK
FT                   WLACPKMKVDDLGRPEQAPYGMRKVEAKLIDEGFKAAIIDPDHLDRHLKYAKALMFSHH
FT                   DYFAFGPPSSTWWGITKKEPINYKSFQALISKPEIQEAKKRGMKILVGGPSTWQWLWRE
FT                   DMIEKVGVDTLVDGEGEKVVVKLAQMILDNEPLPKYVYVSGDDVPDIDDISEIKGASVN
FT                   GMIEIMRGCARSCRFCSVTIRPTRYYPLEKIEKELQTNVRAGVRHGVVHSDDVLFYGAV
FT                   GIYPRPEPLIKLHTLVKKYYKTIAWSHASLAAIRYSEEKYGLISKLGEIIFDDEQRYLG
FT                   VEVGIETGSVKLAKEIMPAKSAPYKPEEYPEIVEEAFKIMHENKIIPAGTMIVGLPEET
FT                   EDDVYRTIELVDNLRPYRSILVPMFFVPMGFFKNRDWFTRVKLSEAHIELYRKVFWHDV
FT                   YWAEDIINSFYMKGPVYMPVRFALKLFLRFAKKKMREVEKWLENQLKA"
FT   gene            complement(529769..530119)
FT                   /locus_tag="SSO0605"
FT   CDS_pept        complement(529769..530119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0605"
FT                   /product="Zn finger protein, hypothetical"
FT                   /note="Similar to rpoM; Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40916"
FT                   /db_xref="GOA:Q7LXS7"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS7"
FT                   /protein_id="AAK40916.1"
FT                   /translation="MQKFLYYSLTLFTLMKFCPKCGGLMVPSKKDGKEILKCSKCGYEM
FT                   MLSEKEKKEYSVKESKDKSSKVLTTSIVSDKEGRNLSEELEHEREEYYKEIGLELLREE
FT                   FEGNEEEESRED"
FT   gene            complement(530119..530592)
FT                   /locus_tag="SSO0606"
FT   CDS_pept        complement(530119..530592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0606"
FT                   /product="Transcriptional regulator, putative"
FT                   /note="Belongs to ASNC family; Transcription, RNA
FT                   polymerase and transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40917"
FT                   /db_xref="GOA:Q7LXS6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS6"
FT                   /protein_id="AAK40917.1"
FT                   /translation="MSDSKKRTVDLDAIDRRLLIELTRDARTSLRRLAEEMNVSPATLH
FT                   NRMTRMVQEGMIKSFVALLDYSKLGFALTGIIMAKVDGKHLVEFEKEIANADNVTAVYD
FT                   VVGEYDVVIIAKFRSVEELDSFLKQLLKNPKIERTYTSIVLNVVKEDPRIRIF"
FT   gene            complement(530647..531255)
FT                   /locus_tag="SSO0607"
FT   CDS_pept        complement(530647..531255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0607"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similarity with AF2111, MJ1677, PAB0863,aq_540"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40918"
FT                   /db_xref="GOA:Q7LXS5"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS5"
FT                   /protein_id="AAK40918.1"
FT                   /translation="MSELVSIPEIAFKLYAIMDPLSILPYLIALYEEFNRNSQNKISWR
FT                   FLVNKLSIAVTVLLLFFSILGGPLLAFLGISVSALEIGGGIILVYLGVDTLGGFQQLKF
FT                   LSSRIEEAIITPIATPLIVGPGTMTGLITLSVSNNLIILILGSLLAALLVYLSLLLGPI
FT                   IIRILGNTGTVAVGRFMAIIIAAFGVQLIIDGISQIKLI"
FT   gene            complement(531252..531563)
FT                   /locus_tag="SSO0608"
FT   CDS_pept        complement(531252..531563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0608"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Some similarity with APE1948"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS4"
FT                   /protein_id="AAK40919.1"
FT                   /translation="MSKFRIDKIPKNEQDIEEIQREIEESHPHEHEHEHSVEELIGEIY
FT                   LNVQSLQSKVEELNKSNNNCKKEISKIYFILGKLLIALTTNDNDEKIKNLKEVLSLLE"
FT   gene            complement(531560..531859)
FT                   /locus_tag="SSO0609"
FT   CDS_pept        complement(531560..531859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0609"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40920"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS3"
FT                   /protein_id="AAK40920.1"
FT                   /translation="MVRPVMKGRDLETLVFLGRLKEVKVEYCDEEKKMAKVIGITDTKE
FT                   EVETECIPLRAAGKISTVLKHYIRLGVGNYIITQTDMRNVANVDTQAEEEEKEE"
FT   gene            complement(531861..532733)
FT                   /gene="pyrD"
FT                   /locus_tag="SSO0610"
FT   CDS_pept        complement(531861..532733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="SSO0610"
FT                   /product="Dihydroorotate dehydrogenase (dihydroorotate
FT                   oxidase) (DHOdehase) (pyrD)"
FT                   /EC_number="1.3.98.1"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40921"
FT                   /db_xref="GOA:Q9UX04"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX04"
FT                   /protein_id="AAK40921.1"
FT                   /translation="MITIKNITLNDPLIIASGIIPDVPNYVETICEKYKPSAITTKTVT
FT                   LNPLEPHKPPTVIKLHDGIYMNAIGLGNPGAKAINEIGVLCPLIVSVGGSSINEIKEVV
FT                   EVVQSKAKIIEINVSSPNRKGYGESLSKLIGDIIESVKSVTKLPVFVKLGPWDNVIELA
FT                   GKALEKGADGLTLINTIKGLIIDVETFKPILYYGTGGVSGRCLYPIALRIIKDVYEEYG
FT                   VDIIGVGGVYDWTDVIGMLAAGAKLVGLGTVLIEKGFSVIEEIRKGLQSYLLEKGLKFE
FT                   DIIGISVRK"
FT   gene            complement(532730..533902)
FT                   /gene="pyrC"
FT                   /locus_tag="SSO0611"
FT   CDS_pept        complement(532730..533902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="SSO0611"
FT                   /product="Dihydroorotase (carbamoylaspartic dehydrase)
FT                   (DHOase) (pyrC)"
FT                   /EC_number="3.5.2.3"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40922"
FT                   /db_xref="GOA:Q9UX05"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX05"
FT                   /protein_id="AAK40922.1"
FT                   /translation="MMILWIMGKAYLSKEIRDVCINFDRRIKEIKSICKPDIALPKGTL
FT                   ILPGAIDLHTHIRGLKLAYKEDVVSGTSEASYGGITLIGDMPNSVPFVNTMETITAKLR
FT                   EFEYYSRVDYFVYSGVTKDLKKVDKFPIAGYKIFPEDLEKEETLEVLKSMKLKILHPEV
FT                   PLALRGNRKLRLNIWYEIGALYYVKGYQNVHITHATNIRTVRLAKELGFTVDITPHHLL
FT                   VDREKECLTKVNPPIRDTNERLWLLQAINEVDTVVSDHAPHASFEKQQPYEICPPGIAA
FT                   LSFTVPFILTLVSKGIISIDRAVELISTNPARILNIPYGEIKENNYANFTIIQFKDWRY
FT                   STKYSKVIETPLDGFPLRASIYMTIIQGKVGSLEGEVFPVKGINPFGENK"
FT   gene            complement(533862..534488)
FT                   /locus_tag="SSO0612"
FT   CDS_pept        complement(533862..534488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0612"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40923"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS2"
FT                   /protein_id="AAK40923.1"
FT                   /translation="MIYYEVIEKRKNVDNVYEIKIANFSVKPKAGQYVSLILPSKAEIP
FT                   LGVGDYDEDNNELRLYVESEKLANEIGKRVILKGPLGKPLDFTNVRIIVGIAYGKLYHD
FT                   LLYPLKVAYRSKIETFAKCIDCKLNYEEPKNIEDADLILVSAPLQLLYELKIPGEKTLV
FT                   YNRWVKMNCNLGVCGLCEVKGKLTCIDGPFMRFDDLVDYGKGVLK"
FT   gene            complement(534485..534976)
FT                   /gene="pyrI"
FT                   /locus_tag="SSO0613"
FT   CDS_pept        complement(534485..534976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="SSO0613"
FT                   /product="Aspartate carbamoyltransferase regulatory chain
FT                   (pyrI)"
FT                   /EC_number="2.1.3.2"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40924"
FT                   /db_xref="GOA:Q9UX07"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX07"
FT                   /protein_id="AAK40924.1"
FT                   /translation="MIGKMISSSKRDELIVSKIRNGTVIDHIPAGRALAVLRILGIRGS
FT                   EGYRVALVMNVESKKIGRKDIVKIEDRVIDEKEASLITLIAPSATINIIRDYVVTEKRH
FT                   LEVPKQIRGLIKCPNPQCITNNDVEAESRFITISIKPLKLKCKYCEMYITEDDVIRQIL
FT                   "
FT   gene            complement(534957..535868)
FT                   /gene="pyrB"
FT                   /locus_tag="SSO0614"
FT   CDS_pept        complement(534957..535868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="SSO0614"
FT                   /product="Aspartate carbamoyltransferase catalytic chain
FT                   (ATCase) (pyrB)"
FT                   /EC_number="2.1.3.2"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40925"
FT                   /db_xref="GOA:Q9UX08"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX08"
FT                   /protein_id="AAK40925.1"
FT                   /translation="MRLRHVVSSLDLTRDDYFRIFELADKFYDVKKLNYLSGKVVSLAF
FT                   FEPSTRTAQSFHTAAIKLGADVIGFASEESTSIAKGENLADTIRMLNNYSNCIVMRHKF
FT                   DGAALFASEISDIPIINAGDGKHEHPTQAVIDLYTVYKAFGEIDGRTFALLGDLKYART
FT                   VNSLLRALTRFKPKKVFLISPSQLKVRREILDELNYPVIETENPYDVIQEIDVLYVTRI
FT                   QKERFVDEVEYEKVKESYVVDLKLVNMMKKDGIILHPLPRVTEIDRRVDKTVNAKYFYQ
FT                   ASLAVPVRMALFYEVLGDREDD"
FT   gene            535932..536519
FT                   /gene="pyrE"
FT                   /locus_tag="SSO0615"
FT   CDS_pept        535932..536519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SSO0615"
FT                   /product="Orotate phosphoribosyltransferase (OPRT) (pyrE)"
FT                   /EC_number="2.4.2.10"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40926"
FT                   /db_xref="GOA:Q9UX09"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX09"
FT                   /protein_id="AAK40926.1"
FT                   /translation="MNFAEVLLERKLLLIGSFVLTSGKVSPYYLDLRPLPNYPEFYDIV
FT                   NQAIKKAKDIPHDIIVGIATGGVPLSAFIACNLKEPMGYIRIEKKGHGTNRTLELDVKG
FT                   KRVLLVDDVATTGVSIEKATLEILNGGGKVSDALVIIDRQEGASQRLEKLGVKLHSLFK
FT                   ISEILDELLKSDKLKDNEKKSILDYLVKNVEK"
FT   gene            536506..537174
FT                   /gene="pyrF"
FT                   /locus_tag="SSO0616"
FT   CDS_pept        536506..537174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SSO0616"
FT                   /product="Orotidine 5'-phosphate decarboxylase (OMP
FT                   decarboxylase) (OMPdcase) (pyrF)"
FT                   /EC_number="4.1.1.23"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40927"
FT                   /db_xref="GOA:Q9UX10"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX10"
FT                   /protein_id="AAK40927.1"
FT                   /translation="MLKSRVILAMDKPLSYQVLKEMENELYGIKVGLPLVLDLGVDKTR
FT                   ELLIGLDVEEIIVDFKLADIGYIMKSIVERLSFANSFIAHSFIGVKGSLDELKRYLDAN
FT                   SKNLYLVAVMSHEGWSTLFADYIKNVIREISPKGIVVGGTKLDHITQYRRDFEKMTIVS
FT                   PGMGSQGGSYGDAVCAGADYEIIGRSIYNAGNPLTALRTINKIIEDKVMKCKGAIFRKK
FT                   "
FT   gene            537335..537808
FT                   /locus_tag="SSO0617"
FT   CDS_pept        537335..537808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0617"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS1"
FT                   /protein_id="AAK40928.1"
FT                   /translation="MYEYFVIYDEILRIYMNFLQNLMLNYASRTINSDVEFMNIVLSDG
FT                   SYIILEGDEKRVSIPFPKGIATTHTHPGICLFSHKDLETADHLFSIGYAVVSVMNTKCI
FT                   SSLYRRGVYTLDDKLALKNLVGKIKKAKNLEEVINIYRNLAFPNYLKFITYSI"
FT   gene            complement(537792..538802)
FT                   /locus_tag="SSO0618"
FT   CDS_pept        complement(537792..538802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0618"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40929"
FT                   /db_xref="GOA:Q7LXS0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXS0"
FT                   /protein_id="AAK40929.1"
FT                   /translation="MSKSITRKIQLTGGSTYIVSLPKEWIKALSLSAGDEVEIYQDTDM
FT                   KLLIVPKSANTTDQKEIKKIIHCDNVTSEAIIREFIAYYIAGFSSVSITCPRMSSSTRA
FT                   YIKDVVRRRLLGAEVIEEDVSTISIQFLVDEKELSIKKAISRAFTISYNMLRDSLEAIS
FT                   KADIELAKEISGRDDEVDRFFFYIARQLTISVKAINVLDSEGYNLTQMVDIYSVAKTIE
FT                   RVGDHANRIASLVEDVSKFSNKEDLVNLGLTILESYKSAMNAFLNEKKDIAHSLISNIE
FT                   IFEKLRELQEIAIKSNDNPKIITSTSMTVESLRRVARYSADIAEATIDILAKSNK"
FT   gene            complement(538820..539326)
FT                   /locus_tag="SSO0619"
FT   CDS_pept        complement(538820..539326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0619"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR9"
FT                   /protein_id="AAK40930.1"
FT                   /translation="MKKKGKSLAELLIDVRIARNKVQNIINRMQNKIGTYNHIFMRNVA
FT                   SFPHLSKMVARESELLENVMDHLLTLEVILEILEIKIETIIYIGNIVTSAASVVEAIKL
FT                   LKESFNLTPDISLLLDDIYSNFYVNVDLPKEIKINVKEEARSVLLDAEKIAEKRKSETY
FT                   YQVNT"
FT   gene            complement(539379..539696)
FT                   /locus_tag="SSO0620"
FT   CDS_pept        complement(539379..539696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0620"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40931"
FT                   /db_xref="GOA:Q7LXR8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR8"
FT                   /protein_id="AAK40931.1"
FT                   /translation="MNEKERKQVKKFFRFLFFTSRGGITRLKIVRVLEEKPLNPNQIAS
FT                   TLKLDYKTVMHHLEVLMENNIVYREADGYGLPYKLTTFYKTYKDVLDELEREIRQKANK
FT                   S"
FT   gene            complement(539774..540166)
FT                   /locus_tag="SSO0621"
FT   CDS_pept        complement(539774..540166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0621"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40932"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR7"
FT                   /protein_id="AAK40932.1"
FT                   /translation="MTLSDVILRYLLSEEPIIEINENDISAEEFSSIDEISIGLRIIII
FT                   GKNRRRRLVDLGLLQIIAKCGHLDFIRDYLNMKFTLRDIYTKYNVYTELEYLAIQEDCA
FT                   GLVNDLDLKCVLLKVKSTTEKRGTTR"
FT   gene            540202..540831
FT                   /locus_tag="SSO0622"
FT   CDS_pept        540202..540831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0622"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40933"
FT                   /db_xref="GOA:Q9UX16"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="PDB:1TLJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX16"
FT                   /protein_id="AAK40933.1"
FT                   /translation="MLVWEELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYTQ
FT                   SSCSGRITIVDAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHI
FT                   YAKNIETGWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDK
FT                   IKTLVNVCNEVLARGKQKMNLLKDLLSSSSNNSMELGKNSKLKTPI"
FT   gene            complement(540769..541404)
FT                   /locus_tag="SSO0624"
FT   CDS_pept        complement(540769..541404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0624"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40934"
FT                   /db_xref="GOA:Q97ZQ9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZQ9"
FT                   /protein_id="AAK40934.1"
FT                   /translation="MVQMKYRVIEIFTSIQGEGEVIGIPSNFIRLATCNLRCVWCDTKY
FT                   SWEIGTEMSIDEIIAKLDKKIKTTTITGGEPLLQNILPLAKELKSIGHKIVVETNGTIK
FT                   PSEELRKIIDIFSVSPKLSNSGHKLKYDFADDWATYYKFVIVYPNKDIDEVVKFVESQS
FT                   INPRKVILQPDGNRSDYINAINEIVQIVLDRGLQFRVLPQLHRIIGAR"
FT   gene            complement(541376..542374)
FT                   /locus_tag="SSO0625"
FT   CDS_pept        complement(541376..542374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0625"
FT                   /product="GTP-binding protein"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40935"
FT                   /db_xref="GOA:Q7LXR6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR6"
FT                   /protein_id="AAK40935.1"
FT                   /translation="MLNPFEKLQIPPKANQTIDTMLKRLPKIGGTTVRDREIRRLKEYY
FT                   ERIKKYYDFVEQFPKIDELHPFYLEATRIMTDINKLRICLSVTKKTSVISMKILKKYIN
FT                   QIRKSPENESNRIMRQAFGRVSSVLRKSSECIDRVIDVAKELKKIQGIDPTLPTIVVAG
FT                   PPNVGKSTLVSKISTAKPEIASYPFTTKEVHVGHVILDDFRIQVIDTPGILDRPEAERN
FT                   RIERKATNAIRNLNGIIVFMFDSSISSVLSVEGQIELFREVKLLKKIVIPVINKIDEKY
FT                   EEYYKKIVDFLLSEGNEWHEISAEKGIGIDKLKEELFNLVKSSGTNEVSRD"
FT   gene            complement(542368..542856)
FT                   /gene="metS-like"
FT                   /locus_tag="SSO0627"
FT   CDS_pept        complement(542368..542856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS-like"
FT                   /locus_tag="SSO0627"
FT                   /product="Methionyl-tRNA synthetase N-term homolog
FT                   (metS-like)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Translation, Aminoacyl tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40936"
FT                   /db_xref="GOA:Q7LXR5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR5"
FT                   /protein_id="AAK40936.1"
FT                   /translation="MVFPSEILLTSITTILHNRYKKLASNKYKLLLHYVNQNPYNSSPM
FT                   LNIMSNQITIDDFAKLDLKVGIVRQAERIEGTRLLKLLIDLGSEQRQIIAGLGEYYTPE
FT                   ELLNKRIIVIANLKPRVIRGFESQGMLLAAGCKEDEAKGIKPRILTVDGEVPPGTKIC"
FT   gene            542822..543523
FT                   /gene="purC"
FT                   /locus_tag="SSO0626"
FT   CDS_pept        542822..543523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SSO0626"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (SAICAR synthetase) (purC)"
FT                   /EC_number="6.3.2.6"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40937"
FT                   /db_xref="GOA:Q9UX20"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX20"
FT                   /protein_id="AAK40937.1"
FT                   /translation="MEVNKISEGKTKIVYDFDKDHVLLEFKDDITAGDGQKRDILEGKG
FT                   VLNAQTSAFFFRLLERNGIETHYVGMKDERTMIVKKLKMIPVEVVLRNIATGSIVKRLP
FT                   IKEGEVFESPIVEFFLKDDLRHDPLLNYYHMEHLKLMNRKEAQHIEDIMMKVNDVLFNF
FT                   IKSKGFILYDFKLEFGRLGDKLVIGDEISLDSMRIRDGNSRIYDKDLYRKGYDLKTVKS
FT                   SYEEFLKRITS"
FT   gene            543534..543788
FT                   /locus_tag="SSO6264"
FT   CDS_pept        543534..543788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO6264"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Related to uncharacterized ACR, YexA/UPF0062 family.
FT                   Similarity with TM1244 and MJ1593"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40938"
FT                   /db_xref="GOA:Q97ZQ8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZQ8"
FT                   /protein_id="AAK40938.1"
FT                   /translation="MKYYVELIIINKDSVRDPEGETIQKYVIEKYTNNIIETRVGKYIQ
FT                   FKIEANNEEDAKNLIEKIANEGRLYNPIIHKILVRVRRE"
FT   gene            543785..544459
FT                   /gene="purQ"
FT                   /locus_tag="SSO0628"
FT   CDS_pept        543785..544459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="SSO0628"
FT                   /product="Phosphoribosylformylglycinamidine synthase I
FT                   (FGAM synthase I) (purQ)"
FT                   /EC_number="6.3.5.3"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40939"
FT                   /db_xref="GOA:Q9UX21"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX21"
FT                   /protein_id="AAK40939.1"
FT                   /translation="MIAIIKFPGTTCETDVYKALIEAGVPTVIVKYKDFDPDRYNGVIL
FT                   PGGFSFGDYLRAGSIAASTETMKKVKQMAEDGKIVIGICNGFQILVESGLLKGALLPNL
FT                   KLRFISKWVYLKVIRADTILTKGLDKKIIRMPIAHAEGRYYVDDIDYAKTHMVLQYCDE
FT                   NGNISEDVNPNGSLLNIASIANEEGNVIGMMPHPERASFKLTSIDGTVDGLILLRRLGE
FT                   WA"
FT   gene            544450..546579
FT                   /gene="purL"
FT                   /locus_tag="SSO0629"
FT   CDS_pept        544450..546579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="SSO0629"
FT                   /product="Phosphoribosylformylglycinamidine synthase II
FT                   (FGAM synthase II) (purL)"
FT                   /EC_number="6.3.5.3"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40940"
FT                   /db_xref="GOA:Q9UX24"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX24"
FT                   /protein_id="AAK40940.1"
FT                   /translation="MGINLLPIEMDEIRKRLGREPNETEWRVIDAVWSEHCSYKSSKIF
FT                   LKSFSIDSPNVIMGIKDWQDAGAVDIGDGWAVVIKVESHNHPSAIDPFNGAATGVGGII
FT                   RDIISKGAKPIALMDMIRVGNLKIKKNVWLLKNIIAGIAAYGNSIGVPVVGGELSFDDT
FT                   YNDNPLVDVAAIGIVRKDKIKPSIVDKAGLKLVLAGLTGVDGLGGASFASRKLSGEDEI
FT                   GAVQIADPFAGKIILDVTLEIADKVEAIKDLGGGGLAVAVTEITNGLGATVDIEKIPLR
FT                   VKNMNPSDVIISETQERMLYAVEEKNVKEVCEAFEEYEYPCSVIGEITNEPVIKFRYIG
FT                   KDLVSLPTNVLLNPPRFLWPIKNTKKNVEEKIVDLPLESAIYTVLTHPDLVSKGWAYSQ
FT                   FDYEVNTSTVVKPGDADSAVVSLPNGKLLAIKADANPDMCAEDGYECGKGIVAEAYRNL
FT                   ATVGARGMVAVDHLQFGDPKKAEVYYTFVEAIRGIGEATRFFNIPIVGGKVSFYNENNQ
FT                   GRPIKPTPLIVMAGLVQDKLLKNRVEDNLYVVSVGYTRKELGGSLLSKIFKIPSQAPKV
FT                   RLQEDLLSSEVVIDSINEGKITFAKDVSRGGLAASLFSILVHGYGVEISTKSILSDTDN
FT                   VIENLFSESSGRFIVLTNEPEWIVEKSKSKGIVASIIGRVNKKTNILTIDNIDYNLKNI
FT                   VDNYFNFLEEVMGNG"
FT   gene            546572..547924
FT                   /gene="purF-1"
FT                   /locus_tag="SSO0632"
FT   CDS_pept        546572..547924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF-1"
FT                   /locus_tag="SSO0632"
FT                   /product="Amidophosphoribosyltransferase (glutamine
FT                   phosphoribosylpyrophosphate amidotransferase) (ATase)
FT                   (GPAT) (purF-1)"
FT                   /EC_number="2.4.2.14"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40941"
FT                   /db_xref="GOA:Q7LXR4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR4"
FT                   /protein_id="AAK40941.1"
FT                   /translation="MDSIRDKCGVFAVSSPKEVNIQLVVEGIRLLQHRGQESAGIAYAE
FT                   NGEILTIKGSGLVDEVFKENLNKFIKNGIGHVRYSTSGKSSIEEAQPLGDSKIVVAFNG
FT                   TISNYYQFGSFRVDTEFIYKFFKQKLAFRSIPDTVKEFMKVVDGGYSVAILLNDEEIVV
FT                   FRDPKGFHPVVLGFLEGSLIVSSEDSVIRQLGGSVLKHILPSEMIIMKNGKILYDKVIY
FT                   EEKNYATCSFEYIYFARPDSNIDGHSVYLARIRLGELLAEKHPANGDIVVPVPDSSRPI
FT                   ALGFSRKSHIPLEEPLVRTISSVRSFIMPTQDKRNEVLEEKFGVVADAVRGKRIVLIDD
FT                   SIVRGNTMKRIITMLRKAGAKEIHVRIGSPMIKYPCYMGIDFPKREELIAHNKSEKEIG
FT                   NELNADSIEFLSVEEMLQGIGRRDLCNACFSGIYPLKFNYNSTELERIFGK"
FT   gene            547921..549135
FT                   /gene="purF-2"
FT                   /locus_tag="SSO0633"
FT   CDS_pept        547921..549135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF-2"
FT                   /locus_tag="SSO0633"
FT                   /product="Amidophosphoribosyltransferase (glutamine
FT                   phosphoribosylpyrophosphate amidotransferase) (ATase)
FT                   (GPAT) (purF-2)"
FT                   /EC_number="2.4.2.14"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40942"
FT                   /db_xref="GOA:Q7LXR3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR3"
FT                   /protein_id="AAK40942.1"
FT                   /translation="MILMAGILGILAFDDVWNVSRFLYYGLIGLQHRGYSKSGIAILNK
FT                   QRNIFTKLENVAPEDLEIKDLNGWAGIGYAGIRNSYPITIDNGAIVVDGMIDDNNVLNH
FT                   VIREPENAIDDIKKPISFIAISKDGQLIAYRDELGLKPLSIGGFGFDLAVISSEPTSMF
FT                   VIGAEFKREINPGELVIVDKYHIESKQVRIPRKSYCTIEYVYQARIDSMINEREIYDLR
FT                   VKIGEELALEYPINADSVIGVPETALPFAIGYSKKLNIPLDLGFTRTGSPIRTMLSSDA
FT                   FLKIVGVQLKLNPIKSAVKGKRIILIDDSMVTGTTLKNTIFNLRKLGAKEIHVLIGSPK
FT                   LVSQCPYGVEVPDEKELISANLNDETIARVLGADSIHWLSIEGLFKAIGHRDLCLGCMT
FT                   KKYPW"
FT   gene            549129..550580
FT                   /gene="purD"
FT                   /locus_tag="SSO0635"
FT   CDS_pept        549129..550580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SSO0635"
FT                   /product="Phosphoribosylamine--glycine ligase (GAR
FT                   synthetase) (GARS) (purD)"
FT                   /EC_number="6.3.4.13"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40943"
FT                   /db_xref="GOA:Q7LXR2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR2"
FT                   /protein_id="AAK40943.1"
FT                   /translation="MVRKMKVLLVGDGARENVLAYSLARSSKGYKIYALSSYINPGINS
FT                   IVKTTGAEYFIGNVNSPEVIKEVIKKVNPDLGVIGPEDPLFNGIADIFRKEGISVFGAS
FT                   KKCARIEESKAWARELMWKHSIPGRLRYKVFYTIEDTAKFILEYGGSVAIKPAGQAGGK
FT                   GVKVIADLEAYLTHDKREALTKSVNEIGSLYNKEGEPRIIIEEKVDGPEYTLHVLSDGK
FT                   TTISLPLAQDYKNAYQDGIGPETGGMGSISGPNELLPFISNEEYQTTYDIVKRTMDAIY
FT                   KETGERYVGVIAGQMMLTELWGPTVIEYYSRFGDPEASAIIPRLESDFGETIELTATGH
FT                   LNKASIKINEKPSIVRAVATLGYPISKQMASGHKIVVDLEKMKERGCVVFFGSVALEGM
FT                   QLITKGSRALEIVAIGDFEEAAENLDRCMQYISSDTKLIYRTDIGRTVKSQIEKAEIIR
FT                   YSYKNREKRGILGVSADWSPNGGLW"
FT   gene            550574..551545
FT                   /gene="purM"
FT                   /locus_tag="SSO0636"
FT   CDS_pept        550574..551545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SSO0636"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase
FT                   (AIR synthetase) (AIRS) (purM)"
FT                   /EC_number="6.3.3.1"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40944"
FT                   /db_xref="GOA:Q9UX29"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX29"
FT                   /protein_id="AAK40944.1"
FT                   /translation="MVSEEYKKAGVDLEKLRNYHNMISQIISSTYKNTIIGAGHYSGVI
FT                   KIGSLNIAMHTDGVGTKTFLALQTRIIKPVGIDCVAMNVNDLICVGAKPVALVDYIALE
FT                   RPMDNVVNEIIDGIVQGAKEADVEVIGGETAIMPDVIRGFDLSCTAIGVVDKLKTGAEI
FT                   RPGDYVLGLESSGIHANGYSLVRKLIEEGKLSLDEYKNELLKPTKIYVKPILEVMNMIK
FT                   GAAHVTGGAFSKLKRLTSYKIVLNMPDPPQIFKTIEKAGVAHEEMYKVFNMGIGIVLFV
FT                   SEELMKEVKTKLEGYGTVYELGRVYNGNGITIKTYKNEILRL"
FT   gene            551602..552057
FT                   /locus_tag="SSO0637"
FT   CDS_pept        551602..552057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0637"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40945"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR1"
FT                   /protein_id="AAK40945.1"
FT                   /translation="MKQTDIKSLVNYVALKILGGSDYLIEALEEYLVKGEGPATVAYKY
FT                   NISKHQLRGYAQRIIEKSGSEGKAKKLVPILKAISEGITPIVKKENDGSYECSLCNIII
FT                   AKEDSEEHIRKYHKEILNENINIMMQRLEKIKKDLQQNKAVIFTSAS"
FT   gene            552331..553551
FT                   /gene="argG"
FT                   /locus_tag="SSO0638"
FT   CDS_pept        552331..553551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SSO0638"
FT                   /product="Argininosuccinate synthetase (argG)"
FT                   /EC_number="6.3.4.5"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40946"
FT                   /db_xref="GOA:Q9UX31"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX31"
FT                   /protein_id="AAK40946.1"
FT                   /translation="MISIVFKLLLYPFCEMKIVLAYSGGLDTTVSIRWLKETFKAEIIT
FT                   VTVDVGQKDDFKKIEERAYIAGASKHYTIDAVRQFANNYIAYAIKLNGLYEGVYPLSTA
FT                   LARPLIAEKVVEVAKKEGAEAVAHGSTSKGNDQVRFDLAVKALYPDVKIIAPARIWNMT
FT                   REDEIKYAKEKGIPIKVESDKYSIDENLWGRSIEGDIISDPSLEVPEDAFEWTKQIYNK
FT                   KEIVSIEFSNGVPTAVNGEKMELNKLVDFLNLKFGSHGFGRVEHIENRVVGFKSREVYE
FT                   VPAALGLIYAHIDLEKTIYTPMELRFKRHIDQLWSDLVYQGLWFEPLRETLHKVADEMN
FT                   KWISGEAKVEVSNGSFRIVGRESEYSPYSEKIASYNKGWYPSDEMARGFIEIWGMHSLI
FT                   ARRVRGL"
FT   gene            553506..554885
FT                   /gene="argH"
FT                   /locus_tag="SSO0639"
FT   CDS_pept        553506..554885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SSO0639"
FT                   /product="Argininosuccinate lyase (argH)"
FT                   /EC_number="4.3.2.1"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40947"
FT                   /db_xref="GOA:Q9UX32"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX32"
FT                   /protein_id="AAK40947.1"
FT                   /translation="MGNALTNSEKSKGTLMLYRKWGSEKDEVVNYTSSVDSDREIIEEV
FT                   KLTMKAHVISLYLTGYLGKETARKILVALNEFKEIGQGYEDIHEALEDFLIKKVGEDAG
FT                   WIGLGRSRNDHVATALRLRLRNKLIELLTDINSLRKILLDKAKEHITTIFPSYTHLQLA
FT                   QPTTFAHYLTYIEEELASRWEIIFSTLKQVNKSPLGSGAIVGTNVKIDREKEAELLGFD
FT                   SIIYNTLSATSSRADILSTISELTVLMVVLSRIAEDLIFFSSNKLIKLPDSHVSTSSLM
FT                   PQKRNPVTMEILRAKAAESIGMLTSLLSIYKGLPTGYNLDLQEMNKYYWLVINYTKSSI
FT                   GVLSSLFSQIQVNKINIDESSLATDDAELLSISKKVPYRSTYFEIAKKVREGSYKSTLK
FT                   IEDSINMKAVIGSPNFDLMANLIKIRETKLKEDEKEIEEYKLKIISKLGELQVIENEIG
FT                   E"
FT   gene            554869..555972
FT                   /gene="carA"
FT                   /locus_tag="SSO0640"
FT   CDS_pept        554869..555972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SSO0640"
FT                   /product="Carbamoyl-phosphate synthase, small subunit
FT                   (carA)"
FT                   /EC_number="6.3.5.5"
FT                   /note="Amino Acid Biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40948"
FT                   /db_xref="GOA:Q59968"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59968"
FT                   /protein_id="AAK40948.1"
FT                   /translation="MKLENKKGYLYLEDGTFIEGYSFGAKGIKVGEVVFTTSMNGYVES
FT                   LTDPSYKGQILIITHPLVGNYGVPEKKYEQGILTNFESERIQVEGLIVAEHTYPSKWNS
FT                   ALTLDEWLKSENVPGVFDVDTRMIVKKIRTYGTMMGIIASELEIDDPRKYLEKKYDEID
FT                   FTQFTSPKSPIFHPNTGDMIVVVDCGIKHGILYGLYKRGFSIVRVPCSFSASKIIEYNP
FT                   KGIVFSNGPGNPNLLENQIKTFSELVEYKIPILGICLGHQIATLALGGKIKKMKFGHRA
FT                   INKPVIESNSNKCYISTHNHGYGIISKNDIPPNTKIWFYNPDDYTIEGLIHEKLPIITT
FT                   QFHPEARPGPWDTTWVFDKFRTMVTGK"
FT   gene            555969..559124
FT                   /gene="carB"
FT                   /locus_tag="SSO0641"
FT   CDS_pept        555969..559124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SSO0641"
FT                   /product="Carbamoyl-phosphate synthase large subunit
FT                   (carB)"
FT                   /EC_number="6.3.5.5"
FT                   /note="Amino Acid Biosynthesis, Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40949"
FT                   /db_xref="GOA:Q59969"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59969"
FT                   /protein_id="AAK40949.1"
FT                   /translation="MRETPKKVLVIGSGPIKIAEAAEFDYSGSQALKALKEEGIETVLV
FT                   NSNVATVQTSKKFADKLYMLPVVWWAVEKVIEKERPDGIMIGFGGQTALNVGVDLHKKG
FT                   VLQKYNVKVLGTQIDGIEKALSREKFRETMIENNLPVPPSLSARSEEEAIKNAKIVGYP
FT                   VMVRVSFNLGGRGSMVAWTEEDLKKNIRRALSQSYIGEVLLEKYLYHWIELEYEVMRDK
FT                   KGNSAVIACIENLDPMGVHTGESTVVAPCQTLDNLEYQNMRTYTIEVARSINLIGECNV
FT                   QFALNPRGYEYYIIETNPRMSRSSALASKATGYPLAYVSAKLALGYELHEVINKVSGRT
FT                   CACFEPSLDYIVTKIPRWDLSKFENVDQSLATEMMSVGEVMSIGRSFEESLQKAIRMLD
FT                   IGEPGVVGGKVYESNMSKEEALKYLKERRPYWFLYAAKAFKEGATINEVYEVTGINEFF
FT                   LNKIKGLVDFYETLRKLKEIDKETLKLAKKLGFSDEQISKALNKSTEYVRKIRYETNTI
FT                   PVVKLIDTLAGEWPAVTNYMYLTYNGTEDDIEFSQGNKLLIIGAGGFRIGVSVEFDWSV
FT                   VSLMEAGSKYFDEVAVLNYNPETVSTDWDIARKLYFDEISVERVLDLIKKEKFRYVATF
FT                   SGGQIGNSIAKELEENGVRLLGTSGSSVDIAENREKFSKLLDKLGISQPDWISATSLGE
FT                   IKKFANEVGFPVLVRPSYVLSGSSMKIAYSEEELYEYVRRATEISPKYPVVISKYIENA
FT                   IEAEIDGVSDGNKVLGITLEHIEEAGVHSGDATMSIPFRKLSENNVNRMRENVLNIARE
FT                   LNIKGPFNVQFVVKENTPYIIELNLRASRSMPFSSKAKGINLINESMKAIFDGLDFSED
FT                   YYEPPSKYWAVKSAQFSWSQLRGAYPFLGPEMKSTGEAASFGVTFYDALLKSWLSSMPN
FT                   RIPNKNGIALVYGNKNLDYLKDTADNLTRFGLTVYSISELPLQDIETIDKMKAEELVRA
FT                   KKVEIIVTDGYLKKFDYNIRRTAVDYNIPIILNGRLGYEVSKAFLNYDSLTFFEISEYG
FT                   GGI"
FT   gene            559125..559973
FT                   /gene="rimK-2"
FT                   /locus_tag="SSO0645"
FT   CDS_pept        559125..559973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK-2"
FT                   /locus_tag="SSO0645"
FT                   /product="Ribosomal protein S6 modification protein
FT                   (rimK-2)"
FT                   /note="Translation, Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40950"
FT                   /db_xref="GOA:Q7LXR0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXR0"
FT                   /protein_id="AAK40950.1"
FT                   /translation="MKIALVVDIIRQEEKLIIKALNERQIDYDVINVGQEPIPFNKALS
FT                   KYDVGIIRPVSMYRALYSSAILEAAGVHTINSTDAIGTCGDKILTYSKLFKHGIPIPDS
FT                   IIAASPDAAMKAYEQMGFPLIDKPPIGSWGRMVSLIRDVYEGKTIIEHREMLNNSALKV
FT                   HIIQEYIKYKERDIRCIVIGDELLGCYARNIPPNEWRANVALGGNPTPIQLDDNIRELA
FT                   VKSVKLVKGEFVSIDILEHKSKGYVINELNDVPEFKGFMLATGINVAEKLVDHIVKTYR
FT                   A"
FT   gene            complement(559954..560547)
FT                   /locus_tag="SSO0646"
FT   CDS_pept        complement(559954..560547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0646"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40951"
FT                   /db_xref="GOA:Q7LXQ9"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ9"
FT                   /protein_id="AAK40951.1"
FT                   /translation="MLVEKIKGYLNSISGVLQERFENRERVLMLARELIRYCGETISLS
FT                   HKGKKEEALKKYQIAISKVSEIQKIIDSFPELLYGDVGTAYQELAEASIVISLYFDVEL
FT                   KLSKELGIPDIYYISGIADAIGEMRRRVLELLKKNKIDEAENTYNIMEELYELLWSFEY
FT                   PKSLVPGLRQKIDTIRRLLEETNHDIFLAKLGRS"
FT   gene            560615..561589
FT                   /gene="hdb-1"
FT                   /locus_tag="SSO0647"
FT   CDS_pept        560615..561589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdb-1"
FT                   /locus_tag="SSO0647"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase (hdb-1)"
FT                   /EC_number="1.1.1.157"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40952"
FT                   /db_xref="GOA:Q7LXQ8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ8"
FT                   /protein_id="AAK40952.1"
FT                   /translation="MFIHMKSINKVAVIGAGVIGVGWTTLLLAKGYKVNLYTEKKETLE
FT                   KALAKVSAYLVNLKNLGMINEEPESYITNLTGITKIDDAIHNVDFVIEAIIEDYTAKKN
FT                   LFKLLDTQLPQDIIIASSTSGLLMTEIQKAMIRHPERGVIAHPWNPPHLLPLVEIVPGE
FT                   KTSKETVDLTREFMEKLDRVVVLLRKEVPGFIGNRLAFALFREAVNLVDEGVATVEDID
FT                   KVMTAAIGLRWAFMGPFLTYHLGGGEGGIEYFFSKGFGYGANEWMHTLAKWDKFPYTAV
FT                   KKVLEQMKEYEFIKGKSFQDLSRWRDEKLVTIYKAVYKEKCNS"
FT   gene            complement(561606..562142)
FT                   /locus_tag="SSO0648"
FT   CDS_pept        complement(561606..562142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0648"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40953"
FT                   /db_xref="GOA:Q7LXQ7"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ7"
FT                   /protein_id="AAK40953.1"
FT                   /translation="MEVLKRVDKQDVLKGEVEELVKQIEQDDLKVVTFMEYTNPPEKVK
FT                   PKLIKFEKVLPLLERIAESGKIQNGVAKIMFFSPSTCRNRGLTPTMMAGFQLIKPGIAT
FT                   KPHSHNMASIYLVFRGRGYSVIGKEKIEWKAGDVFVVPANEIHYHVNTGDDDCILFDVT
FT                   DSGLLESLGILEFRE"
FT   gene            complement(562244..562795)
FT                   /locus_tag="SSO0649"
FT   CDS_pept        complement(562244..562795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0649"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40954"
FT                   /db_xref="GOA:Q7LXQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ6"
FT                   /protein_id="AAK40954.1"
FT                   /translation="MANKLYEALKYVVKYELKSSIRRYIVLGAFDGILLTLSILLAGVI
FT                   SHIGLTSISLSIYSGIIATAISSTWNALVVELGEKKTELEKIEKQVLKSLKGTIYDYSA
FT                   RIAAALAAIAHGISPFLGLLVLYAYEYSHSTMLSLGVGISSLAVLGLLYGEGIKAKIST
FT                   MVQLIVAGIITALITLLVIK"
FT   gene            562836..563246
FT                   /locus_tag="SSO0650"
FT   CDS_pept        562836..563246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0650"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40955"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ5"
FT                   /protein_id="AAK40955.1"
FT                   /translation="MLLMNRQILLALALLVIVVMAIGVYEGNKYRTEISTVALGSQQTD
FT                   GMYMLKVNVIMNYGPFGGKSPLSNAVIWVYKYNGTTYSFYTYNFTNSQGIASFNLPAGQ
FT                   YKILVTQLRLTYIVNLNQNEEVIINYAYLNSG"
FT   gene            563330..563821
FT                   /locus_tag="SSO0651"
FT   CDS_pept        563330..563821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0651"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40956"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ4"
FT                   /protein_id="AAK40956.1"
FT                   /translation="MMSIKIDVVRIDIPEGTNVIIGQSHFIKTVEDLYETLSSSSPNLK
FT                   FGIAFNEASSKRLIRYDGNDQELIKLAIENAKKIGAGHVFVIYLKNGYPINVLNRIKNV
FT                   EEVVRIFVATANPLQVIVAETDQGRGVIGVVDGYAPLGVESEADIQERKEFLRKIGYKR
FT                   "
FT   gene            complement(563750..564202)
FT                   /locus_tag="SSO0652"
FT   CDS_pept        complement(563750..564202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0652"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40957"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ3"
FT                   /protein_id="AAK40957.1"
FT                   /translation="MLGRVLLFYKKGIFNDDLKKFLRSKNINVIDVRIGKYVEVDIMDD
FT                   PRKVISLIGEPLFMVTEISGTFKPLFYEMRFWECHEIIEEKWREVKNKDDKKFLQAIIL
FT                   LCASLIKYLKGEIEVSDMLMEKALSLISDLPQELLPLLYISLGLNT"
FT   gene            564264..565319
FT                   /locus_tag="SSO0653"
FT   CDS_pept        564264..565319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0653"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40958"
FT                   /db_xref="GOA:Q7LXQ2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ2"
FT                   /protein_id="AAK40958.1"
FT                   /translation="MTKEAVLYKKEDGRIRCLACARKCLIGEGQVGFCGVRSVRNGKLY
FT                   LDVYGKIAAAHIDPIEKKPLVHFNPGSKVFSFSTYGCNWMCMYCQNYDISQRRKAEGVE
FT                   LSPEEIVELAMGYDVDGMTYTYNEPAIFSEFAHDVGIVAKRYGLFNTMVSNGYWTPNLV
FT                   DYVKDFLDAVTIDFKGNGEQKFLRRYTGATSAEPIIETASELSKKGIHVEITDLIIPQI
FT                   GDDLQAAKQLLTKLYDQLGADIPIHFLRFHPDYKLNYIPWTPVETLERHYKLAKELGFK
FT                   FVYVGNVPGHPYENTYCPNCGNLVIRRYSFDILEWHLTEDMRCKFCGYKLPIRGKLSRH
FT                   AFKERFEPVFI"
FT   gene            complement(565312..566070)
FT                   /gene="paaF-2"
FT                   /locus_tag="SSO0654"
FT   CDS_pept        complement(565312..566070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaF-2"
FT                   /locus_tag="SSO0654"
FT                   /product="Enoyl CoA hydratase (paaF-2)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40959"
FT                   /db_xref="GOA:Q7LXQ1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ1"
FT                   /protein_id="AAK40959.1"
FT                   /translation="METIVTKEEPPIEWIVLNRPDKLNSINSIMIREIGDILRQIVDND
FT                   KIKVVIFTGSGKAFSAGADISQFKDLDPVKAWEFAIKGRELMDYIERYPKPTIAMINGY
FT                   ALGGGLELALSCDLRIASQIAELGLPEINLGIYPGFGGTQRLVRLIGKGRAMEIIMLGD
FT                   IIKADYAERIGLVNRVVEPSSLEKEVRELALKLAEKPQIAIRLIKTVVNYGNDAPILSG
FT                   LTLESLGWGIAFATEEEKKRVNEFLSRRSK"
FT   gene            566143..566694
FT                   /locus_tag="SSO0655"
FT   CDS_pept        566143..566694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0655"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40960"
FT                   /db_xref="GOA:Q7LXQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXQ0"
FT                   /protein_id="AAK40960.1"
FT                   /translation="MTRRDIIISIISALPPIIGTTITSFIMSRRYGDLKEVIKYVIIGL
FT                   PVTLAITYYLILNIFPKYVDYLIAIPALLPLPISFLLTRNNISINYSEDYIEIKFKIPI
FT                   NMTSHDPHELFNYVFNKALGKIRNPYYHYKLSAAANCSGLKVSYQNEDKLVIRRKCGDI
FT                   DIRIIISSKKIADMVIDISY"
FT   gene            complement(566686..567546)
FT                   /locus_tag="SSO0656"
FT   CDS_pept        complement(566686..567546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0656"
FT                   /product="Cytochrome C oxidase folding protein"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40961"
FT                   /db_xref="GOA:Q9UX46"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX46"
FT                   /protein_id="AAK40961.1"
FT                   /translation="MMSLQQKIKAYLKLGKLGVVSLLDLAAIAGAFLAYKHGISLLPII
FT                   PMLIGGTLASMGAMIINSGIEINRDKVMSRTSNRPTVVGYVSRKEVIVVGSLLAVLGTA
FT                   LGFIDNALTAFFIALGVIIYVFVYTILLKPRTWLNIVIGGFAGSAAAWAGYTSLTNSLT
FT                   LEAFLLGFLIFMWTPGHFWSLALKYREDYINAHYPMLPAVVGITTSARAIATSNALMIP
FT                   IVLLMGYYISLIALIVFSVLSALLLFLSYRLILNPTKEEAMKSFIFSNIYLMLILLSII
FT                   IIKLI"
FT   gene            complement(567579..568523)
FT                   /gene="thrA/hom"
FT                   /locus_tag="SSO0657"
FT   CDS_pept        complement(567579..568523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA/hom"
FT                   /locus_tag="SSO0657"
FT                   /product="Homoserine dehydrogenase (thrA/hom)"
FT                   /EC_number="1.1.1.3"
FT                   /note="Amino Acid Biosynthesis, Aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40962"
FT                   /db_xref="GOA:Q7LXP8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP8"
FT                   /protein_id="AAK40962.1"
FT                   /translation="MKLLLIGYGNVGKAFRRLLHEKKDNYPILQGVEIAGIITRQGLMV
FT                   GDKENFSPDKQLTVLEAIDYINPDVIVDMSVPNYKDGEPSVSAYIKALSRKIHVITVNK
FT                   APLALKFREIFEVAEKTGAKIGFQGTVMSGTPSINLFRIQPVAEVSRIRGILNGTTNYI
FT                   LTRIYEGLSFNEALKEAKEKGYAEEDPTLDLNGFDAAAKLTILSNFIMNRSLKLGDFKF
FT                   KGITEITNEEIRRAKSEGKKIKLIAYADNYVVQVSPQIIGPQDPLYYIDGVENALEIQN
FT                   EIQRIIIRGPGAGPINAAYGALSDLVLLLEGCL"
FT   gene            complement(568520..569194)
FT                   /locus_tag="SSO0658"
FT   CDS_pept        complement(568520..569194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0658"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40963"
FT                   /db_xref="GOA:Q7LXP7"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP7"
FT                   /protein_id="AAK40963.1"
FT                   /translation="MKRLSISEDVRRLGVFVAMTEVSNVDAKRPLDTLDDIIRNLEEKY
FT                   ASQDVESLRNDPVVRAYRDFYWRIGIDPTKTRPSGEALRRRLARGNKLPRINIVVDIGN
FT                   IVSAETLVPIGLYDRDKIVGDLHLVMSKGNEEFLGLGKKKEKLDKGIPILVDDEGKVLH
FT                   IYPHRDSVLTSITLNVKNVVIIGAGVPNIDENLVKYAVDRVADLLEKVCNGKREYNTMV
FT                   IR"
FT   gene            complement(569181..569582)
FT                   /locus_tag="SSO0659"
FT   CDS_pept        complement(569181..569582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0659"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40964"
FT                   /db_xref="GOA:Q9UX49"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX49"
FT                   /protein_id="AAK40964.1"
FT                   /translation="MSAEKISISLPKELYRELEDFIIRKGIPDRSKIFQIALRNYLDEN
FT                   RDGNEIIYGIINLVYDHEEASEALTEIQHEYNDSIISTLHLHVSEKICIEAIAVKGEKR
FT                   KLVELNNKLGQIRGILKARLLISFPYEKT"
FT   gene            569617..570948
FT                   /gene="tldD"
FT                   /locus_tag="SSO0660"
FT   CDS_pept        569617..570948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="SSO0660"
FT                   /product="Zn-dependent protease, tldD protein homolog,
FT                   putative (tldD)"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40965"
FT                   /db_xref="GOA:Q7LXP6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7LXP6"
FT                   /protein_id="AAK40965.1"
FT                   /translation="MFKYIKKAEELGASFADIRYERVIANEVTITEDRKYVSHGVDEGY
FT                   SIRVIYNRNWGFKATDKITENEIEDTINHIYGDERVNIVYLPSKHDTIKIGKDINKNEE
FT                   EKINDLHKVASQVNTLHPSIKSYSIKYYDEIFHKEYYSSEDREIIADGSSSSLSILVVA
FT                   REGDVTVEVSEILSTQMGYIFDVFDINQVLANLQKRIINQLKGSTPKAGEYPVILAPEV
FT                   VGIFTHEAIGHLSEADVTLNGSLYKLRNKRIGDEFLNISDLPAMDHPQSSLVYYDDEGV
FT                   EGREVKIIENGILKEFMTDRYYSAYLGQPPTGNARAQSYRNFSLIRMRNTYMKPGDASL
FT                   NELFEGIKEGYYLVSPIGGETSSNGTFQFAIQEGYRVENSEIKEPLRNIGISGNTISTL
FT                   NAIEMISKDFGMSSGFCEKNGQTVQVSNGGPHIKVKKLKVGGYV"
FT   gene            570941..572200
FT                   /gene="tldE"
FT                   /locus_tag="SSO0661"
FT   CDS_pept        570941..572200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldE"
FT                   /locus_tag="SSO0661"
FT                   /product="Zn-dependent protease, tldE protein homolog,
FT                   putative (tldE)"
FT                   /note="Proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40966"
FT                   /db_xref="GOA:Q7LXP5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP5"
FT                   /protein_id="AAK40966.1"
FT                   /translation="MYERLISRAKAMGISLEIFSVKMREYTIAKDKFYVPIIVEETGYG
FT                   IRLIDEKYRIGYIYTKKLNDNVLEEALKIAKLGESDKANILPSKQPVKRINENQINEDV
FT                   VQDTIKDLIELEEKVNLTSASASAINYEVSIFNTEGVEVSEKRGVLSVQASANDGNNSP
FT                   EIYEYLIKRDSKISLEKLKASIIEKVKIMKKKERIDPKGYDVTFTQKALDSLFSSLFPS
FT                   LFSARNFYKETSPFKLGELVNENLEIIDDPLNQSLPFSRSFDDEGNPSRVSKVIESGLV
FT                   KRPLTNTYWATRMSVENTSSASRNLDWVVPSYFIPPHVDFSNIIFDYKNTESNIEENSV
FT                   IVDQLEGIDTADLSSGNFSLVANVSWLNRKDEKIGLEELLITGNLKQLLKNIVSTSKNI
FT                   ENYGKVVSGKLKVRGLSLLM"
FT   gene            complement(572192..572893)
FT                   /gene="bioR"
FT                   /locus_tag="SSO0662"
FT   CDS_pept        complement(572192..572893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioR"
FT                   /locus_tag="SSO0662"
FT                   /product="Biotin--(acetyl-CoA carboxylase) synthetase
FT                   (bioR)"
FT                   /EC_number="6.3.4.15"
FT                   /note="Cofactor Biosynthesis, Biotin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40967"
FT                   /db_xref="GOA:Q7LXP4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP4"
FT                   /protein_id="AAK40967.1"
FT                   /translation="MCGSMLVIRLNKVTSTQDFAEAISNMLFEDFLVIAEEQTKARGRL
FT                   GRSWYSPKGGLWFTYVKKNFKTEEIQLSSLKVAVAVLDVLRKFVDAKIRWPNDIVVNDK
FT                   KIAGILIEAKTYEEDIKLADLFIGAGIDILIKEFPSDLNATSLYLEIGKEVELNIDEVI
FT                   GKIEEHLKLDNRKIIDIVNQYLSIKDREVTLKGENWEKRCKALFVDYMGRLVTECGIYE
FT                   VEEIYRVEVSH"
FT   gene            complement(572859..573935)
FT                   /locus_tag="SSO0664"
FT   CDS_pept        complement(572859..573935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0664"
FT                   /product="SUA5 related conserved hypothetical protein"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40968"
FT                   /db_xref="GOA:Q7LXP3"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP3"
FT                   /protein_id="AAK40968.1"
FT                   /translation="MTEVLKVDPLYPELDKIKKAANVIKAGGTVVFPTETVYGLGANAL
FT                   DPEAVKKIFIAKNRPMDNPLIVHISNIDQLYEVAKDIPKKIINLVNIVWPGPLTFVLKK
FT                   TEKVPKETTGGLETVAVRMPAHPVALALINESGVPIAAPSANLATKPSPTRVEHVIDDI
FT                   YGKVDVILDSGETFFGVESTVINVTVDPPVLLRPGPFSVEELERLFGKVVVPEQAKGTA
FT                   EFDVALAPGMKYKHYAPTKRLLVVENRSVLRGVINELQKRSCRIALLCASEVCKQFRGE
FT                   KIEIIELGSENNLYEISRNLFDSFRKLDKSNVDIGVIHSISEKGIGLAIMNRTRKASGF
FT                   SSIYNIEDVWKYVGNKTQ"
FT   gene            574064..574576
FT                   /gene="NuoB"
FT                   /locus_tag="SSO0665"
FT   CDS_pept        574064..574576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoB"
FT                   /locus_tag="SSO0665"
FT                   /product="NADH dehydrogenase subunit B (NuoB)"
FT                   /note="Energy Metabolism, Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40969"
FT                   /db_xref="GOA:Q7LXP2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP2"
FT                   /protein_id="AAK40969.1"
FT                   /translation="MTEQTILMGNLNEVAKKAAQWLINRKPIKSIIDWGISFSLWPPHF
FT                   TTSCCGTEFGAFAAARFDAERYGMLPFSSARQSNILILEGTLSRKMGRAARIVYDQMPE
FT                   PKYVIALGACILEGGIFWNSYNTVLPSDIGIPVDLYVPGCPIRPEAVARAVLMLQKKIR
FT                   TQGALKT"
FT   gene            complement(574555..575757)
FT                   /locus_tag="SSO0666"
FT   CDS_pept        complement(574555..575757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0666"
FT                   /product="Glycerate kinase, putative"
FT                   /note="Uncategorized"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40970"
FT                   /db_xref="GOA:Q7LXP1"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP1"
FT                   /protein_id="AAK40970.1"
FT                   /translation="MDIVDKILEYTDPYKALQEKVRVYNNILLFNNEKIPFKKPILISI
FT                   GKASLPMARFFRERMELKAKLIVTPKGTNGKENDVIEAGHPLPDENSIKAGKRMIELLA
FT                   NEDYDLVIFAISGGASALVEYSEIPLDELKIINKVLVTSGLGINKINIVRKHLSKVKGG
FT                   KILEYVKDKIPIVSFIVSDVPGNDISSIGSGLTSIDNSSNDDALEILKAIGLEKYSKYL
FT                   TETPKSFSRIVKNYIILDNMEVLRKLANTLVNSFILTSEIRGEARDVGAIIASIYNSSE
FT                   SYNIPFRRPYYLLVGGEPEVTIQGKAGKGGRNGEVCLSFLKYAKKRNRFELLGFATDGI
FT                   DGNSEYAGCKVSSDMEIREDEINNALETHNSYGLLESHKAVIKTGYTHTNVNNIYVLRA
FT                   P"
FT   gene            complement(575760..576098)
FT                   /locus_tag="SSO0668"
FT   CDS_pept        complement(575760..576098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0668"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40971"
FT                   /db_xref="UniProtKB/TrEMBL:Q97ZQ7"
FT                   /protein_id="AAK40971.1"
FT                   /translation="MDELMKKILIHIYKYGPDNPWYMARRLLGESGWIAKYDMAQIEEA
FT                   CKKLEELGYLIRFKGSLKKSVTSSIKPWLKVKARELDHKPNGIYYDLSKEGRKVASLLY
FT                   KEYRKENG"
FT   gene            complement(576091..576729)
FT                   /locus_tag="SSO0669"
FT   CDS_pept        complement(576091..576729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0669"
FT                   /product="Iron-dependent repressor"
FT                   /note="Regulation"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40972"
FT                   /db_xref="GOA:Q7LXP0"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXP0"
FT                   /protein_id="AAK40972.1"
FT                   /translation="MVELSEPLENYLKEMYEIEEIKGSAKVSELISIFNISPGTISKAL
FT                   NKLEKLGLVERTNDRKIKLTEEGKRIAERLIKSHRLSERLLTDIVGVDWIRAHELAHRL
FT                   EHIWPDDILERIDRLLGYPTTCPHGHPIGNRIKVSGKKLSEINIAGKYKVVMIVREEEW
FT                   ILREATRLGLKPGVVLEVIENNGTDIKIKIGEEIEEVSKVIGDQVLVIG"
FT   gene            577067..577486
FT                   /locus_tag="SSO0670"
FT   CDS_pept        577067..577486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0670"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40973"
FT                   /db_xref="GOA:Q7LXN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN9"
FT                   /protein_id="AAK40973.1"
FT                   /translation="MYKVIFRIKGGYGTSFRELRQAGFTPIYFRRDKGEEYYVTIFTGK
FT                   DLSEVKEAILDLSYYLSKWGKYGDHNFATIYEVKNQNLGKVAGGALGALAGYYLGGLAG
FT                   LVIGALGGIFLGELVDIEMGEKLVGVLGWPMSISR"
FT   gene            577462..577875
FT                   /locus_tag="SSO0671"
FT   CDS_pept        577462..577875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40974"
FT                   /db_xref="GOA:Q7LXN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN8"
FT                   /protein_id="AAK40974.1"
FT                   /translation="MAHVNKQIRKRLVSISLGILLLTTSIFLLIKTGINSEQLQSALFF
FT                   GISPILFYMLGIIFGLERIVFGVTGSEKLFRLLAGDGELYYTALLGVFFIFIISGVLIL
FT                   AYTPLIAGIIEKVLELINGLSFFALSATLFMRS"
FT   gene            complement(577862..578560)
FT                   /locus_tag="SSO0673"
FT   CDS_pept        complement(577862..578560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0673"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40975"
FT                   /db_xref="GOA:Q7LXN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN7"
FT                   /protein_id="AAK40975.1"
FT                   /translation="MIFSCPIDRSDVNEKLECEKGHKFGIIGGQIYDFLLKDVEVDKLL
FT                   SRVIPIYESIWAPLGLLITSGKTYTSFLREIGEFIDGDLIIDVGTGTGKIFDFLNCKTC
FT                   IGIDVSLRFLMYMKRKRTRVIAVRADANNLPLKSGIADGISSTLVLHMLSNPSFAIREM
FT                   SRVLKSNGKCSIAVLANVNSIIGKTLSRWWKVNLRHYDYYINLLQENSLKVVERKELGP
FT                   WEVINCIKIS"
FT   gene            complement(578557..579279)
FT                   /locus_tag="SSO0674"
FT   CDS_pept        complement(578557..579279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0674"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Weak hit with inosine 5' monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40976"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN6"
FT                   /protein_id="AAK40976.1"
FT                   /translation="MSVQINGAEIISLDPNAYVTDALFFMRRNNVRRLVVSNSSNIIGV
FT                   FTIENAIRQILENRLEVRLNELKLRRPVYVEDNYIKSIVGTMIGESSDFVLYRGKYIIT
FT                   EKDVVRSFNWSSVKGSVEGISKDAIVVQPFTKISTCIETMLKNNIRHLPIVNGIALGIV
FT                   SARDIAYSYDSVTGNTIVEKIMNVNLVTADDNSELSYAINLMIGRNVGSLIVKTRVKNK
FT                   VKILTNRDLIKLIFSYIL"
FT   gene            complement(579263..579772)
FT                   /gene="mobB"
FT                   /locus_tag="SSO0675"
FT   CDS_pept        complement(579263..579772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="SSO0675"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B (mobB)"
FT                   /note="Cofactor Biosynthesis, Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40977"
FT                   /db_xref="GOA:Q7LXN5"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN5"
FT                   /protein_id="AAK40977.1"
FT                   /translation="MACIFHIIGKKDTGKTSVIESVLREIKKDNLKVAVVKHSHHKLDL
FT                   AGKDTYRYRNSGSDLILFQEGEEESVLFMPSVSSLTLITLLPVDVILVEGFSNVDIGKK
FT                   YIINNVNEVEAISKQVINDIKKECQKTNRALILDNVKVEVTSDNALLLTLYNLMKVLGV
FT                   KNVSSD"
FT   gene            579806..580975
FT                   /gene="moeA-1"
FT                   /locus_tag="SSO0676"
FT   CDS_pept        579806..580975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA-1"
FT                   /locus_tag="SSO0676"
FT                   /product="Molybdopterin biosynthesis protein (moeA-1)"
FT                   /note="Cofactor Biosynthesis, Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40978"
FT                   /db_xref="GOA:Q7LXN4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN4"
FT                   /protein_id="AAK40978.1"
FT                   /translation="MALIPVEEARKIISNTNFEVKRREKYVEIFQALGKIAVEDILAVK
FT                   SMPERSLSAMDGYAIKYDDYLKYGKLRVVGKLYPSTSNIPELKEGETYYVTTGSPLPLY
FT                   ADSVVPVENSRLEGEYVIFKGEVKKGKNIREEGEDINIGQIIIQKGTEITPYYLGILIQ
FT                   QKIFHVKVSDLKFTVFANGDEITSFENPQKNKIIDSISPILIKILEKFGSVKYMGVAKD
FT                   DLNDVTEKIEKSLEISDVIISVGGSSVGEKDYVKKAVNKLGEVLFDGVSVNTIKRGSVG
FT                   RIQGKPILILPGQVVSAITAFHEFGLSVLSNILGTNLKKFIKSTLVEDIYVNHSMDSVY
FT                   LFNVKGNSAFPLRWGVGLYSELAKANGFAILKRGLTYKKGEEVELQQLI"
FT   gene            580953..581537
FT                   /gene="mobA"
FT                   /locus_tag="SSO0677"
FT   CDS_pept        580953..581537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="SSO0677"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A (mobA)"
FT                   /note="Molybdopterin guanine dinucleotide biosynthesis;
FT                   Cofactor Biosynthesis, Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40979"
FT                   /db_xref="GOA:Q7LXN3"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN3"
FT                   /protein_id="AAK40979.1"
FT                   /translation="MSYNNSYDVIILAGGLSKRFGADKCCFEVNSKTMLDRLLEQFDNP
FT                   IVVSRSPRRIKKGILVIEKGEYEGPVKGVREGLKYVRRDRVFITGCDFPFLIKNLVDYV
FT                   CSKPYDIVIPFDHRPQPLLACYSTELLNKNIDKINGLVELIELSSSVYFIGTEELLKID
FT                   PFLYSLININSIIDLIYRPIRIKTKSNFILR"
FT   gene            581925..582593
FT                   /locus_tag="SSO0678"
FT   CDS_pept        581925..582593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0678"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40980"
FT                   /db_xref="GOA:Q7LXN2"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN2"
FT                   /protein_id="AAK40980.1"
FT                   /translation="MKICVLYSGGKDSTYALHWAVFKGFEVVCLITLIPKREDSWMFQY
FT                   PNVIYTKYQAEAMDFKLITFGTSGEKDKELEDLKKALLQAKNEGADGIVSGALLSDYQR
FT                   LNISIIAEELGLKTYTPLWRKSQEEYMRWLVKEGFKFIITSASAYGFPFDLVGKEITTE
FT                   DVEKIIERARRYGFNPAFEGGEAETFVTYAPLFKTQLRVNGKLKRISEYECRYEITDIH
FT                   "
FT   gene            582563..583798
FT                   /gene="trzA"
FT                   /locus_tag="SSO0679"
FT   CDS_pept        582563..583798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trzA"
FT                   /locus_tag="SSO0679"
FT                   /product="N-ethylammeline chlorohydrolase, putative (trzA)"
FT                   /note="Cellular Processes"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40981"
FT                   /db_xref="GOA:Q7LXN1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN1"
FT                   /protein_id="AAK40981.1"
FT                   /translation="MQIRNNGYTLKNCRFIVNYDKILENVNIVIQNGYIKNVGREVEGD
FT                   EVDCSEYIAIPGLVNAHTHTPMIILRGYYDDAELTEWLKKIWEFEKVFKLNEMNIASEL
FT                   AIMEMLSKGTTAFIDMYFNPEGVKEIAEKYGIRAYAGYTFLNSLFEPHEIDKKQRQLKT
FT                   SELFKPIVNVHSIYSTSIETLKLAKQIAEETDTWIHIHVSETRSEIYEIKKKYGKFPVE
FT                   LLNELGIVKNAQLVHLGWIANWELRYVNQATHCPTSNMKLATAGFFPFKELMENGVNIT
FT                   IGTDGAASNNSLDMFREMKNAVLLQRHSYWDVGVKAFHAFRAATENGYKLINLKGGRIE
FT                   EGYIADIVLLKKDKLYPLRKDRILSNIVYYTVGEYVGKVIVNGRIVYDEKVEREFDKRR
FT                   RELLKLLDEIIS"
FT   gene            complement(583766..584650)
FT                   /locus_tag="SSO0680"
FT   CDS_pept        complement(583766..584650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0680"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40982"
FT                   /db_xref="GOA:Q7LXN0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXN0"
FT                   /protein_id="AAK40982.1"
FT                   /translation="MVEIIIPVGPNDKLEWVKRSVNSALLQSVDKVIIYDNSERADIYN
FT                   FFQELKDKLVYIKDKRMTKVNMARLRNKMLSLASDKYVIMLDSDVVIPKNYSNNIINKL
FT                   ERGVAYTWIHYAYSEEEIEKPLSISENNPNLGCAGLNLEVIKRIGYFDERYERDEDVWL
FT                   YAKLKKTGYKVEPAEGRCLHLNKVHARLNLSSSVAEARRNLWRSKYDIMLMFDGLTDFT
FT                   FLTGYSYYGSYYILAILSVIFHPLTFLYLPLIGYGVYYYKGPKKYLLNLIPGLSLAISF
FT                   PYGLGYNLIQKLK"
FT   gene            584670..585737
FT                   /locus_tag="SSO0681"
FT   CDS_pept        584670..585737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0681"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40983"
FT                   /db_xref="GOA:Q7LXM9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR038013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM9"
FT                   /protein_id="AAK40983.1"
FT                   /translation="MKKIKVAVIAHGLGMSMGYSGEGNIYKTFFEMLEERKIDYTAISF
FT                   AKPYNTSIPSVYTLPFHLPKLDKYQRLLTYYTAKKVKPDLYLNASGVPIPLSKIAPHIV
FT                   YAGAPSIANLPSKYTRSLFWKLYLLPFRLVINKIKEEGKRAKIIANSRYSAKAIAEVYE
FT                   ISEPKVIYPPVDVGYFQRAYNEEKRENFFVTIGRIERGKMLENSILLSAKSGVKGVIIG
FT                   SLNEKDYLKKLINLKRELNADIEIITNLPREELLKVLSKAKVYFHATIGEHFGVPVVEA
FT                   MASGVIPIVPKESGAYEVVPEFSYSDIEEAVTLLKSLLEKENVELRRELKDRALNFSKE
FT                   NFKRKIFNEISSIIF"
FT   gene            complement(585724..587703)
FT                   /locus_tag="SSO0683"
FT   CDS_pept        complement(585724..587703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0683"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40984"
FT                   /db_xref="GOA:Q7LXM8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012075"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM8"
FT                   /protein_id="AAK40984.1"
FT                   /translation="MVDYYPSGCGVFGILRKRDAPKVKGDLVVRAIDRVRYRGSDKGAG
FT                   FAVFNLEKRNYYVIKAFYNGNPSELKEVFSKYGIEVKNVELVSKYSNLCDCNLIALGDI
FT                   NEVRKAIRNINEIMWNGKERKGRVYSVGSSLHVYKGVGYPRDVAEQYRVEEIEGDLWLA
FT                   HTRQPTNSPGYYPFWSHPFSSFNIAIVHNGDVSSFGANVEYLNSRGLNSFVGTDSEVLA
FT                   FLFEELIAEGLTVEEAVKILINPSRRFDGLPKDVDYLYRNARLDGPFTAVIGYDSGDDL
FT                   YLIAIADRSKFRPAIVGEDDSYYYIASEENEIREVSPKAKVWTLKPGSYFIASYKKGVI
FT                   SYGRSNEELKTFSPPPIMVPEKYDINAYNIGYKELNYEILKLAEKGKREITVANVLGHR
FT                   YIGINLPARGINNLRINLYGVIGNAMANLNEGNEFYVYGNVADDCCDTMHGGKVVIYGD
FT                   ARDVLAQTFQNGKIFVKGNAGNRVGIQMREYKDKRPYLIIGGIVDDYLGEYMAGGSIIV
FT                   FGKGYNGEPVGNFVGTGMVGGRIYIRGKVSPSKLGLQPPKYEVMRLIKALFLEGLISSE
FT                   EYDSLKNEEYIGIVNKLKGEAKEYAKKLFEEKIGVPMYEYRELTEEEFKELSPVVNEYS
FT                   KDMMDHSYEELLKEKFTVVTARKL"
FT   gene            complement(587703..589946)
FT                   /gene="gltB"
FT                   /locus_tag="SSO0684"
FT   CDS_pept        complement(587703..589946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="SSO0684"
FT                   /product="Glutamate synthase (NADPH) subunit alpha (gltB)"
FT                   /EC_number="1.4.1.13"
FT                   /note="Amino Acid Biosynthesis, Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40985"
FT                   /db_xref="GOA:Q7LXM7"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM7"
FT                   /protein_id="AAK40985.1"
FT                   /translation="MIIEYNKLGTILYSRISHKQLYNIFHYSYHEVRLLVYNKYLPIPK
FT                   QFNDEFWTVEKVEHIRYLSLTGKPYKIFNEDMNSLRVLDKVRFKLDKATSISLTPKANL
FT                   ELEFSGIYMKSPLYLGDMSYGALSGNPNIAIATAADLTETLAGTGEGGLHPEVAKHKRI
FT                   FVQWASARFGVDIRVLTAGMGVVIKIGQGAKPGIGGHLPGNKVTEPISLTRRIPIGIDA
FT                   ISPAPHHDIYSIEDLGQRIEALKEATGRPVFVKVAATNYIPYIVSGIARMGADGVIIDG
FT                   HGAGTGATPVVIRDNVGIPIELAIASADKILRREGLRDKFTIIAAGRVSSATDAAKLFA
FT                   LGADIVSVGTGALIAMGCVMVHKCHVGSCPTGLTAKIDGTRVVDTEFGVKMLVNFINGF
FT                   SLELANILDNLGLNNIRELRGRRDLLYGHGLSKDTLETLGIDGTEDEANPKLGELWNRR
FT                   IIAYMHELMNKGNPVITSMGSTAPPDVEKPARIIDWLRSDGAQVTRPSIDPYREDVDTS
FT                   FYLKGGEIYLSLPIIFDITEAPLEYKEAFSWSALALSSAVFDYETIDKYAEVFISSDGR
FT                   GIARWSRNEIYENSYLLIPADENVIDEVIGMGVQGFIIDEDSGNSDLELVVSALDTKLK
FT                   EVGVRNHYDILAKSSRLRHSADAFKLILLGADSVIMPYFILEKAIGEGNKGNLKEKAFS
FT                   LITGMKKEIALLAGAAGVYSVQSTLTGNRELLRSINLNHSIRKALRIKPAGSL"
FT   gene            complement(590217..590292)
FT                   /locus_tag="SSOt28"
FT   tRNA            complement(590217..590292)
FT                   /locus_tag="SSOt28"
FT                   /product="tRNA-Gly"
FT   gene            complement(590460..591716)
FT                   /locus_tag="SSO0686"
FT   CDS_pept        complement(590460..591716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0686"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to TM0351, MJ1507, AF1470, AF1017, MJ0797,
FT                   MTH695"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40986"
FT                   /db_xref="GOA:Q7LXM6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM6"
FT                   /protein_id="AAK40986.1"
FT                   /translation="MNSLDILWLAYKGLVSRKAIAILAIISVMIGVASVTVLVAFTQGV
FT                   SQSVLSVVESLGPSTILVLPRGGASLTQATVATIASLPGIKAVYPVVSGFGEMNVEGQP
FT                   IGVSIIGIDNLSALLGQVLLESGSVYPPVTSPETVIGSEVANPAPGIFFSPGDIITVQV
FT                   SRGNSVALEVVGVLSPSGANPLSNSETSIFLPLNEAMAILNRTSYSELIINAQSVNDVN
FT                   NVVNLIEEIYGNQLSVISVQQLINTVSTITSGFSFLLISVASISLFVGAVGIMAIMLSR
FT                   VYQRIREIGIMKTVGLTTRDILLVFLAESGIIGLIGGIVGILVGLVGTSFIDLLSAITS
FT                   QSASGTSTTVSSSGFRGGGGFGRFGTAASSSAFTFKPVISIEAILIALVVAVAVSLIAG
FT                   IYPAWKAARLTAIDAIRRD"
FT   gene            complement(591723..594278)
FT                   /locus_tag="SSO0687"
FT   CDS_pept        complement(591723..594278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0687"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40987"
FT                   /db_xref="GOA:Q7LXM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM5"
FT                   /protein_id="AAK40987.1"
FT                   /translation="MSKIFSIITISLFLVSLLFIPLTSSATQSSFSASSQWLSSTPYVT
FT                   PGERLVQLQVNLVYHGNGNITNVEISPIESGPFIVYPSTQTYILPSMFPNQQYSLVFIG
FT                   NITPNIPLGVYNFYLQATYLENGAEQSQIITVQIPILGYVQLSAIAQTSGTVFPGEQYV
FT                   PINLVIYNTGTVTANNVALFLNSTYPLQFITKEINIPIISAGSSLNVQAIANIYNNATI
FT                   GTYKIPLTAFVYGTYHSLNVTITINSNQTVGGKLITPYVILPAGSYQLGVPITLQLIYT
FT                   GPISVSSYSIQLILPNGFTNITGGNSVYINGGPLQPYEEFTVSFTINIRNVSLGAYTIP
FT                   LKIIWSTIEGNGVVVNTLQYMSFTMFLMGQPNIEVYPETSLLYPGEVNNITLVILNLGS
FT                   GSIYNLSLSVSSQQVSILNNLPKIQSLSPTQSVKIPLEVYVPSTYQGAPVQFTISISYL
FT                   NSVYQQSQYQQQIGLYVSPLISPNTPIIASLNPGIISPNSFTTTYLVLTNSLNTTLYNL
FT                   SITLSSPVYVNATAFNLPSLKPTSKYELPITVYAQGSGSYSISISIVYYQGNIERQEQI
FT                   TVPVYVIQINSPTIPILIQFNSSTLLTGQVEDATIIIQNTVNQPLYNVTISLASQGTLY
FT                   INTTTITLPSLQPLQRLDIPVKVYTQSAGIISISASISYYQAGQLKQAQEVINSLAAGS
FT                   VNIIITGVSSVPTVAVRGGIVSVTATIYNFGTGPANGLTVTVFPPRGVVVIGQNTYYVG
FT                   NLGSDTSSTFTFAFRILNSTKPGSYVIPIEYTYTNDIGQVIHSNSSITLQVSNSSSSFF
FT                   ISFSRSSNNSHISLIDILGIIIVIIVVVVLVIVLLRKRR"
FT   gene            complement(594271..595011)
FT                   /locus_tag="SSO0688"
FT   CDS_pept        complement(594271..595011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0688"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="Transport"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40988"
FT                   /db_xref="GOA:Q7LXM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM4"
FT                   /protein_id="AAK40988.1"
FT                   /translation="MPKDFLEGANRVDYMTDILIDAMDLKKVYKTKNIEYVALRGVTLK
FT                   VNKGEFLVIAGPSGSGKTTLLDLLGLLDSPSAGKIIIDGIDVTNFDEDERAIFRRRYIG
FT                   FVFQSYNLITYLTVLENVELALAAIGIPVWKRREKAEEILSMIPGMLELKNKKPNELSG
FT                   GQQQRVAIARALANDPKILLADEPTANLDSKTGEAIVELMKKLNEEKKVTIIMATHDPD
FT                   MMRYADRIVYIRDGLVEKEVIQNE"
FT   gene            complement(595385..595458)
FT                   /locus_tag="SSOt29"
FT   tRNA            complement(595385..595458)
FT                   /locus_tag="SSOt29"
FT                   /product="tRNA-Phe"
FT   gene            595591..596142
FT                   /locus_tag="SSO0689"
FT   CDS_pept        595591..596142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0689"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40989"
FT                   /db_xref="GOA:Q9UX78"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX78"
FT                   /protein_id="AAK40989.1"
FT                   /translation="MTEMKILIVTLTYIEKSIIDEIVNNLSSYGLEVDILLDSRKYLPI
FT                   SAFNWERLQYDAEKVLSFLKSIHDFNYDSIIFLADSDGYIDGYNFVFGLTIDNFAIIFL
FT                   HRLREEFYNRKPDLDLFMKRVVKEVTHEVGHTLGLSHCNTTGCVMNFSNSVEDVDKKQA
FT                   KFCKNCAHKIEKLSKYLQQK"
FT   gene            complement(596120..596539)
FT                   /locus_tag="SSO0690"
FT   CDS_pept        complement(596120..596539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0690"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40990"
FT                   /db_xref="GOA:Q9UX79"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX79"
FT                   /protein_id="AAK40990.1"
FT                   /translation="MRQFEFFEHTADVGIKSYGRSLEEAFSNAALGVFEVITDTSKVRP
FT                   VEYREIYLNGYDLENLLYKWIEELLYYYDSELMIFSKFDLMIDQDSITLEGKAWGERFN
FT                   DKIHERRTVVKAMTYHQLSIEKTESGYVITFVVDI"
FT   gene            complement(596824..597690)
FT                   /locus_tag="SSO0691"
FT   CDS_pept        complement(596824..597690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40991"
FT                   /db_xref="GOA:Q7LXM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM2"
FT                   /protein_id="AAK40991.1"
FT                   /translation="MDCIRNNSVLINNLSSFTSGIMSSGYSPFYILYIAMNIATLTYAV
FT                   GTLFYGLPIPIYGLKKWGPRMMSDAIYAAVWVNIYGIIIFAIGQIQSLLGVDWSSFFSS
FT                   ILQLQANMFSALIQVKSLYYIITTEKISMALALLADPVLQFSSFITDIIFLLQFFIDLG
FT                   EFIQQSYMILIAIGILLLSLPFRMGKGVGGTLISSAIIFYIGLPYLPIFMQEMSSITLS
FT                   QIGSQLSTITDVNTLVETIAGVVPELVIVFIIIPMLYLSILAGISLGLGNAIGGSSGRV
FT                   PFPLDLF"
FT   gene            complement(597866..598435)
FT                   /gene="cmK"
FT                   /locus_tag="SSO0692"
FT   CDS_pept        complement(597866..598435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmK"
FT                   /locus_tag="SSO0692"
FT                   /product="Cytidylate kinase (cmK)"
FT                   /EC_number="2.7.4.14"
FT                   /note="Pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40992"
FT                   /db_xref="GOA:Q9UX81"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX81"
FT                   /protein_id="AAK40992.1"
FT                   /translation="MIIIISGPPGSGKTSVAIKLANELSYKFISAGKIFRDIAQSMGLD
FT                   IINLNRVAESNFDIDKMVDKKIHEYVLRERNLIVESHIAGWIFREYTDVAIYLWAPLKI
FT                   RANRIAIRDKISYVEAVSQIIRREYMHYKRFNKFYGIDINDLSVFDLVINTSNIDINNI
FT                   VKLILDYLSSVSHNSQPLKEKNINDK"
FT   gene            complement(598477..598743)
FT                   /gene="rpl34E"
FT                   /locus_tag="SSO6374"
FT   CDS_pept        complement(598477..598743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl34E"
FT                   /locus_tag="SSO6374"
FT                   /product="LSU ribosomal protein L34E (rpl34E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40993"
FT                   /db_xref="GOA:Q97ZQ6"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="InterPro:IPR038562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZQ6"
FT                   /protein_id="AAK40993.1"
FT                   /translation="MPRPALRSRSLRRVYVKLPSGKTVIHYERKRNDIAICAICKKPLH
FT                   GVKTNFLHKYSKSEKRPERPFGGYLCSSCLTQLIKATVRQQLQ"
FT   gene            complement(598757..599206)
FT                   /locus_tag="SSO0693"
FT   CDS_pept        complement(598757..599206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSO0693"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40994"
FT                   /db_xref="GOA:Q7LXM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LXM1"
FT                   /protein_id="AAK40994.1"
FT                   /translation="MELNTIYIFLISLFSNFVVYLIYKYYFYGKIINKISLVEKYEERL
FT                   KNIASSKRREKAYKKISKELESYISSVRYYMFLRSMILVGVYIVDLVIILNYLNTNIYL
FT                   PFYIPYLTAKSSSNMYLMLNGSLFEFIASYILFTPLSLRSNLKTR"
FT   gene            complement(599211..599798)
FT                   /gene="adkA"
FT                   /locus_tag="SSO0694"
FT   CDS_pept        complement(599211..599798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adkA"
FT                   /locus_tag="SSO0694"
FT                   /product="Adenylate kinase (adkA)"
FT                   /EC_number="2.7.4.3"
FT                   /note="Purines"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40995"
FT                   /db_xref="GOA:Q9UX83"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX83"
FT                   /protein_id="AAK40995.1"
FT                   /translation="MKIGIVTGIPGVGKTTVLSFADKILTEKGISHKIVNYGDYMLNTA
FT                   LKEGYVKSRDEIRKLQIEKQRELQALAARRIVEDLSLLGDEGIGLIDTHAVIRTPAGYL
FT                   PGLPRHVIEVLSPKVIFLLEADPKIILERQKRDSSRARTDYSDTAVINEVIQFARYSAM
FT                   ASAVLVGASVKVVVNQEGDPSIAASEIINSLM"
FT   gene            complement(599801..601210)
FT                   /gene="secY"
FT                   /locus_tag="SSO0695"
FT   CDS_pept        complement(599801..601210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SSO0695"
FT                   /product="Preprotein translocase secY subunit (secY)"
FT                   /note="Cellular Processes, Secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40996"
FT                   /db_xref="GOA:Q9UX84"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX84"
FT                   /protein_id="AAK40996.1"
FT                   /translation="MSFIDSLATLGQYLPAVTKPKEKPSLGQKLVWSLVAVIIYLIMAS
FT                   TPLYGITSASFFKNLILEQIIFASTTGTLAQLGIGPIITAGLIMQILAGSKLISIDLND
FT                   PDDRVKFTEAQKGLAFIFILVESALFGYVLARTSTTINASILFIAGIVIAQLIVATYLI
FT                   LLLDELIQKGWGLGSGVSLFILAGVMKIMFWDMFGIASVSSQNLPIGFFPALFTALASH
FT                   SDVLNLIVNTSTKNLFQPDLVGLVTTIALIIITIYLTTMTIEIPVTSQKLRGIRRTIPL
FT                   NFLYVSSIPVIFVAVLGSDIQLFASLASYVSPSASNILNTVSGVFFFPPPNSAIPHSIY
FT                   AVVLDPLGALEYAVVFIVLSILFGILWVDVAGLDPATQAQQLVEAGIEIPGVRNNPKII
FT                   EGILARYIYPLAFFSSIIVGLIAVFATLLGAYGTGIGILLAVTIAIQYYSLLAYERSLE
FT                   MYPLLKRLIGE"
FT   gene            complement(601227..601661)
FT                   /gene="rpl15AB"
FT                   /locus_tag="SSO0696"
FT   CDS_pept        complement(601227..601661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl15AB"
FT                   /locus_tag="SSO0696"
FT                   /product="LSU ribosomal protein L15AB (rpl15AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40997"
FT                   /db_xref="GOA:Q9UX85"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX85"
FT                   /protein_id="AAK40997.1"
FT                   /translation="MVVRREKKSRKMRGSRTMGWGIRGQHRDRGSQGGRQIGMHKEKWS
FT                   WLVKYGKGWYGKHGFRNPTTKLTSAISLRKLNELLESGYIKIKEMDGKKIVDLNELGYN
FT                   KLLGGGSISIPVTIKVGKATNKAIQKVKEMGGEVILSPTE"
FT   gene            complement(601664..602140)
FT                   /gene="rpl30AB"
FT                   /locus_tag="SSO0697"
FT   CDS_pept        complement(601664..602140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl30AB"
FT                   /locus_tag="SSO0697"
FT                   /product="LSU ribosomal protein L30AB (rpl30AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40998"
FT                   /db_xref="GOA:Q9UX86"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX86"
FT                   /protein_id="AAK40998.1"
FT                   /translation="MVELLGIIRIRGWAKAPWYINETLNMLRLRYNFNTMVYPKTSQIL
FT                   GMLNKVSPYITWGEIDPDTLKLLIINRLETVKGDKVSDSYVKEVLKIENIDAMVKQLYE
FT                   GKIYLHKLDEYFKLPIRLHPPRGGFKGSVKRPYKNKGEFGYRGDKINELMRRMV"
FT   gene            complement(602147..602800)
FT                   /gene="rps5AB"
FT                   /locus_tag="SSO0698"
FT   CDS_pept        complement(602147..602800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps5AB"
FT                   /locus_tag="SSO0698"
FT                   /product="SSU ribosomal protein S5AB (rps5AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAK40999"
FT                   /db_xref="GOA:Q9UX87"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX87"
FT                   /protein_id="AAK40999.1"
FT                   /translation="MVKMAEEVPSLNIEEWKPRTSIGSLVKEGKISSIKELFDRNLPIT
FT                   EPEIVDVLLPKLKYEVVDIKVVQKQTDAGEISRYKVLVIMGNMDGYVSIGTGKAKQLRV
FT                   AIQKAIRDAKMNIIPVRRGCGSWQCTCGEPHSLPFKVVGKAGSVEVDLLPAPKGTGLVV
FT                   GSVLKTLLTYAGIKDAWSTTKGETRTTENFVRAGYSALYNTYKFVTLQDWVRKR"
FT   gene            complement(602793..603392)
FT                   /gene="rpl18AB"
FT                   /locus_tag="SSO0699"
FT   CDS_pept        complement(602793..603392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl18AB"
FT                   /locus_tag="SSO0699"
FT                   /product="LSU ribosomal protein L18AB (rpl18AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41000"
FT                   /db_xref="GOA:Q9UX88"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX88"
FT                   /protein_id="AAK41000.1"
FT                   /translation="MNKLANGPNYKVKPRRRREGKTNYYKRYVYVISKQTRFIVRITNK
FT                   YVIVQIAKIDPKGDIMIASAHSAELAKKFGWKGDENNTPAAYLTGYLAGLRAIKRGVTE
FT                   CVADIGLHVPSKGNRVFYVIKGAIDAGLKIPIGDISIENDRIKGEHIAKYAEKLKSENS
FT                   DLYSKLFSRYLQRGLNPENLPSHFEEILNKIKSSGG"
FT   gene            complement(603389..603844)
FT                   /gene="rpl19E"
FT                   /locus_tag="SSO0700"
FT   CDS_pept        complement(603389..603844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl19E"
FT                   /locus_tag="SSO0700"
FT                   /product="LSU ribosomal protein L19E (rpl19E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41001"
FT                   /db_xref="GOA:Q9UX89"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR033936"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX89"
FT                   /protein_id="AAK41001.1"
FT                   /translation="MTNLKAQKRLAASIAGVGINRIKVVEDYIEDVQSSLTRDEIRNLI
FT                   KDGKIIVLKKVGISGGRLKERRKKRSLKSEGKKSGSRKGKKGARANSKQMWVKRVRKIR
FT                   AYLKWLRDHKVIDRHTYRELYLKTKGGNYKGVSDVRNVLIQMGKIKG"
FT   gene            complement(603841..604257)
FT                   /gene="rpl32E"
FT                   /locus_tag="SSO0701"
FT   CDS_pept        complement(603841..604257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl32E"
FT                   /locus_tag="SSO0701"
FT                   /product="LSU ribosomal protein L32E (rpl32E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41002"
FT                   /db_xref="GOA:Q9UX90"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="InterPro:IPR023654"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX90"
FT                   /protein_id="AAK41002.1"
FT                   /translation="MTEGRIQSYRKKIYVIRQKLKAKKPKFLRYDSDKFYRLGRQEKWR
FT                   RPYGRDNKTRLKVRGFPAIVSVGYRLPKKVRGFHPSGLRQVIVHNVNELVKVQNQKDNV
FT                   IVTISSSVGFKKRLEILNKARELGLKVSNEGVVT"
FT   gene            complement(604254..604799)
FT                   /gene="rpl6AB"
FT                   /locus_tag="SSO0702"
FT   CDS_pept        complement(604254..604799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl6AB"
FT                   /locus_tag="SSO0702"
FT                   /product="LSU ribosomal protein L6AB (rpl6AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41003"
FT                   /db_xref="GOA:Q9UX91"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX91"
FT                   /protein_id="AAK41003.1"
FT                   /translation="MQIVILREEIEIPKNVVVDLKGSIIKIKGPKGEVVKDFSFAKGIQ
FT                   ISLDGNKIVLETTFANRRKKAVFYSIVSHIKNMITGVTKGYRYYLKIIYTHFPTSVKVV
FT                   GNEVQITNLIGEKNTRRAQILEGVKVTVKGEDIVVEGPNLEAVAQTAANIESASKISGF
FT                   DRRIFSDGIFIYKKEVIE"
FT   gene            complement(604809..605210)
FT                   /gene="rps8AB"
FT                   /locus_tag="SSO0703"
FT   CDS_pept        complement(604809..605210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8AB"
FT                   /locus_tag="SSO0703"
FT                   /product="SSU ribosomal protein S8AB (rps8AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41004"
FT                   /db_xref="GOA:Q9UX92"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX92"
FT                   /protein_id="AAK41004.1"
FT                   /translation="MVFVNPLANALTSIYNNEMRRNKQAIIMPASKLVINVLRVMQKEG
FT                   YVGEFEYIDDGRWGKITVQLLGRVNKCGPITPRYPLSYRQMIALPDYVRRYLPSKEIGI
FT                   IIVSTSKGVMSHKEAARLRIGGVALGYVY"
FT   gene            complement(605217..605390)
FT                   /gene="rps14AB"
FT                   /locus_tag="SSO6391"
FT   CDS_pept        complement(605217..605390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps14AB"
FT                   /locus_tag="SSO6391"
FT                   /product="SSU ribosomal protein S14AB (rps14AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41005"
FT                   /db_xref="GOA:Q97ZQ5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q97ZQ5"
FT                   /protein_id="AAK41005.1"
FT                   /translation="MSEMGKYKPPAERKYGKGVQSCQRCGSKDSVIQKYGIYLCRQCFR
FT                   EVAYELGFRKYW"
FT   gene            complement(605387..605935)
FT                   /gene="rpl5AB"
FT                   /locus_tag="SSO0704"
FT   CDS_pept        complement(605387..605935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl5AB"
FT                   /locus_tag="SSO0704"
FT                   /product="LSU ribosomal protein L5AB (rpl5AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41006"
FT                   /db_xref="GOA:Q9UX93"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX93"
FT                   /protein_id="AAK41006.1"
FT                   /translation="MIKMAESTLPLSQNPMRKVKLSKVTVNIGLGESGDRLQKAYQLLQ
FT                   ELTGAKPVYTISKKTIREFGIRKGQEIGVKVTLRGAQAEEFLRKVLEAIGYRLKKSSFD
FT                   DYGNVSFGIAEHVILPGARYDPEIGIFGMDIAITLERAGYRISRRRRKKAKIPKRHRVT
FT                   KEEAMEFLRNNFNVQLVEG"
FT   gene            complement(605928..606647)
FT                   /gene="rps4E"
FT                   /locus_tag="SSO0705"
FT   CDS_pept        complement(605928..606647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps4E"
FT                   /locus_tag="SSO0705"
FT                   /product="SSU ribosomal protein S4E (rps4E)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41007"
FT                   /db_xref="GOA:Q9UX94"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX94"
FT                   /protein_id="AAK41007.1"
FT                   /translation="MAHITRFEAPWFLMISKKQYKWTVRPNAGPHSIEKSIPLAVVIRD
FT                   YLKLAGTIREAKHIIFDGKVLVDGKVRKDYKYPVGLMDIVSIPSADLYFRVLPDNVRFM
FT                   RFSKISADEARYKYVRIINKTTIKEGRIQLNLEDGRNILVDKETAKNFKTLMTLKIELP
FT                   SQQILDSFTISERSYAIFVGGRNVGIHGIVKNINLSKFKSRKYSVITLESRDGNTYQTN
FT                   IMNVMSIGREKSDLRVD"
FT   gene            complement(606655..607014)
FT                   /gene="rpl24AB"
FT                   /locus_tag="SSO0707"
FT   CDS_pept        complement(606655..607014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl24AB"
FT                   /locus_tag="SSO0707"
FT                   /product="LSU ribosomal protein L24AB (rpl24AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41008"
FT                   /db_xref="GOA:Q9UX95"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX95"
FT                   /protein_id="AAK41008.1"
FT                   /translation="MVSLKPSKQRKLLYTLPLHQRKKLLVAKVSDDIASQYGIKRIRVR
FT                   KGDTVRVMRGGNSGKEGKVVEVNTKTGRLAIEGITRKKVDGTPVYVWIHASKVMITKLD
FT                   LSDPRRREKLEKSKK"
FT   gene            complement(607020..607436)
FT                   /gene="rpl14AB"
FT                   /locus_tag="SSO0708"
FT   CDS_pept        complement(607020..607436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl14AB"
FT                   /locus_tag="SSO0708"
FT                   /product="LSU ribosomal protein L14AB (rpl14AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41009"
FT                   /db_xref="GOA:Q9UX97"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX97"
FT                   /protein_id="AAK41009.1"
FT                   /translation="MSEKIQVLGSRKGLTPALQHYSVVNVADNSGGKEAMIIGVYGYRG
FT                   VLRRVPFANIADMVMVSIKKGTPEVRKQKFRAVIVRQRMPYRRPDGTWISFEDNAVVII
FT                   NPDGTPKGTEVRGPIAREAAERWPKIASLATLVV"
FT   gene            complement(607438..607782)
FT                   /gene="rps17AB"
FT                   /locus_tag="SSO0709"
FT   CDS_pept        complement(607438..607782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17AB"
FT                   /locus_tag="SSO0709"
FT                   /product="SSU ribosomal protein S17AB (rps17AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41010"
FT                   /db_xref="GOA:Q9UX98"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UX98"
FT                   /protein_id="AAK41010.1"
FT                   /translation="MVSKGKTVKDPGIPNITIPEKVCEDEDCPYHGSLRVRGITLEGVI
FT                   VKYRGTKAAVIERQYLYYDSKYKRYERRRSRIHAHVPPCINVREGDKVIIGECRPLSKS
FT                   ISFVVLGKVS"
FT   gene            complement(608048..608269)
FT                   /gene="rpl29AB"
FT                   /locus_tag="SSO6397"
FT   CDS_pept        complement(608048..608269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl29AB"
FT                   /locus_tag="SSO6397"
FT                   /product="LSU ribosomal protein L29AB (rpl29AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO6397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41011"
FT                   /db_xref="GOA:P58084"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58084"
FT                   /protein_id="AAK41011.1"
FT                   /translation="MTVDPEELRKMETGDLLKKLDELKLELIKLRVQSRMGTLKNTASI
FT                   RNTRKDIARILTVLSEKKKVKREKVENK"
FT   gene            complement(608266..608955)
FT                   /gene="rps3AB"
FT                   /locus_tag="SSO0712"
FT   CDS_pept        complement(608266..608955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps3AB"
FT                   /locus_tag="SSO0712"
FT                   /product="SSU ribosomal protein S3AB (rps3AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41012"
FT                   /db_xref="GOA:Q9UXA0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UXA0"
FT                   /protein_id="AAK41012.1"
FT                   /translation="MPNIKRYFLEKSIVKVKIDEYLAKQYYNAEYAGVEVLKTPIGTRV
FT                   IIYAGRPSMIIGRGGRNIKQLAQIFEKVFGLENPQITITNVENPELNARVMAFRLAIAL
FT                   EKGYHFRRAAFISMRRIMNAGALGAEIIISGKLTTERARYEKLKEGIVYKSGQQLEKMI
FT                   DRAIAIAMLKPGIFGVEVVITKPLKIEDKINLKESPSVPQEVSVTNVTFIEESSQKSEE
FT                   KSEGEKE"
FT   gene            complement(608957..609430)
FT                   /gene="rpl22AB"
FT                   /locus_tag="SSO0713"
FT   CDS_pept        complement(608957..609430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl22AB"
FT                   /locus_tag="SSO0713"
FT                   /product="LSU ribosomal protein L22AB (rpl22AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41013"
FT                   /db_xref="GOA:Q9UXA2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UXA2"
FT                   /protein_id="AAK41013.1"
FT                   /translation="MASWKYPQLDVDELKIAKAVIRDVPESIRDLYNVCKAIRGMYLND
FT                   AKDFLNRVLEEKEALPFWRYNKGASHKSNISAKWKIKAGRYPKKAIRQVLKVLENAEAN
FT                   ATNKGLDVDKLIIRHIAAHKGITLQRYMPRAFGRATAKYRRTSNIEVILEEVE"
FT   gene            complement(609437..609859)
FT                   /gene="rps19AB"
FT                   /locus_tag="SSO0715"
FT   CDS_pept        complement(609437..609859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19AB"
FT                   /locus_tag="SSO0715"
FT                   /product="SSU ribosomal protein S19AB (rps19AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41014"
FT                   /db_xref="GOA:Q9UXA3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UXA3"
FT                   /protein_id="AAK41014.1"
FT                   /translation="MSLEIPPEWKNFKYRGKSIDELLNMPMDEFIKLLPSRQRRSLKRG
FT                   FTDAQRHLLEKVRKYRREGKFNKTIKTHVRNLVILPELIGLKMAVYNGKEFVEFTVTPE
FT                   MIGHYLGEYSITTKKVEHGEPGLKATRSSLFLAMKG"
FT   gene            complement(609895..610611)
FT                   /gene="rpl2AB"
FT                   /locus_tag="SSO0716"
FT   CDS_pept        complement(609895..610611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl2AB"
FT                   /locus_tag="SSO0716"
FT                   /product="LSU ribosomal protein L2AB (rpl2AB)"
FT                   /note="Translation, Ribosomal Proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SSO0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAK41015"
FT                   /db_xref="GOA:Q9UXA5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT