(data stored in ACNUC5340 zone)

EMBL: AE006914

ID   AE006914; SV 1; circular; genomic DNA; STD; PRO; 1268755 BP.
XX
AC   AE006914; AE008569-AE008682;
XX
PR   Project:PRJNA42;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Rickettsia conorii str. Malish 7, complete genome.
XX
KW   .
XX
OS   Rickettsia conorii str. Malish 7
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
XX
RN   [1]
RX   DOI; 10.1126/science.290.5490.347.
RX   PUBMED; 11030655.
RA   Ogata H., Audic S., Barbe V., Artiguenave F., Fournier P.E., Raoult D.,
RA   Claverie J.M.;
RT   "Selfish DNA in protein-coding genes of Rickettsia";
RL   Science, e1252229 290(5490):347-350(2000).
XX
RN   [2]
RC   Response to Letter to the Editor
RP   1-1268755
RX   DOI; 10.1126/science.291.5502.252.
RX   PUBMED; 11253208.
RA   Ogata H., Audic S., Claverie J.-M.;
RT   "Selfish DNA and the origin of genes";
RL   Science, e1252229 291(5502):252-253(2001).
XX
RN   [3]
RP   1-1268755
RX   DOI; 10.1126/science.1061471.
RX   PUBMED; 11557893.
RA   Ogata H., Audic S., Renesto-Audiffren P., Fournier P.-E., Barbe V.,
RA   Samson D., Roux V., Cossart P., Weissenbach J., Claverie J.-M., Raoult D.;
RT   "Mechanisms of evolution in Rickettsia conorii and R. prowazekii";
RL   Science, e1252229 293(5537):2093-2098(2001).
XX
RN   [4]
RP   1-1268755
RA   Ogata H., Audic S., Renesto-Audiffren P., Fournier P.-E., Barbe V.,
RA   Samson D., Roux V., Cossart P., Weissenbach J., Claverie J.-M., Raoult D.;
RT   ;
RL   Submitted (26-APR-2001) to the INSDC.
RL   Unite des Rickettsies, Faculte de Medecine, CNRS UMR 6020, Universite de la
RL   Mediterranee, 27 boulevard Jean Moulin, Marseille Cedex 05 13385, France
XX
DR   MD5; e95102c55cdf2fdf49add8cb41d5b946.
DR   BioSample; SAMN02603141.
DR   EnsemblGenomes-Gn; EBG00001084117.
DR   EnsemblGenomes-Gn; EBG00001084118.
DR   EnsemblGenomes-Gn; EBG00001084119.
DR   EnsemblGenomes-Gn; EBG00001084121.
DR   EnsemblGenomes-Gn; EBG00001084122.
DR   EnsemblGenomes-Gn; EBG00001084123.
DR   EnsemblGenomes-Gn; EBG00001084124.
DR   EnsemblGenomes-Gn; EBG00001084125.
DR   EnsemblGenomes-Gn; EBG00001084126.
DR   EnsemblGenomes-Gn; EBG00001084127.
DR   EnsemblGenomes-Gn; EBG00001084128.
DR   EnsemblGenomes-Gn; EBG00001084129.
DR   EnsemblGenomes-Gn; EBG00001084130.
DR   EnsemblGenomes-Gn; EBG00001084131.
DR   EnsemblGenomes-Gn; EBG00001084132.
DR   EnsemblGenomes-Gn; EBG00001084133.
DR   EnsemblGenomes-Gn; EBG00001084134.
DR   EnsemblGenomes-Gn; EBG00001084135.
DR   EnsemblGenomes-Gn; EBG00001084136.
DR   EnsemblGenomes-Gn; EBG00001084137.
DR   EnsemblGenomes-Gn; EBG00001084138.
DR   EnsemblGenomes-Gn; EBG00001084139.
DR   EnsemblGenomes-Gn; EBG00001084140.
DR   EnsemblGenomes-Gn; EBG00001084141.
DR   EnsemblGenomes-Gn; EBG00001084142.
DR   EnsemblGenomes-Gn; EBG00001084143.
DR   EnsemblGenomes-Gn; EBG00001084144.
DR   EnsemblGenomes-Gn; EBG00001084145.
DR   EnsemblGenomes-Gn; EBG00001084146.
DR   EnsemblGenomes-Gn; EBG00001084147.
DR   EnsemblGenomes-Gn; EBG00001084148.
DR   EnsemblGenomes-Gn; EBG00001084149.
DR   EnsemblGenomes-Gn; EBG00001084150.
DR   EnsemblGenomes-Gn; EBG00001084151.
DR   EnsemblGenomes-Gn; EBG00001084152.
DR   EnsemblGenomes-Gn; EBG00001084153.
DR   EnsemblGenomes-Gn; EBG00001084154.
DR   EnsemblGenomes-Gn; EBG00001084155.
DR   EnsemblGenomes-Gn; EBG00001084156.
DR   EnsemblGenomes-Gn; EBG00001084157.
DR   EnsemblGenomes-Gn; EBG00001084158.
DR   EnsemblGenomes-Gn; EBG00001084159.
DR   EnsemblGenomes-Gn; EBG00001084160.
DR   EnsemblGenomes-Gn; RCRNA01.
DR   EnsemblGenomes-Gn; RCRNA02.
DR   EnsemblGenomes-Gn; RCRNA03.
DR   EnsemblGenomes-Gn; RCRNA04.
DR   EnsemblGenomes-Gn; RCRNA05.
DR   EnsemblGenomes-Gn; RCRNA06.
DR   EnsemblGenomes-Gn; RCRNA07.
DR   EnsemblGenomes-Gn; RCRNA08.
DR   EnsemblGenomes-Gn; RCRNA09.
DR   EnsemblGenomes-Gn; RCRNA10.
DR   EnsemblGenomes-Gn; RCRNA11.
DR   EnsemblGenomes-Gn; RCRNA12.
DR   EnsemblGenomes-Gn; RCRNA13.
DR   EnsemblGenomes-Gn; RCRNA14.
DR   EnsemblGenomes-Gn; RCRNA15.
DR   EnsemblGenomes-Gn; RCRNA16.
DR   EnsemblGenomes-Gn; RCRNA17.
DR   EnsemblGenomes-Gn; RCRNA18.
DR   EnsemblGenomes-Gn; RCRNA19.
DR   EnsemblGenomes-Gn; RCRNA20.
DR   EnsemblGenomes-Gn; RCRNA21.
DR   EnsemblGenomes-Gn; RCRNA22.
DR   EnsemblGenomes-Gn; RCRNA23.
DR   EnsemblGenomes-Gn; RCRNA24.
DR   EnsemblGenomes-Gn; RCRNA25.
DR   EnsemblGenomes-Gn; RCRNA26.
DR   EnsemblGenomes-Gn; RCRNA27.
DR   EnsemblGenomes-Gn; RCRNA28.
DR   EnsemblGenomes-Gn; RCRNA29.
DR   EnsemblGenomes-Gn; RCRNA30.
DR   EnsemblGenomes-Gn; RCRNA31.
DR   EnsemblGenomes-Gn; RCRNA32.
DR   EnsemblGenomes-Gn; RCRNA33.
DR   EnsemblGenomes-Gn; RCRNA34.
DR   EnsemblGenomes-Gn; RCRNA35.
DR   EnsemblGenomes-Gn; RCRNA36.
DR   EnsemblGenomes-Gn; RCRNA37.
DR   EnsemblGenomes-Gn; RCRNA38.
DR   EnsemblGenomes-Tr; EBT00001686763.
DR   EnsemblGenomes-Tr; EBT00001686765.
DR   EnsemblGenomes-Tr; EBT00001686766.
DR   EnsemblGenomes-Tr; EBT00001686768.
DR   EnsemblGenomes-Tr; EBT00001686771.
DR   EnsemblGenomes-Tr; EBT00001686772.
DR   EnsemblGenomes-Tr; EBT00001686775.
DR   EnsemblGenomes-Tr; EBT00001686777.
DR   EnsemblGenomes-Tr; EBT00001686779.
DR   EnsemblGenomes-Tr; EBT00001686782.
DR   EnsemblGenomes-Tr; EBT00001686784.
DR   EnsemblGenomes-Tr; EBT00001686786.
DR   EnsemblGenomes-Tr; EBT00001686789.
DR   EnsemblGenomes-Tr; EBT00001686791.
DR   EnsemblGenomes-Tr; EBT00001686793.
DR   EnsemblGenomes-Tr; EBT00001686795.
DR   EnsemblGenomes-Tr; EBT00001686797.
DR   EnsemblGenomes-Tr; EBT00001686800.
DR   EnsemblGenomes-Tr; EBT00001686802.
DR   EnsemblGenomes-Tr; EBT00001686805.
DR   EnsemblGenomes-Tr; EBT00001686807.
DR   EnsemblGenomes-Tr; EBT00001686808.
DR   EnsemblGenomes-Tr; EBT00001686809.
DR   EnsemblGenomes-Tr; EBT00001686810.
DR   EnsemblGenomes-Tr; EBT00001686811.
DR   EnsemblGenomes-Tr; EBT00001686812.
DR   EnsemblGenomes-Tr; EBT00001686813.
DR   EnsemblGenomes-Tr; EBT00001686814.
DR   EnsemblGenomes-Tr; EBT00001686815.
DR   EnsemblGenomes-Tr; EBT00001686816.
DR   EnsemblGenomes-Tr; EBT00001686817.
DR   EnsemblGenomes-Tr; EBT00001686818.
DR   EnsemblGenomes-Tr; EBT00001686819.
DR   EnsemblGenomes-Tr; EBT00001686820.
DR   EnsemblGenomes-Tr; EBT00001686821.
DR   EnsemblGenomes-Tr; EBT00001686822.
DR   EnsemblGenomes-Tr; EBT00001686823.
DR   EnsemblGenomes-Tr; EBT00001686824.
DR   EnsemblGenomes-Tr; EBT00001686825.
DR   EnsemblGenomes-Tr; EBT00001686826.
DR   EnsemblGenomes-Tr; EBT00001686827.
DR   EnsemblGenomes-Tr; EBT00001686828.
DR   EnsemblGenomes-Tr; EBT00001686829.
DR   EnsemblGenomes-Tr; RCRNA01-1.
DR   EnsemblGenomes-Tr; RCRNA02-1.
DR   EnsemblGenomes-Tr; RCRNA03-1.
DR   EnsemblGenomes-Tr; RCRNA04-1.
DR   EnsemblGenomes-Tr; RCRNA05-1.
DR   EnsemblGenomes-Tr; RCRNA06-1.
DR   EnsemblGenomes-Tr; RCRNA07-1.
DR   EnsemblGenomes-Tr; RCRNA08-1.
DR   EnsemblGenomes-Tr; RCRNA09-1.
DR   EnsemblGenomes-Tr; RCRNA10-1.
DR   EnsemblGenomes-Tr; RCRNA11-1.
DR   EnsemblGenomes-Tr; RCRNA12-1.
DR   EnsemblGenomes-Tr; RCRNA13-1.
DR   EnsemblGenomes-Tr; RCRNA14-1.
DR   EnsemblGenomes-Tr; RCRNA15-1.
DR   EnsemblGenomes-Tr; RCRNA16-1.
DR   EnsemblGenomes-Tr; RCRNA17-1.
DR   EnsemblGenomes-Tr; RCRNA18-1.
DR   EnsemblGenomes-Tr; RCRNA19-1.
DR   EnsemblGenomes-Tr; RCRNA20-1.
DR   EnsemblGenomes-Tr; RCRNA21-1.
DR   EnsemblGenomes-Tr; RCRNA22-1.
DR   EnsemblGenomes-Tr; RCRNA23-1.
DR   EnsemblGenomes-Tr; RCRNA24-1.
DR   EnsemblGenomes-Tr; RCRNA25-1.
DR   EnsemblGenomes-Tr; RCRNA26-1.
DR   EnsemblGenomes-Tr; RCRNA27-1.
DR   EnsemblGenomes-Tr; RCRNA28-1.
DR   EnsemblGenomes-Tr; RCRNA29-1.
DR   EnsemblGenomes-Tr; RCRNA30-1.
DR   EnsemblGenomes-Tr; RCRNA31-1.
DR   EnsemblGenomes-Tr; RCRNA32-1.
DR   EnsemblGenomes-Tr; RCRNA33-1.
DR   EnsemblGenomes-Tr; RCRNA34-1.
DR   EnsemblGenomes-Tr; RCRNA35-1.
DR   EnsemblGenomes-Tr; RCRNA36-1.
DR   EnsemblGenomes-Tr; RCRNA37-1.
DR   EnsemblGenomes-Tr; RCRNA38-1.
DR   EuropePMC; PMC1082560; 15812043.
DR   EuropePMC; PMC1428390; 16547041.
DR   EuropePMC; PMC1482720; 16677374.
DR   EuropePMC; PMC186582; 11997347.
DR   EuropePMC; PMC187327; 12933880.
DR   EuropePMC; PMC1951237; 17553977.
DR   EuropePMC; PMC2223442; 18025092.
DR   EuropePMC; PMC2813287; 20126457.
DR   EuropePMC; PMC2866381; 19861070.
DR   EuropePMC; PMC3358144; 22608066.
DR   EuropePMC; PMC3557878; 23171714.
DR   EuropePMC; PMC3767692; 24039725.
DR   EuropePMC; PMC3883474; 24380581.
DR   EuropePMC; PMC3911462; 24226919.
DR   EuropePMC; PMC3957756; 24371248.
DR   EuropePMC; PMC4540899; 26135877.
DR   EuropePMC; PMC525201; 15528527.
DR   EuropePMC; PMC6138182; 28582983.
DR   EuropePMC; PMC6306169; 30586406.
DR   EuropePMC; PMC6341051; 30649634.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE006914.
DR   SILVA-SSU; AE006914.
DR   StrainInfo; 621673; 1.
XX
CC   On or before Feb 20, 2009 this sequence version replaced
CC   gi:15619032, gi:15619045, gi:15619053, gi:15619068, gi:15619087,
CC   gi:15619100, gi:15619111, gi:15619126, gi:15619137, gi:15619148,
CC   gi:15619154, gi:15619175, gi:15619185, gi:15619191, gi:15619207,
CC   gi:15619218, gi:15619228, gi:15619232, gi:15619242, gi:15619253,
CC   gi:15619263, gi:15619279, gi:15619288, gi:15619304, gi:15619322,
CC   gi:15619336, gi:15619344, gi:15619355, gi:15619370, gi:15619383,
CC   gi:15619396, gi:15619405, gi:15619420, gi:15619434, gi:15619446,
CC   gi:15619459, gi:15619472, gi:15619482, gi:15619498, gi:15619512,
CC   gi:15619522, gi:15619535, gi:15619546, gi:15619562, gi:15619576,
CC   gi:15619590, gi:15619606, gi:15619620, gi:15619630, gi:15619643,
CC   gi:15619662, gi:15619669, gi:15619685, gi:15619700, gi:15619712,
CC   gi:15619724, gi:15619740, gi:15619754, gi:15619767, gi:15619781,
CC   gi:15619794, gi:15619810, gi:15619820, gi:15619838, gi:15619854,
CC   gi:15619870, gi:15619882, gi:15619898, gi:15619912, gi:15619923,
CC   gi:15619936, gi:15619951, gi:15619962, gi:15619977, gi:15619990,
CC   gi:15620004, gi:15620017, gi:15620025, gi:15620042, gi:15620057,
CC   gi:15620068, gi:15620080, gi:15620093, gi:15620111, gi:15620130,
CC   gi:15620138, gi:15620149, gi:15620163, gi:15620174, gi:15620190,
CC   gi:15620200, gi:15620208, gi:15620220, gi:15620239, gi:15620258,
CC   gi:15620277, gi:15620297, gi:15620305, gi:15620328, gi:15620339,
CC   gi:15620349, gi:15620360, gi:15620367, gi:15620381, gi:15620399,
CC   gi:15620409, gi:15620413, gi:15620428, gi:15620443, gi:15620451,
CC   gi:15620468, gi:15620477, gi:15620490, gi:15620507.
CC   A public version of R. conorii genome database is accessible at
CC   http://igs-server.cnrs-mrs.fr/. The database intends to provide
CC   updated data. Annotation of the genome is an ongoing task whose
CC   goal is to make the genome sequence more useful. Comments to the
CC   authors are appreciated.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1268755
FT                   /organism="Rickettsia conorii str. Malish 7"
FT                   /strain="Malish 7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272944"
FT   gene            1..822
FT                   /locus_tag="RC0001"
FT   CDS_pept        1..822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0001"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02539"
FT                   /db_xref="GOA:Q92JR6"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JR6"
FT                   /protein_id="AAL02539.1"
FT                   /translation="MTKLIIHLVSDSSVQTAKYTANSALAQFTSVKPKLYHWPMIRNLE
FT                   LLNEVLSKIEYKHGIVLYTIADQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEI
FT                   EKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQMLNELSEADIILIGPSRTSKTPTSVFLA
FT                   YNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIREARLNLLQINENKSYT
FT                   DFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNKYNK"
FT   gene            1039..1356
FT                   /gene="trxA"
FT                   /locus_tag="RC0002"
FT   CDS_pept        1039..1356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="RC0002"
FT                   /product="thioredoxin"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02540"
FT                   /db_xref="GOA:Q92JR5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JR5"
FT                   /protein_id="AAL02540.1"
FT                   /translation="MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISK
FT                   ELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKS
FT                   I"
FT   gene            1367..2116
FT                   /gene="rfbE"
FT                   /locus_tag="RC0003"
FT   CDS_pept        1367..2116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbE"
FT                   /locus_tag="RC0003"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02541"
FT                   /db_xref="GOA:Q92JR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JR4"
FT                   /protein_id="AAL02541.1"
FT                   /translation="MSLSYPKVFIEITNGYVEGIDTHKRAQGLKHFFLKKGVSLSPNIP
FT                   ILNNINFSCYEGEKIAFIGSNGSGKSSFLKLIAGIYPLKSGTVKVHGDIAAIIDMGVGF
FT                   ESEQTGRENIKMLMLYNNMLDKYSKKIEKEIIDFSELGSKIDLPIKIYSSGMLSRLAFS
FT                   VSIFQNPQILLLDEVFAAGDSYFIEKSLSLMKNKFKNTPISIIVSHQEEIIKDNCDRCI
FT                   LLKDGNIIGDGTPSEMFKIYNQQQGNS"
FT   gene            2117..2893
FT                   /gene="rfbA"
FT                   /locus_tag="RC0004"
FT   CDS_pept        2117..2893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="RC0004"
FT                   /product="O-antigen export system permease protein RfbA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02542"
FT                   /db_xref="GOA:Q92JR3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JR3"
FT                   /protein_id="AAL02542.1"
FT                   /translation="MIKYFFSKKYWRAIALLVKASIIRQNKDSFLGSLWSLIQPFIHIM
FT                   VISYFFGFLLRQPREFMVMNLVGGIPLWSFIVSSLTMCSSSLVTRDQIIKKVRISKTFF
FT                   PVADSLGQLYTLICSFSAMYFAFILLFPEKFSWQIIFMPILILPLIICVISGSIAVAFL
FT                   TPYIRDIPQMLSVILGVIYWSIPIVYPYSLIPESKKIYFEFNPFFLVIRPVQALVIDGT
FT                   LPDMMLIVKSIIVAFITVCISYLIYRQFSKRVIYYL"
FT   gene            2890..5991
FT                   /locus_tag="RC0005"
FT   CDS_pept        2890..5991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0005"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02543"
FT                   /db_xref="GOA:Q92JR2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JR2"
FT                   /protein_id="AAL02543.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADRSLHKDLMLFRST
FT                   PLSIIPKDYSEFLLKISPHLDDFLAELFCISKEITISRLKHKDFDIIYECKRKFVQRVA
FT                   VKKYPPEKIKDIDFEDVYLKLTDLIGANFTSREFAKQIIIWQQAEESFAEELDIAARYA
FT                   AYRVYLCEGIKPQDNILFNLPQKLDKENLIDDEKILKYQKNERVDFDYTDSFLNLDEAL
FT                   NHSHYCIYCHKQDKDSCSKGLLQPQNRHCEERSDVAISGDLTRLPRSLQSLAMTDLKQG
FT                   CPLKQKISEMNYVKAQGFNLSALAIIVIDNPMVAATGHRICNDCSKACIYQKQDPVNIP
FT                   LIESNILEETLKLPYGLEIYLLLTRWNPLNIYAPLPKEPTNYNILVTGLGPAGFSLSYY
FT                   LLRSGHNVVAIDGLRITLLPFDVHKPIKFWHEYKNLLSERMPRGFGGVAEYGITVRWDK
FT                   NNLDILRLILERNNNFKYYDGVALDFNITKEQAFDLGFDYIAFCIGAGQPKVLDIENFE
FT                   AKGVKTASDFLMTLQNGGAFLKNSSTNMVIRMPIAVIGGGLTSLDAATESLYYYKKQVE
FT                   EFAEDYIEKDLTEEDKEIAEEFIAHAKLFKEAKNNEELRKVFNKLGGATVYYRGRLQDS
FT                   PVYKLNHEELIYALALGVDFKENMQPLRINVDKYGHVESVEFENRNRRCEQSKTVWQSQ
FT                   EFGLTRLPRQCYAFPRNDIKTKTVIMAIGIENNTQFNEDKYSYFGDCNPKYSGSVVKAL
FT                   ASTKEGYDAINKKLINNNPRFKGSYKDFCTQLDYLLTSRVNKINILDDKTFELIIHSPL
FT                   AAKNFKFGQFFRLQNYSEDAAKLIEPVALSPIDIDVEKGLINFIVFEVGKSTSLCKILS
FT                   ENEKVVLMGPTGSPLEIPQNKKIVIVNFEVGNIGLLKVLKENNNEVIFVTYPDIKVRKL
FT                   VSVDIVIINASPEIIEELQSLKNEIFSENTKIIVSVNSPMQCMMKGICGQCIQKVKGEQ
FT                   KYIFACSQQNQNAEIVDFKSLKTRLRQNSLQEKMRKLVANLSII"
FT   repeat_region   3634..3667
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(3681..3715)
FT                   /note="REP01, repeated element"
FT   repeat_region   4938..4970
FT                   /note="REP01, repeated element"
FT   gene            complement(6035..6277)
FT                   /locus_tag="RC0006"
FT   CDS_pept        complement(6035..6277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0006"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02544"
FT                   /db_xref="GOA:Q92JR1"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JR1"
FT                   /protein_id="AAL02544.1"
FT                   /translation="MLLGVISGDYGKPRPAVVVQSNLYKNHPSITVCLHNGFNRCPTTF
FT                   HLLLTPTELNGFNLESHIMVDEISAIRSDKIQKNW"
FT   gene            complement(6299..6580)
FT                   /locus_tag="RC0007"
FT   CDS_pept        complement(6299..6580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0007"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02545"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JR0"
FT                   /protein_id="AAL02545.1"
FT                   /translation="MLQLNIIRRIKMTKSITTSIRLEINLSKKLEKATYDLHREKSWII
FT                   SEAYLKQLENSDLAKEAKRQSLLASKENNPDANLWLKHNEESWLDEWK"
FT   gene            complement(6611..7405)
FT                   /gene="lpxA"
FT                   /locus_tag="RC0008"
FT   CDS_pept        complement(6611..7405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="RC0008"
FT                   /product="acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02546"
FT                   /db_xref="GOA:Q92JQ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ9"
FT                   /protein_id="AAL02546.1"
FT                   /translation="MSNSNIHTTAVIAEGAKLGKNVKIGPYCIIGPEVVLHDNVELKSH
FT                   VVIEGITEIGENTVIYPFASIGQPPQILKYANERSSTIIGSNNTIREYVTVQAGSQRGG
FT                   MMTRVGNNNLFMVGVHIGHDCKIGNNVVFANYVSLAGHIGVGDYTIIGGLSAVHQYARI
FT                   GEYSMIGGLSPVGADVIPFGLVSSKRAVLEGLNLIGMNRKGFDKVKSLSALKAIEEIFS
FT                   GEGNFAERIKQVAEKYNNNSIVIQIIDFLNQDSNRAFCRFEK"
FT   gene            complement(7413..7850)
FT                   /gene="fabZ"
FT                   /locus_tag="RC0009"
FT   CDS_pept        complement(7413..7850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="RC0009"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02547"
FT                   /db_xref="GOA:Q92JQ8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ8"
FT                   /protein_id="AAL02547.1"
FT                   /translation="MIIDITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQ
FT                   FTGHFPARPVMPGVLMVEAMAQLAAILVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDT
FT                   MHIHAVIDQQRANVWKFSSTVTVEGEIATESKFTAMIKDKT"
FT   repeat_region   complement(7884..7925)
FT                   /note="REP01, repeated element"
FT   gene            complement(8046..9086)
FT                   /gene="lpxD"
FT                   /locus_tag="RC0010"
FT   CDS_pept        complement(8046..9086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="RC0010"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02548"
FT                   /db_xref="GOA:Q92JQ7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ7"
FT                   /protein_id="AAL02548.1"
FT                   /translation="MVSSNFYKNLGPRKLTAIIDFLHDIIAPPKIHEDIAIHDIKILQE
FT                   ASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNPYFAYGKLIDFF
FT                   YAPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVNI
FT                   GRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKISHIGIVKIGNNVE
FT                   IGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAGSSTIGKYCTL
FT                   GGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSIIMKQLLKTS
FT                   NSKLKK"
FT   repeat_region   9195..9294
FT                   /note="REP01, repeated element"
FT   gene            complement(9599..9671)
FT                   /locus_tag="RCRNA01"
FT   tRNA            complement(9599..9671)
FT                   /locus_tag="RCRNA01"
FT                   /product="tRNA-Phe"
FT   repeat_region   complement(9675..9800)
FT                   /note="REP04, repeated element"
FT   gene            9922..10941
FT                   /gene="nifR3"
FT                   /locus_tag="RC0011"
FT   CDS_pept        9922..10941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifR3"
FT                   /locus_tag="RC0011"
FT                   /product="nifR3-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02549"
FT                   /db_xref="GOA:Q92JQ6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ6"
FT                   /protein_id="AAL02549.1"
FT                   /translation="MFIFITVFMIKIGNIELSSNIILAPMSGVTDLEFRRLVKRFGAGL
FT                   VVSEMVASRAMIVESRQSLKKSAIMRDDATSACVQLAGCEPNVIAEAAKMNEGMGAKII
FT                   DLNFGCPAKKVVGGYSGSALMKDEQLAAKIFEATVEAVKLPVTVKMRMGWDDNTKNAPT
FT                   LAKIAESSGVQMITVHGRTRCQFYSGNADWDFIRSVKESVKIPVIANGDITNFAKAKEA
FT                   LQKSGADGIMVGRGAYGKPWLISQIDHYLKTGEEKSAPSIAEQLDIVTEHYEAILDYYG
FT                   ESVGVPIARKHIGWYSSGLPNSAEFRGAVNLMNDPLAVKEKIAEFYTSVMETNKLKEF"
FT   gene            10959..11882
FT                   /locus_tag="RC0012"
FT   CDS_pept        10959..11882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0012"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02550"
FT                   /db_xref="GOA:Q92JQ5"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ5"
FT                   /protein_id="AAL02550.1"
FT                   /translation="MFFSLSYASEKAVIITDYKPVFLPVIAENKKIRIAIRSYLNNEKS
FT                   YFVLVDPNSFKTEIALQELVILPTNKIEKENLLKKLSKTPYIKVLNKYSSTPYIQQNYG
FT                   ATSSMYKVKGQFLTIDMCPSSKSFEKDFFKKLVELSIKLNKPIPIAICVSGLWINKHTE
FT                   EFLWLLKQQENGYLQITWVNHSFSHPYFKDKPLEDNFLLSNKDDFENEVLEAGKILVSY
FT                   NIAPSPFFRFPGLVSDQTLIEKLKDLGFIPLGSNAWLAKGEKVQNGSFILVHGNSNEKA
FT                   GIDLIMPMLPELKLLPIEKAFLLHDN"
FT   gene            complement(12114..12641)
FT                   /locus_tag="RC0013"
FT   CDS_pept        complement(12114..12641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0013"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02551"
FT                   /db_xref="GOA:Q92JQ4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ4"
FT                   /protein_id="AAL02551.1"
FT                   /translation="MHTLNSEEETKKLAKLLAQSLKPNDIVLLNGDLGAGKTFFCREII
FT                   KYFCGENTSIISPTFNLLQTYKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILIE
FT                   WSEIIKHLLTPPLIEVNLEALDNNKRLCSIITNHKENSQESSLIDFLQDSPLFDTKLDI
FT                   QRDKSPTRKVKL"
FT   gene            complement(12629..13582)
FT                   /gene="znuA"
FT                   /locus_tag="RC0014"
FT   CDS_pept        complement(12629..13582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="RC0014"
FT                   /product="zinc/manganese ABC transporter substrate binding
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02552"
FT                   /db_xref="GOA:Q92JQ3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JQ3"
FT                   /protein_id="AAL02552.1"
FT                   /translation="MRASTSNRHCEEKLKILTKQSRAKILRFPRSFQSLAMTIWYQRKQ
FT                   AFTEMTYLALLFLTFLSLTSYATPKIVVSITPIGSIVSMLVKDKADIESLAISSDCPHH
FT                   YNLKPSDLVKVKNSDIAIYINEQFDGFAEKLIDNHSKNIIKISDIKSLTTIKDNWHIWL
FT                   DLNNAVILLQEFAQIFSEKFPELQEDINNNLSTALKELNKLQEIKNNELATIKDVILLS
FT                   DSSEYFFLNTNIKTAKLYSESQKSLRYISKLEDLIKESNNKCLVLSNEQNSRLYDKLNA
FT                   KIIILNSENWNVQNIGSNTFQNQYLQMIYQVKKCIH"
FT   repeat_region   13471..13528
FT                   /note="REP01, repeated element"
FT   repeat_region   13529..13561
FT                   /note="REP01, repeated element"
FT   gene            complement(13579..14889)
FT                   /gene="pcnB"
FT                   /locus_tag="RC0015"
FT   CDS_pept        complement(13579..14889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="RC0015"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02553"
FT                   /db_xref="GOA:Q92JQ2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JQ2"
FT                   /protein_id="AAL02553.1"
FT                   /translation="MQVTHKILKIPSKGYRKILSLLNEKGQARLIGGCVRDALLDLLHN
FT                   KTNKEEFEGDTERRIAMYINVREDSSTGSTYKLPLEASYPRDRLEKGSCDIDIATNLTP
FT                   SEVTNILSGAKIKTIPTGLKFGTITATLNNEKFEITTLRKDIECNGRHAKVIFTNDFAE
FT                   DAARRDFTINALSYCPFKNEIYDYFEGFKDLQQEKVVFIGEALDRIKEDYLRILRFFRF
FT                   SSYYANQLDDGNFKACKALKDGLKTLSRERIKSEMDKIIVSKRAAQILKAMFEIGILEL
FT                   IFSIQNYEIKFFEQANDFKLELVTRYALLLYCQKDLNLKVFLDWKFSKHEAMQILSITN
FT                   FLNDAKFNMKKIWFEKKNYKEYLLAARIIGKLNHSQVKEFILKYDALLRPKFQVNGNDL
FT                   LNMNIEKKKIGAKLEYLKNFWIEQDFKPSKLELLAKL"
FT   repeat_region   complement(14627..14770)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   repeat_region   15003..15138
FT                   /note="REP01, repeated element"
FT   gene            complement(15379..15603)
FT                   /locus_tag="RC0016"
FT   CDS_pept        complement(15379..15603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0016"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JQ1"
FT                   /protein_id="AAL02554.1"
FT                   /translation="MLGLAIMAISFIFMSYSPKPELIFDANHMAVGVKDRENKLVIHAD
FT                   KIPAFNRTYWANWFGQKDSMVLPLENNIF"
FT   gene            complement(15687..16421)
FT                   /locus_tag="RC0017"
FT   CDS_pept        complement(15687..16421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0017"
FT                   /product="competence locus E protein 3-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02555"
FT                   /db_xref="GOA:Q92JQ0"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JQ0"
FT                   /protein_id="AAL02555.1"
FT                   /translation="MQDMRQNGISHVLCVSGLHLSLVVMIIFLTTRFLLNLSNYLAYNF
FT                   NIKLISAYCSLIGSFGYLELSGMQAATRAFITAAIFIYGIIFIGRSCFPLHSLAIAAFI
FT                   ILSLNPEYIFHPSFQLSFIAVLSLVAGYEFYLKNSWLLGEKKGIFGAVKFYTASNIYSS
FT                   FLASIITAPVVINQFFIFATYSVPANLIVVPITLFFLMPLALLSLPFTMIGFDNYILKL
FT                   MGFFIDIIIKSAAYFNSLPAAV"
FT   gene            complement(16433..16681)
FT                   /locus_tag="RC0018"
FT   CDS_pept        complement(16433..16681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0018"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02556"
FT                   /db_xref="GOA:Q92JP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JP9"
FT                   /protein_id="AAL02556.1"
FT                   /translation="MLAKLYKPQNSILPEGYDFGFYAYLSDIGANGYAMSEPQIIERNE
FT                   TNFDSFIYRVRSYIYNNLIEKIKGLLQLQYYLARQKV"
FT   gene            17298..23006
FT                   /gene="sca1"
FT                   /locus_tag="RC0019"
FT   CDS_pept        17298..23006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca1"
FT                   /locus_tag="RC0019"
FT                   /product="cell surface antigen"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02557"
FT                   /db_xref="GOA:Q92JP8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP8"
FT                   /protein_id="AAL02557.1"
FT                   /translation="MNKLTEQHLLKKSRFLKYSLLASISVGAAIPFEGMAMSKEAFRID
FT                   LSNKLLNHVSQLNGYKDTTNNTPQQIGKVIVSEPKINTYTPSEIREMKISNKPKASNPL
FT                   KDVPIEDHYKVVARSKSDVGTARKVRPITRCKTFAGIEKTEQSQNTYTPESTEQMPQKP
FT                   EIIITASSPTVSPASNSFITAPNTPNTTLTSPEHYTTAPGTPSSTPATPYQSTSDSKPN
FT                   DSLGANTPPNINTNSKAVRRLSFSSSGPQQQAVQSSSQVKSEVPPKPTFVPLPIKKSST
FT                   EIVAGMVSNISRVNEMIGIKLAEVTQAIDTTDKKDKERLQKLYTQLTSTQKTTEKLKSR
FT                   AEEIETKIKIGENKDKIKKLEKELTSKNNKADRLFQKIEKIDIPANKVSIKSQETVPVT
FT                   TASTEVSAFQAQQARINEARQGVFNKNKSSGGNARKSSAGTKREKKKQEAQKQLSEIKK
FT                   QEKAIKTASDKAKEVAASAKKETSRTALRAMQDKMNGDSEQLNKIEENLKLLTPVVYNS
FT                   STGPTYKQSPKATPTIPLSHGVQRILGEQPEDEEGYLVPIKVQQQPYQEIEDPIPSHSK
FT                   DIYEAKVSQYINYLNSIQPNQSNQAQIDSVIDGLATEMRKFSADQFSQKLGEIAHLASI
FT                   KAYEGLFEKLYEIQQARILETQKVYEQAEISQSYAEYEENSRKSSIPVLSRSSSAKSVI
FT                   SSNFEEKSALLQTTTTDESLRSDNNWKNSAPYSSSPKLDKRGLEYLDLAGDAFVQNLKQ
FT                   PDTLTIETLGLITPTQNTTVAKSDSSRKNNVSGSISEIQQLQSEKMRTETLGVQDDLGL
FT                   DLHYTPQETLTEKSTYLVSSKKKQGNIIKRAVSKVGSILQTNYAENRRRKRDGETSKQR
FT                   TVDQEGEFGHAWGNENHKESSLSVVSGCIKKATQLISLLDAKRTAILQTTSPSQRRSVS
FT                   LVLQEIENDYREAIKISQKLQQVLIRKPEDIKAYNAKAEKKLDAIKSRADKHFNNIETD
FT                   VDVGFNPNGGNSHSMPTANMDILPKNLAVTPPTNVGSLYNSPQAQQFQEDHKNIIINDR
FT                   SQGRLNLVDSTIVRELTDVDASIYNTAPPEVLKEAEALLDRSQGRLNLVDNTIKKGTQP
FT                   LSNLSTIYESVSYENLASETIYKTEQPKPSISYTNTSKRKLPIPLFRSAELDKKLEYLD
FT                   LEDKLLEVEEARIVKEKEAIAKLNQYQDPENLEFKRLAMEALDLSSKESQLKQKRKAIE
FT                   AEFSLNEKSSSTDVSILRSYSIDDISGVLSDAESNLSRSPSVSGLEDLNNSNVMQLEEL
FT                   KSKHEKIANDYNKELELDTLNKEKIWLEGEIKHLDTEFKPKVTESKPVFSCSSSVGSIN
FT                   SFSNDDDLSSRDVVTPVDTLNIEINKDYVDTYIRVLSNKIQKIEEIQKIEELSGSSSRS
FT                   EELNHIKEAMAYISNRIQDVEELDEKMLLAINAQLQEHDEKISSLLREEATDILAQLLL
FT                   QEMLVSDGKSESTLPAGDEEQEDTEVSRQLSSLPALASSNESALALSDDREKECLALGD
FT                   SSEDEESYDSGFEEEEETIGQLSDSDGDNLKITEVDTVIPLEQEAKKEMQTQISENAPT
FT                   LNQAKVVNTIVNNMIRNRLDASMNMSNNMVAVGAGDEEESHIKRGLWMRGMYGTNNHGR
FT                   VENMTGYRGTNKGATIGFDAEIDNNIVGIAYSNVHSVFKFKNSKNNDKELINSHVVSIY
FT                   GQKELPKNFALQALVSASKNFIKDKTTYSYGDTKIKSNVKHRNHSYNAEALLHYNYLLQ
FT                   SKLVITPNIGLRYGKSRDGVYNETGVNVQEIALTMKENNILSGIVGTKVTVPLKDALKF
FT                   NNLGLIFQGAVEHNFKEKTQRINRVVKIFDNTFKHNYLIPKQPKTSYNLGTGIIGSIKN
FT                   TTISLDYNYYLNKHYRSHQGSVKLKVNL"
FT   gene            23116..23187
FT                   /locus_tag="RCRNA02"
FT   tRNA            23116..23187
FT                   /locus_tag="RCRNA02"
FT                   /product="tRNA-Glu"
FT   gene            23481..23747
FT                   /locus_tag="RC0020"
FT   CDS_pept        23481..23747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0020"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02558"
FT                   /db_xref="GOA:Q92JP7"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JP7"
FT                   /protein_id="AAL02558.1"
FT                   /translation="MLKTNSPFKAHFKSILGGQIVAQQAAAYEVTKEITKYAEENNYNL
FT                   SFTGHSLGVWLAELSLYFAHRDFHYPKAKAITFDSPGLATENL"
FT   gene            24352..24978
FT                   /locus_tag="RC0021"
FT   CDS_pept        24352..24978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0021"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02559"
FT                   /db_xref="GOA:Q92JP6"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JP6"
FT                   /protein_id="AAL02559.1"
FT                   /translation="MIVHNEILQQIEETLNEKRFVTISAFAGAGKTTLAIKYGDRQTQA
FT                   KKKIVRFINVDSADKVLEAYRQLAKEFTIYVIDEKEENIIRLVHERIANLNSAILFIFD
FT                   NVEDHKDIEPYLNSIINILNDKAQVIITTKNNNLSDDIENIILVESFSKKEAILYLKKS
FT                   LKNRLNKKDIDKLVEDFGSNDAASPYRLSKAVAYLKANKLLKVND"
FT   gene            25436..25618
FT                   /locus_tag="RC0022"
FT   CDS_pept        25436..25618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0022"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02560"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP5"
FT                   /protein_id="AAL02560.1"
FT                   /translation="MDKCRKANLYQKMGYYNEYILCKFEESLKYYKKALKIDQELVHPS
FT                   FIASSLNNIGVIYEN"
FT   gene            25983..26186
FT                   /locus_tag="RC0023"
FT   CDS_pept        25983..26186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0023"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02561"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP4"
FT                   /protein_id="AAL02561.1"
FT                   /translation="MLCFEAICLGAINSSSKNFTCVKEFVRAYPELTNKITNEHPEYFI
FT                   DGSILRICVNDKAILNKLLASG"
FT   gene            complement(26192..26686)
FT                   /gene="atpF"
FT                   /locus_tag="RC0024"
FT   CDS_pept        complement(26192..26686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="RC0024"
FT                   /product="ATP synthase B chain precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02562"
FT                   /db_xref="GOA:Q92JP3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP3"
FT                   /protein_id="AAL02562.1"
FT                   /translation="MNFLDESFWLAVSFVIFLYLVYRPAKKAILNSLDAKILEVQEKVL
FT                   QAEKLKEDAALLFKHTNAQIKKLETLRSQMIEDSNEVTKKIIQEKTKEIEEFLEHKKSD
FT                   AIQLMQNQKSTASKELQDEFCDEVIKLVSEYFQSVKLSESNIAKNLMDKSDFPQDEGKA
FT                   T"
FT   gene            complement(26686..27159)
FT                   /gene="atpX"
FT                   /locus_tag="RC0025"
FT   CDS_pept        complement(26686..27159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="RC0025"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02563"
FT                   /db_xref="GOA:Q92JP2"
FT                   /db_xref="InterPro:IPR003319"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JP2"
FT                   /protein_id="AAL02563.1"
FT                   /translation="MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTN
FT                   IQDNITQADTLTIEVEKLNKYYNEEIDKTNAEIDRLKKEKIDSLESEFLIKKKNLEQDL
FT                   KNAINQNIEDINLAAKQFRTNKSAAIIKLAVNIIEKIAGTKADMNLLQNIKVK"
FT   gene            complement(27178..27414)
FT                   /gene="atpE"
FT                   /locus_tag="RC0026"
FT   CDS_pept        complement(27178..27414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="RC0026"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02564"
FT                   /db_xref="GOA:Q92JP1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP1"
FT                   /protein_id="AAL02564.1"
FT                   /translation="MSFFMDMVSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPS
FT                   ATENLQRMALIGAGLAEAMGLFSFVIAMLLIFS"
FT   repeat_region   27456..27599
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(27598..28326)
FT                   /gene="atpB"
FT                   /locus_tag="RC0027"
FT   CDS_pept        complement(27598..28326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="RC0027"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02565"
FT                   /db_xref="GOA:Q92JP0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JP0"
FT                   /protein_id="AAL02565.1"
FT                   /translation="MTHSPLAQFDIKKLIDIKMFGFDVSFTNSSIYMLLASILALTYFY
FT                   LAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMT
FT                   PYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLRFLTLFLPHGTPLWLAPLMIVIELF
FT                   TYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPIMVILIGFEIFVAIL
FT                   QAYIFTILSCMYLNDAINLH"
FT   gene            complement(28331..28627)
FT                   /locus_tag="RC0028"
FT   CDS_pept        complement(28331..28627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0028"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02566"
FT                   /db_xref="GOA:Q92JN9"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN9"
FT                   /protein_id="AAL02566.1"
FT                   /translation="MASSRNDGDKLMNTEKLKDIKARIKDLTTPKFSNPKIRQEISPFT
FT                   IAVDLVSGTMLGVVIGIFTDKIFNSKPLFLIIFTIIGMIAGFNIIRKKVNNKK"
FT   repeat_region   complement(28661..28696)
FT                   /note="REP01, repeated element"
FT   gene            complement(28705..29538)
FT                   /locus_tag="RC0029"
FT   CDS_pept        complement(28705..29538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0029"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02567"
FT                   /db_xref="GOA:Q92JN8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JN8"
FT                   /protein_id="AAL02567.1"
FT                   /translation="MRSIFIILIFLLFLSSCSEEKAQDKNHEEKQIIEHETQNNETSKA
FT                   TNQEAVNSENTTESIVPANDNNQTDEVSTPASQKQKNPAIKAVKVTFKVDDNDMVLGNK
FT                   KSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILAR
FT                   CKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAIL
FT                   IANTNFVAKAPQFIGTPSFFVNGVQTGNYSIDTISTAVDKALEEQKEKAKNEMSL"
FT   gene            29703..30224
FT                   /locus_tag="RC0030"
FT   CDS_pept        29703..30224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0030"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02568"
FT                   /db_xref="GOA:Q92JN7"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN7"
FT                   /protein_id="AAL02568.1"
FT                   /translation="MANTTQSEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIKVY
FT                   VISFSQDKMTLKVPVSRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEYEG
FT                   KINSGNIVAIAEVLRDLHKNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAINKL
FT                   VEVLREKLVA"
FT   repeat_region   complement(30226..30354)
FT                   /note="REP04, repeated element"
FT   gene            complement(30471..32075)
FT                   /locus_tag="RC0031"
FT   CDS_pept        complement(30471..32075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0031"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02569"
FT                   /db_xref="GOA:Q92JN6"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN6"
FT                   /protein_id="AAL02569.1"
FT                   /translation="MTKQANKISYDEVPYSPFTFSYTSPPYLRTIGKLFGLNPPPLETA
FT                   KILELGCGIGVNLLNFAETYPKSQSLGVDLSKTQIELGKKIISDLKIKNAELKALSILD
FT                   LDESYGKFDYIVCHGVYSWVPEEVQDKILKVCNKLLNPNGIAFVSYNTLPGWNMQRTIR
FT                   EMIMFHSEPFNTSHDKLQQAKLLLKFINDSLESSTTPYSNFLRDETKLLSAYTDSYVLH
FT                   EYLGEINTGIYFHQFIEKAQKNHLNYLGDTSLTAMFIGNLPTQAAEKLQAINDIVRTEQ
FT                   YMDFITNRKFRSTLLCHQNIPINRKIEFNNLKEFFTSLNIRPVILEKAVDLTNEQENVS
FT                   FYYENLPEPFISTTSPIMKAILYVYAENISNPISLEQVAKEAFKKLGKYQLQDFLAALE
FT                   QHFIIFIFQGYLKIFETKPHAIATITEKPKTSEFARYQAKQAYFNNVTSVFSVTNRLND
FT                   MVGIPIHEKYILEMLDGTHNIDDIKKGVLEKINSKLLTARDDKGQEVTDPKLLKEFVDY
FT                   VVNTSLEKFRMNYLLVE"
FT   repeat_region   32370..32403
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   32410..32459
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   32460..32488
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(32500..33582)
FT                   /gene="recF"
FT                   /locus_tag="RC0032"
FT   CDS_pept        complement(32500..33582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RC0032"
FT                   /product="RecF protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02570"
FT                   /db_xref="GOA:Q92JN5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JN5"
FT                   /protein_id="AAL02570.1"
FT                   /translation="MKNIFLHSLNLENYRNFKNLELKTDNTPIILIGENGSGKTNILEA
FT                   ISLFYPGRGLRSAKLANVCKTSEDHCLVKALLQSKLGLAEFTTQFKRSSNRRITEYNES
FT                   KIANNELSKFTSMVWLTPHMEGIFTSGSSDRRKFLDRIVYNFDPKHAELVSKYEYYMHE
FT                   RNKILVEDRRDDNWLKIIEEKMADISNHIANNRLKTLEFMQQAIDDLENEFPKADLSID
FT                   GIVEQKILNGKKNIVSFITAELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCS
FT                   TGEQKAILIAIILAEMNYAIKLTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWV
FT                   TTTNLEGIDNFATKAQLIKL"
FT   gene            complement(33606..33908)
FT                   /locus_tag="RC0033"
FT   CDS_pept        complement(33606..33908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0033"
FT                   /product="coenzyme PQQ synthesis protein c-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02571"
FT                   /db_xref="GOA:Q92JN4"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN4"
FT                   /protein_id="AAL02571.1"
FT                   /translation="MFKVIKLTEESFSIGLGVLYAYERQTPKVSDSKIQGLQKFYGNSD
FT                   YRTLQSFIVHSKVDQWHTQECANLINNLSSKEQTLAYQGAKLLWQFLDGINATYQ"
FT   gene            complement(34249..34743)
FT                   /gene="folA"
FT                   /locus_tag="RC0034"
FT   CDS_pept        complement(34249..34743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="RC0034"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02572"
FT                   /db_xref="GOA:Q92JN3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN3"
FT                   /protein_id="AAL02572.1"
FT                   /translation="MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIV
FT                   MGRKTFDSIPTKILKNCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVG
FT                   GTKIATLFLEQNLIDEFLLTKINKNYDGDTFLPLNLLAEWHSVIIDKTNNYQIYKFTKR
FT                   R"
FT   gene            complement(34740..35045)
FT                   /locus_tag="RC0035"
FT   CDS_pept        complement(34740..35045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0035"
FT                   /product="folate synthesis bifunctional protein-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02573"
FT                   /db_xref="GOA:Q92JN2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN2"
FT                   /protein_id="AAL02573.1"
FT                   /translation="MDLIEKISFLILELVLENPFIKIYILQYIKEFKNLGCEILLGHSR
FT                   KSYISAFYNSKASERDLEIIAISKYLMENLVDYLQVHNVIEHQKFFVADHMINYIL"
FT   gene            complement(34957..35226)
FT                   /locus_tag="RC0036"
FT   CDS_pept        complement(34957..35226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0036"
FT                   /product="folate synthesis bifunctional protein-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02574"
FT                   /db_xref="GOA:Q92JN1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN1"
FT                   /protein_id="AAL02574.1"
FT                   /translation="MVKNNLDDYTLRLIADYNCKIITMHSLTVPPQKQKCLDFDKSPLA
FT                   SLNIWTEQEITKLEKCGFDRKNIILDPGIGFGKSVYQNLYITIY"
FT   gene            complement(35416..35838)
FT                   /locus_tag="RC0037"
FT   CDS_pept        complement(35416..35838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0037"
FT                   /product="folate synthesis bifunctional protein-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02575"
FT                   /db_xref="GOA:Q92JN0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JN0"
FT                   /protein_id="AAL02575.1"
FT                   /translation="MSLTKIEKQLGRVSSYDKWSPRVIDLDILLWNNCHIDLPDLKIPH
FT                   PELLNRPFLIHLIAGLSLECRYSCPINNFYNNKTFAAIAHLIEHQGVIRSLVLNPQFVG
FT                   ILNITPDSFSDGGLSFHEEDAVRNFVRLINEGATIN"
FT   gene            complement(35819..36058)
FT                   /locus_tag="RC0038"
FT   CDS_pept        complement(35819..36058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0038"
FT                   /product="folate synthesis bifunctional protein-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02576"
FT                   /db_xref="GOA:Q92JM9"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JM9"
FT                   /protein_id="AAL02576.1"
FT                   /translation="MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQAIIFETQAILQ
FT                   PNADKAWDKSYLNMVVQGKSTLTPSKLLIELNKD"
FT   gene            complement(36524..37192)
FT                   /locus_tag="RC0039"
FT   CDS_pept        complement(36524..37192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0039"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02577"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM8"
FT                   /protein_id="AAL02577.1"
FT                   /translation="MTNNQFSEDTKKIADQIKDALMGISDDLVLESKEVEEIFEELSQN
FT                   EEFEYEMERMLSILNEQTMDLTQLQSRIILLIRKYLGKTKNLKLKMLKMDEKLINKNVA
FT                   EVSNYLMHQHSKIVRDANKNLTNPKDKLQGLTKQARIDLKRLLKSFAVYQIYMFMNPKR
FT                   IAGETKLMNFAYNMIKGGMKLAKKYEGGKEQEIKSYSPRLIKKLKKAHVGFKKSGGISI
FT                   "
FT   gene            complement(37792..38109)
FT                   /locus_tag="RC0040"
FT   CDS_pept        complement(37792..38109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0040"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02578"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM7"
FT                   /protein_id="AAL02578.1"
FT                   /translation="MLPDQALPIYNLLEKLLKETHKSINDCYKNENLYKHQLAKIYCQQ
FT                   AQICTPNGSTKLSKNSIGLYENAANLGSEEANIKLGKIEFKSGNYVKALEYFKNLCKRS
FT                   F"
FT   gene            complement(38531..38800)
FT                   /locus_tag="RC0041"
FT   CDS_pept        complement(38531..38800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0041"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM6"
FT                   /protein_id="AAL02579.1"
FT                   /translation="MPKTDKLKQLIDIVNYYKQLEDNAKTIGNFLETVKKLNQLLETPK
FT                   SENKLENLLNYLKYIYLTSNFPKKKIWLHLILQNGLTIYLPRGI"
FT   gene            40072..40671
FT                   /gene="sco2"
FT                   /locus_tag="RC0042"
FT   CDS_pept        40072..40671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco2"
FT                   /locus_tag="RC0042"
FT                   /product="sco2 protein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02580"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM5"
FT                   /protein_id="AAL02580.1"
FT                   /translation="MRNNKNQMYIIKIFIALAMITGIIFLCLLYSSLTPSKLKIGVKTS
FT                   NMDDSPKIKFTLIDQEGKKFDSTHLQGHLSLIYFGTTYSLYDNQTLKRVEDIIKILKKE
FT                   NILVQVVFITLDSEHDTSEVLKKYLEKIDDNFIGLTGRVEDIEQLADQFKVFFYTSKIF
FT                   DVKTNKYELQHSNFVYLISSQGKFLKHYYLGLPKNG"
FT   gene            complement(40682..41251)
FT                   /locus_tag="RC0043"
FT   CDS_pept        complement(40682..41251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0043"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02581"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM4"
FT                   /protein_id="AAL02581.1"
FT                   /translation="MGDKIFHNLSGKTLVATPHVITKGIYHKSLIYMLSHTEEGAIGLI
FT                   FNRLVNHIDLKSFFKIKNDEITTPVMVPIYLGGPVEHEKGFFLHSSDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGKGPKNSLFIVGYTAWKPGQLEEELETNLWLVMDCNKEFIFADN
FT                   PESKWHNALKHLGIDEIHFSSQIGNA"
FT   gene            41317..41985
FT                   /locus_tag="RC0044"
FT   CDS_pept        41317..41985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0044"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02582"
FT                   /db_xref="GOA:Q92JM3"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JM3"
FT                   /protein_id="AAL02582.1"
FT                   /translation="MITFFDITIFAIITLFSFFGLYQGIIGFTTRILGFITSIMLGYFL
FT                   YPYISDLIGKYMDNEVIRIIIAGVISYVIALILCVFIVYKFLAIISFMRNGFIDRFLGL
FT                   LAGFAVGTTISLVLFFITMIFTSENYFKSKSLKDFVVSSKQSKYGGVLKVAVTTDYLDE
FT                   LSKNIIVIIPNETLKSIEIFENKDLNNFKNSLKKSNASNDDEDVFSRELQDELSNIDDE
FT                   "
FT   repeat_region   complement(42000..42020)
FT                   /note="REP01, repeated element"
FT   gene            complement(42377..42703)
FT                   /locus_tag="RC0045"
FT   CDS_pept        complement(42377..42703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0045"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02583"
FT                   /db_xref="GOA:Q92JM2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM2"
FT                   /protein_id="AAL02583.1"
FT                   /translation="MNCPLSLQIVNVSYIVNTNSCSWIAFNNSKYPIKTIKINIININI
FT                   LGKINHMVIFCDNNIVIILWKIMVVIISSIIHRTYIRRWISRRNNIRRKASHACKQPNN
FT                   TTGC"
FT   gene            42551..43378
FT                   /locus_tag="RC0046"
FT   CDS_pept        42551..43378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0046"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02584"
FT                   /db_xref="GOA:Q92JM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JM1"
FT                   /protein_id="AAL02584.1"
FT                   /translation="MVNFAQNININDINLYGFNGVFTIIEGNPTTRVSINNITNVDNLQ
FT                   TQRAVQNALGAPLAYGANNNNAKAKLKLISGNGTGAELTITGNITNTKTMRGEVTFVKI
FT                   PDIYEIGSQTKQVSKVMFEGNHEHKLHNDIHSRQTNFDSGTYNICTQDITINGNVNGST
FT                   FDLRRNVILTGDVVLEGNITINALGESGIVFQNLPTAFGTNIVININRVHTANDVAALS
FT                   ILRMSNGDGFLMDILILQQTGTGVNNMYVAGKAGNLTTGIAGIKLTAPKTILK"
FT   gene            43432..43611
FT                   /locus_tag="RC0047"
FT   CDS_pept        43432..43611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0047"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02585"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JM0"
FT                   /protein_id="AAL02585.1"
FT                   /translation="MKARFIWADNYFENTTSSSTPKVGYNVGASLLTAHKRILSYLQRI
FT                   TVIYAANILATKGS"
FT   repeat_region   43662..43762
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(43798..43838)
FT                   /note="REP04, repeated element"
FT   gene            complement(43865..45187)
FT                   /locus_tag="RC0048"
FT   CDS_pept        complement(43865..45187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0048"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02586"
FT                   /db_xref="InterPro:IPR020183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL9"
FT                   /protein_id="AAL02586.1"
FT                   /translation="MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCN
FT                   FARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASDQKIKSIFDNLKKQIQK
FT                   LQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNS
FT                   GMQSTNGKDVAIFVSCGGNPFAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDD
FT                   KGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNA
FT                   NKVSGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLS
FT                   PAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLIT
FT                   SYNAITGENYQRDFKKPKSNFFSKINIFSNKKLVLKPVREL"
FT   gene            complement(45197..45721)
FT                   /locus_tag="RC0049"
FT   CDS_pept        complement(45197..45721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0049"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL8"
FT                   /protein_id="AAL02587.1"
FT                   /translation="MIAQNHFKKIAISSTGIRRGVEDFLNQKYFADKFTEEEQGCFVLF
FT                   LAYKIFRYGNKVCLKYFSEQQPELITKIFDDYPHLFFRREAINICIKNKDGRQKALDAI
FT                   KLKSSNKFFKDCFDTVFPKVDVVVNLIFEEEPKPKHVPNEPELVFNLELIPLNIDENDD
FT                   VLPTSNVENNH"
FT   gene            complement(45699..46100)
FT                   /locus_tag="RC0050"
FT   CDS_pept        complement(45699..46100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0050"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02588"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL7"
FT                   /protein_id="AAL02588.1"
FT                   /translation="MRQISVISLRLNCQCTINFFVMIPNNIKEMNSNPMEKLAFQDAIS
FT                   LISYMYHHAEDILKSSKSLLNQILTTTKEGLSTSWDDIKKTTSGNVEYDLWQMEKQVPE
FT                   SEIITEKAKSGQLRSIKISCFSVDCSKPL"
FT   gene            complement(46024..46377)
FT                   /locus_tag="RC0051"
FT   CDS_pept        complement(46024..46377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0051"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02589"
FT                   /db_xref="GOA:Q92JL6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL6"
FT                   /protein_id="AAL02589.1"
FT                   /translation="MSASSLIKWVCYLGDIAASGFLNSIATALIAVLHDAGDNMFNSKE
FT                   EKKLVDILTKFYKMINKQSDITVPVGQDLQRLALLFANLRSVEIKKNNETDFSNFFTTK
FT                   LPMHNKFFRYDTK"
FT   gene            complement(46518..46715)
FT                   /locus_tag="RC0052"
FT   CDS_pept        complement(46518..46715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0052"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL5"
FT                   /protein_id="AAL02590.1"
FT                   /translation="MLSRDSSQLTSFNNKDSHDIIEVSQTLNALISIIAKHDHDIARHA
FT                   QAIADIKKCYNLQMLGILQI"
FT   gene            complement(46780..46998)
FT                   /locus_tag="RC0053"
FT   CDS_pept        complement(46780..46998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0053"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL4"
FT                   /protein_id="AAL02591.1"
FT                   /translation="MKASLTCVGEYYNNVEQTELYLKAVASLRQTALYTSKPKDTDILL
FT                   GKAFYKAGKLSEAGTVLNKYIYILSRE"
FT   gene            complement(47153..47878)
FT                   /gene="phbB"
FT                   /locus_tag="RC0054"
FT   CDS_pept        complement(47153..47878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="RC0054"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02592"
FT                   /db_xref="GOA:Q92JL3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JL3"
FT                   /protein_id="AAL02592.1"
FT                   /translation="MSELTIVTGGTRGIGKATALELKNKGLTVVANFFSNYDTAKEIEE
FT                   KYGIKTKRWNIANFEECRKAVKEIEEEFKKPVSILVNNAGITKDKMLHRTSYQDWNDVM
FT                   NINLNSCFNMSSSVMEQIRNQDYGRIINISSINAQARQIGQTNYSAAKAGIISFTKALA
FT                   RETASKNITINCIAPGYIAIKMVGAVPEDVLVKIVNSIPKKRLGQPEEIARAVAFLVDE
FT                   NAGFITGETISINGGHNMI"
FT   gene            complement(48036..48323)
FT                   /locus_tag="RC0055"
FT   CDS_pept        complement(48036..48323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0055"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL2"
FT                   /protein_id="AAL02593.1"
FT                   /translation="MLAVKIEKGLMNIIKYLKQYHKKKTNIDKQLLKNCHITQQAGSNL
FT                   CRRCNNRLLRHYKKENKRVIPKSRKETLAAIMALTAKTNKIADKKKMDKR"
FT   gene            complement(48478..49068)
FT                   /locus_tag="RC0056"
FT   CDS_pept        complement(48478..49068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0056"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02594"
FT                   /db_xref="GOA:Q92JL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JL1"
FT                   /protein_id="AAL02594.1"
FT                   /translation="MKNAFEKIGAITDKDGKNFETLLTSKHAGTLASISNDIDSRQKIT
FT                   KLNARQAQEWLEEGVILHTNTLNSGPIGAGNDPTITDQTKKSMENVGGKNTNTPLNLFR
FT                   LIGVTNNFAGVSDTLNKIAKNLPTEKGIDELKAHIKPRSKFEHFFRINKPKGNAAETIN
FT                   NANLTDQEKEILKKAVTLRKNIEQADIPFRVSF"
FT   gene            complement(49114..49389)
FT                   /locus_tag="RC0057"
FT   CDS_pept        complement(49114..49389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0057"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02595"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JL0"
FT                   /protein_id="AAL02595.1"
FT                   /translation="MLGKNDIKNVHKKLNVAKDFQNFNDEHCNIVTLSKVINDEGKKHI
FT                   VVEAEVAFKGLTEEQKQEYQNRDGKNWYNVMPECERKLVDQYTDTI"
FT   gene            complement(49383..49778)
FT                   /locus_tag="RC0058"
FT   CDS_pept        complement(49383..49778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0058"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02596"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK9"
FT                   /protein_id="AAL02596.1"
FT                   /translation="MLSSLKKQFDNDKEFLLNHTKEFLTTPGVGVTLETNRANIEGKNG
FT                   ETPILIRDGRNNPNEKIVLGTKAFEYLNAIRGAINIAKGKNKPELVLKLNKKTVKFINR
FT                   FNAFNMEKSQENISKIGKLKLTVLLNC"
FT   gene            49891..52464
FT                   /gene="clpB"
FT                   /locus_tag="RC0059"
FT   CDS_pept        49891..52464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="RC0059"
FT                   /product="clpB protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02597"
FT                   /db_xref="GOA:Q92JK8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK8"
FT                   /protein_id="AAL02597.1"
FT                   /translation="MNIDKFTAHAKSVIASSQLLAAKNDHQQILPLHLLSSLLSEETGI
FT                   IQTLINNTGGNINLLKDQVQLELNKIPKVQVEGGGQVYSSAEALKVLEKASSIAKDNGD
FT                   SFVTIERIFEALTYDNTIAGKILTNNGINNKKIATAILQFRKGKKADTESAENSYDALK
FT                   KYGRDVTELAESGKLDPIIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQ
FT                   RIFSKDVPESLINCRIIELDMGALIAGAKYRGEFEERLKAVLSEIKESSGEIILFIDEL
FT                   HLLVGTGKTDGAMDASNLLKPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVS
FT                   EPTVEDTISILRGIKEKYELHHAVRISDSAIVAAATLSNRYITDRYLPDKAIDLIDEAC
FT                   SRMKIELSSKPEELDELDRRIIQIKIELAALKKENDEHSKKKIEHLTTALEKLESQSYD
FT                   MGAKWQAEKSKLQQTQKLKEELDRSRNELERAERDANLAKASELKYGIIPEIMKKLQEA
FT                   ESMDNKGLLKEIVSESDIASIISRITGIPIDTMLSSERERLLVMEQKLRESVIGQDKAI
FT                   KGVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSE
FT                   YMEKHAISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILD
FT                   EGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKEDEDTYKVKDEVMEYVKAVFKPEFL
FT                   NRLDEIILFHRLNRNNIHDIVKIQLESLKKILLAQNIILEFDESALNYLAEKGYDPSFG
FT                   ARPLKRLIQREIQNNLAKMILAGEISSGKTVKINSKDKELKVTMS"
FT   gene            complement(52705..53196)
FT                   /locus_tag="RC0060"
FT   CDS_pept        complement(52705..53196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0060"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02598"
FT                   /db_xref="InterPro:IPR035354"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK7"
FT                   /protein_id="AAL02598.1"
FT                   /translation="MSNSNYENIYKAFYCFSEATNSAYSAINTFLELPNVFNKYPAVIS
FT                   LIFSKTATLDSNINNIIKNGVIIYDISTALIGAINTFYKDKKLVNKILKDGQNAIDKLI
FT                   ETTTYLSPIVTDITNSYLVDPYKEENALLFDLQIPNSTSSDYYKLSGTESITLAEIEYY
FT                   "
FT   gene            complement(53323..54357)
FT                   /gene="gcp"
FT                   /locus_tag="RC0061"
FT   CDS_pept        complement(53323..54357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="RC0061"
FT                   /product="sialoglycoprotease"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02599"
FT                   /db_xref="GOA:Q92JK6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK6"
FT                   /protein_id="AAL02599.1"
FT                   /translation="MIKILGIESSCDDTAVSIITENREILSNIIISQNTEHAVFGGVVP
FT                   EIAARSHLSHLDKALKNVLKESNTKLTDISTIAATSGPGLIGGVIVGSMFARSLSSALK
FT                   KPFIAINHLEGHALTARLTDNIPYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAVG
FT                   EAFDKVAKMLNLAFPGGPEIEKRAKLGDPHKYKFPKPIINSGNCNMSFSGLKTAVRTLI
FT                   MTLKEINDTVINDIAASFQFTIGEILSSKVQDAIRAYEQITNNFDKKNIVIAGGVAANK
FT                   YLQKILSSCAKTYGYRLIYPPIHLCTDNAAMIAYAGLERYNNKLFTPLNFCPKARWSLE
FT                   DISN"
FT   gene            complement(54469..55662)
FT                   /gene="aco1"
FT                   /locus_tag="RC0062"
FT   CDS_pept        complement(54469..55662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aco1"
FT                   /locus_tag="RC0062"
FT                   /product="acyl-CoA desaturase 1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02600"
FT                   /db_xref="GOA:Q92JK5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JK5"
FT                   /protein_id="AAL02600.1"
FT                   /translation="MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASY
FT                   YINNITVGIGLHRLWSHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQD
FT                   QDPHTPLKFDNKFLGFMWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIA
FT                   AFMNIVVPLFIGYLVGGTMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGT
FT                   AGDIWWMALFLLGENWHNYHHAFPSDYRNGAKWYHLDVHKWIIFLMSKIGLASELERTT
FT                   KVRIQAKMQETLNYLSEKQKQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSF
FT                   VEIQESLKNLAEQVSAATQITEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSH"
FT   gene            complement(55790..56161)
FT                   /locus_tag="RC0063"
FT   CDS_pept        complement(55790..56161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0063"
FT                   /product="transcriptional regulator-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02601"
FT                   /db_xref="GOA:Q92JK4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JK4"
FT                   /protein_id="AAL02601.1"
FT                   /translation="MLFFYKPFLSEQIVGTLKSLLRRFKSVVQDNIIKFKNLNIDLNTE
FT                   KVYKDGLNIPLGPTEFKILQLFFQVPNEVFLRQEIIKYLWESEETFNERLIDVHINRIR
FT                   DVLGKDNLIITTVRLSVVV"
FT   gene            56522..56959
FT                   /gene="rpsF"
FT                   /locus_tag="RC0064"
FT   CDS_pept        56522..56959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="RC0064"
FT                   /product="30S ribosomal protein S6"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02602"
FT                   /db_xref="GOA:Q92JK3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK3"
FT                   /protein_id="AAL02602.1"
FT                   /translation="MNLIVLVAINSFILKFVCWRFLYIMSFYESVFIIRQDVSLNDIDK
FT                   IVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHYYFLGLDITGNVKEELERKMK
FT                   LNENIIRFLTIQADSISSEPSPILKNQSTENTPVIDVTINN"
FT   gene            56984..57271
FT                   /gene="rpsR"
FT                   /locus_tag="RC0065"
FT   CDS_pept        56984..57271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="RC0065"
FT                   /product="30S ribosomal protein S18"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02603"
FT                   /db_xref="GOA:Q92JK2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK2"
FT                   /protein_id="AAL02603.1"
FT                   /translation="MLKSNNASETAAHKVGDKTAKKVFFRRRKGCPLSVPNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
FT   gene            57283..57798
FT                   /gene="rplI"
FT                   /locus_tag="RC0066"
FT   CDS_pept        57283..57798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="RC0066"
FT                   /product="50S ribosomal protein L9"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02604"
FT                   /db_xref="GOA:Q92JK1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK1"
FT                   /protein_id="AAL02604.1"
FT                   /translation="MEIILIKPVRKLGKIGDILKVADGFGRNYLLPQKLAIRATEPNKE
FT                   LIVKQKHEFEAKDKQIREEVEKINALIKDQQLVFIRQTSNDGKLFGSVTNKEIADKLSE
FT                   NISYNISHSNIILDKQIKSTGIYTVEIRLHAELNAIVTVIVARSESEAQDYLREQKTET
FT                   SEDLAELA"
FT   repeat_region   57882..57910
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(57911..57963)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(57966..57999)
FT                   /note="REP02, RS3-like repeat"
FT   gene            58097..59533
FT                   /gene="mesJ"
FT                   /locus_tag="RC0067"
FT   CDS_pept        58097..59533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="RC0067"
FT                   /product="cell cycle protein MesJ"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02605"
FT                   /db_xref="GOA:Q92JK0"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JK0"
FT                   /protein_id="AAL02605.1"
FT                   /translation="MLYEKFEYNINNLIGNFGLSKISIAVSGGSDSVALLYLANIWAEK
FT                   NNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFSNLQERAREGRY
FT                   DLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLY
FT                   NIPKSELVEYLVRHNIKWFEDESNSSDKYRRNVIRQKLAKGADYIRHFSKPVYREEFKG
FT                   DTERSTAAYTLVREDASTGTASKLSLEAKCGKMSKAAIISQQLKTNKLIENEFKPELIS
FT                   AIAEAVKIFEYGFAFLDLVKFDKFSNEVKVQIINFLLIIISGQSRAARFYSVEPILKLI
FT                   TQDVNFKNTLHGCIIKRIQNELLIYREFGKKLPESKILLDKSVIWDNRFCITKNQETPN
FT                   CFVTHLSLKDYKIIKKQLDLEPLKNLSCKNHNAVLLTLPIIKILEKVIAIPHISYYDND
FT                   MWNFEVSFSPNFVSRFTHFC"
FT   repeat_region   58721..58864
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            59634..61547
FT                   /gene="ftsH"
FT                   /locus_tag="RC0068"
FT   CDS_pept        59634..61547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="RC0068"
FT                   /product="cell division protein ftsH"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02606"
FT                   /db_xref="GOA:Q92JJ9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ9"
FT                   /protein_id="AAL02606.1"
FT                   /translation="MNNQGRSILAWATLFIFVILLFNVFQSDSLLGGRNNITFSDFLTR
FT                   VDEKTVNSVKIQGRVIEGTSNDGSTFNTYAPDYPDLVNRLTSNDVNIEVVPLETRMNTF
FT                   LGFLISWFPMLLLIGVWVFFMRQMHGGGKAMGFGKSKARLLSDKGPKITFKDVAGIDEA
FT                   KEELTEIVDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGS
FT                   DFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQM
FT                   LVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKK
FT                   IKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMGV
FT                   ARRSIAMSEKEKRLTAYHEGGHALVGLYCPAASPIHKATIIPRGNALGMVQRLPETDEY
FT                   SQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLIG
FT                   PIFHGSSGDDMYGRQPNNETSEATAELIDAEVKRIITQGYEFAKDILTKHIDQLHTLAN
FT                   ALIEYETLSGQQIKNLLSGRALDSEEENKFPFNDSSTIKIDKEKSPEKTKTTKAKKENY
FT                   AS"
FT   repeat_region   complement(61787..61912)
FT                   /note="REP04, repeated element"
FT   repeat_region   61980..62005
FT                   /note="REP02, RS3-like repeat"
FT   gene            62230..63015
FT                   /gene="sdhB"
FT                   /locus_tag="RC0069"
FT   CDS_pept        62230..63015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="RC0069"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02607"
FT                   /db_xref="GOA:Q92JJ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ8"
FT                   /protein_id="AAL02607.1"
FT                   /translation="MAELRLPPNSVVKKGREHKEQEEMLKPRKIKIYRYDPDLDKNPTI
FT                   DSFEIDLSKTGPMILDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPI
FT                   EDISGDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPTPSNSERLQSIKDRE
FT                   KLDGLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDP
FT                   FKLYRCHTIMNCTKTCPKGLNPAKAIGKIKSLIAERHGL"
FT   gene            63304..63459
FT                   /locus_tag="RC0070"
FT   CDS_pept        63304..63459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0070"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02608"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ7"
FT                   /protein_id="AAL02608.1"
FT                   /translation="MILLMCLTSYRKNRRAYKKEFEAMLKCEEGDLSCPFIIKTQNLGF
FT                   FVDISS"
FT   repeat_region   complement(63438..63597)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            complement(63599..64819)
FT                   /locus_tag="RC0071"
FT   CDS_pept        complement(63599..64819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0071"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02609"
FT                   /db_xref="GOA:Q92JJ6"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JJ6"
FT                   /protein_id="AAL02609.1"
FT                   /translation="MSIESKIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEG
FT                   DFVTAPEISQLFGEIIGLWCIREWQRIGCPKSLSLVELGPGRGLLMRDLLRTAKLVPEF
FT                   YKALSIELIEINKNFIAYQKANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQ
FT                   YIKVKELWYERIFVVQPVDERIKYDKISVNKQLQEYLLCTHIEAKDGAVLEESYKSIEI
FT                   IKFIAQHLKRLSGSGLIIDYGYDIAPNGRTRYQYNQTLQAVKNHKYCPILENLGEADLS
FT                   AHVDFYALKTVAKNSKINVIDTISQRDFLIENGILLRKQTLQDKLNDRHLAKFAYREEF
FT                   KGDTKRSTAAYTLVREDASIGSTYKLPLEVEFGKMSEQAQIIERQVERLISPKQMGELF
FT                   KVLQIMN"
FT   repeat_region   complement(63692..63835)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(64798..65577)
FT                   /gene="lgt"
FT                   /locus_tag="RC0072"
FT   CDS_pept        complement(64798..65577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="RC0072"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02610"
FT                   /db_xref="GOA:Q92JJ5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ5"
FT                   /protein_id="AAL02610.1"
FT                   /translation="MTFPNINPIIFSIGPLAISWYSLSYVIGILLGWFYANKIVEKFKP
FT                   QITKKNLEDFITYAVIGIIVGGRLGFVLLYNPSRYFSNPIDILKTYEGGMSFHGGALGG
FT                   IIAAYLFCRKYKINFLSLTDIIAPVVPIGLFLGRIANFINGELYGRITNSSFGMIFPNS
FT                   DLMPRHPSQLYEAFFEGLVLFSILAYTTFKHKTLKKCGLNSGIFFTFYGLFRITIEIFR
FT                   EPDIQIGFILDSLTMGQILSVPMLLLGSYLICQSNPK"
FT   gene            65822..66985
FT                   /locus_tag="RC0073"
FT   CDS_pept        65822..66985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0073"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02611"
FT                   /db_xref="GOA:Q92JJ4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JJ4"
FT                   /protein_id="AAL02611.1"
FT                   /translation="MQYLMDLYHTSSTELVLLFVMLVSLIPVIFLIKRLIFIPVKNYLT
FT                   RHHYDDYERIKKYPIFRYLLHTLLALYFICWGKIFHPTSFKAHVLLGIKDTIVILYTGI
FT                   SVTMLLLTLIDAFADLYHNRIKAVTKNAPLSLYFQILKIIVIVIAAMVTISYILNISLS
FT                   TFLTSLGAAAALLTFVFKDTVLGLLASLQLTTQEIINIGDWVRIGAIEGTVEKITISVV
FT                   TIRNFDQSISTVPTYSILNSNVTNYRGISESGARRVKRVFNINMATINFCDATILKALK
FT                   KSPYISKDVIDKITLDKEEKDLTNIKLFKLYIQEYLKNNPAVYTEGFTFLVRQLEPTIN
FT                   GLPIEIYIFVKEVNLVGYENIQDNISEHFISILPEFKLKIFQNVGVV"
FT   gene            67177..68859
FT                   /gene="yidC"
FT                   /locus_tag="RC0074"
FT   CDS_pept        67177..68859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="RC0074"
FT                   /product="60 kD inner-membrane protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02612"
FT                   /db_xref="GOA:Q92JJ3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ3"
FT                   /protein_id="AAL02612.1"
FT                   /translation="MNNNIINLIAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAEN
FT                   LKKQQLKALVEPATGIVVQEESQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSK
FT                   NSPEVRLFSPANTENAYFAEVGLVSNLSSVKLPNNDTIWNSDSEILSPEKPVHLFWVNE
FT                   DGVKFLVTITVDENYLFTIEQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIG
FT                   CIDENLKEYSYDDIKDKKSEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQ
FT                   GTERYQVDFISPVQIIKPGENFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWF
FT                   YIITKPVFYAMNFFYGYVGNFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDR
FT                   IKNLYSDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPF
FT                   YGWIKDLSASDPTTIFNLFGLLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQA
FT                   QVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQQYYINKFN"
FT   gene            68863..69408
FT                   /gene="pgsA"
FT                   /locus_tag="RC0075"
FT   CDS_pept        68863..69408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="RC0075"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02613"
FT                   /db_xref="GOA:Q92JJ2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ2"
FT                   /protein_id="AAL02613.1"
FT                   /translation="MRIDKNLPNYLTIARIMVIPVIILVFYINNSLARTLGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMFDPIADKLLVGCVIIMLLKKDNVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSRLAKVKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAA
FT                   FLTIITGYSYFKACKKYF"
FT   gene            69422..69982
FT                   /locus_tag="RC0076"
FT   CDS_pept        69422..69982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0076"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02614"
FT                   /db_xref="GOA:Q92JJ1"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ1"
FT                   /protein_id="AAL02614.1"
FT                   /translation="MIHVKYIILGFIMVSSLNLYAANNDIIANKKVVKVEVSNEHLKTL
FT                   NEASTLLISCVDFRLIDETDKLMKQLGLEDNFDKVSLPGASLALINDKYTYWGKTIEDT
FT                   IEILQELHNIKQIVFLDHRECGAYKILIGQEQLNTKEKETAAHAAILNKARDIIKEKFP
FT                   QLKVYTFLMGLDGVVEQIYEIPS"
FT   repeat_region   complement(70014..70113)
FT                   /note="REP01, repeated element"
FT   gene            complement(70152..70571)
FT                   /locus_tag="RC0077"
FT   CDS_pept        complement(70152..70571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0077"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02615"
FT                   /db_xref="GOA:Q92JJ0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JJ0"
FT                   /protein_id="AAL02615.1"
FT                   /translation="MVYLSRIRLKVYMIKKIIFGIAILLSTSCFANSTTSDGSKKDAAK
FT                   TNDITTQKIIDDFSAYAGTIKPEVREEIQKYRVAIVKINKKKRELYNRLSKEAQNFLAE
FT                   QQKYKQKLSISKLTVENDQKNNTADSNDNKSKDTK"
FT   repeat_region   complement(70592..70735)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            70755..71027
FT                   /locus_tag="RC0078"
FT   CDS_pept        70755..71027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0078"
FT                   /product="BioC-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02616"
FT                   /db_xref="GOA:Q92JI9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JI9"
FT                   /protein_id="AAL02616.1"
FT                   /translation="MYFLFVCYCLVSINILIVGKNIQYYNNNAQEFYSRTINADLSDNY
FT                   KAFTSYLPEQAHIVDAGCGVGCDTKYFLSQRYQVTAFDGSTEMVK"
FT   gene            71594..72442
FT                   /locus_tag="RC0079"
FT   CDS_pept        71594..72442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0079"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02617"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI8"
FT                   /protein_id="AAL02617.1"
FT                   /translation="MAYRTNAVAAINVGFFEIAGSDDGRPGLTLMIDSKLFSLRKQLQS
FT                   LLIIDQGNIQITKASAKILVVIGDKSVIPNQVHYFSNLKDITFYNDVWASTTLTSYTNK
FT                   EILIDQNRSNFIVTAISKHGDNQIPQKGFILSFPQATSLPVVNINDSVKLILEFIDKDG
FT                   KLINLSNTASIVTGIPLLVQNGKNVVDNPKQDDPAHARTALGVCNDGTIVIVVVEHIYK
FT                   QHVKDLKLVQVRSILRQEKEINVDKLIIPEALKILEKHLVNYTVIGLTKTELADYMLTW
FT                   I"
FT   gene            complement(72659..73333)
FT                   /gene="def3"
FT                   /locus_tag="RC0080"
FT   CDS_pept        complement(72659..73333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def3"
FT                   /locus_tag="RC0080"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02618"
FT                   /db_xref="GOA:Q92JI7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI7"
FT                   /protein_id="AAL02618.1"
FT                   /translation="MSKLKTALLLTAIIFITGCKSNMKNENNISLPQYVTLNIQTLNSS
FT                   EDKTIRIKAKTLNFPLSSEDLRDISILEKKYDQEENCAGLAAPQIGISKCIIIFAVHED
FT                   AELKKWHPDLKDTMPKTIWINPSYKPIGIDKHEDYEGCFSVENATGPVARFKKIHYHAY
FT                   DINGNQIQGIAEGFLARVIQHEIDHLNGKVFLDYVAPKKIMTKEEYLEMRKKAMEQENI
FT                   KS"
FT   gene            73532..75028
FT                   /gene="tlc1"
FT                   /locus_tag="RC0081"
FT   CDS_pept        73532..75028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlc1"
FT                   /locus_tag="RC0081"
FT                   /product="ADP,ATP carrier protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02619"
FT                   /db_xref="GOA:Q92JI6"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI6"
FT                   /protein_id="AAL02619.1"
FT                   /translation="MNNPKNDNYLSELSKVIWPIERYENKKFLPMAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGAEAISFLKTYIVLPSAVIAMVIYVKLCDILKQENVFYVITSFFLGY
FT                   FALFAFVLYPYPDLVHPDPETIESWSVAYPNVKWFIRIVGKWSFASFYTMAELWGTMML
FT                   SLLFWQFANQITKTDEAKRFYSMFGLLANLALPVTSVIIGYCLHEKTQIVAEHLKFVPL
FT                   FVIMITSSFLVILTYRWMNKNVLTDPRLYDPALVKEKKAKAKMSLIDSFKMIFTSKYVG
FT                   YIALLLIAYGVSVNLVEGVWKSKVKELYPTKEAYTIYMGKFQFYQGWVAIAFMLIGSNI
FT                   LRKVSWLTAAMITPLMMLITGAAFFAFIFFDSVIAMHLTGILASGPLALAVMIGMIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRFGKSGGAIIQSTFFILFPAF
FT                   GFVEATPYFASIFFVIVILWIYAVKGLNKEYKVLVNKTEK"
FT   gene            75225..76520
FT                   /gene="glpT"
FT                   /locus_tag="RC0082"
FT   CDS_pept        75225..76520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="RC0082"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02620"
FT                   /db_xref="GOA:Q92JI5"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JI5"
FT                   /protein_id="AAL02620.1"
FT                   /translation="MTNTRSKIKTPRSPYVKKYNSWRVRILYSIIIGYATFYFCRQNFN
FT                   IATPAIREYFGVTKTQIGWILTASSIMYGVSKACNGFISDKVNARIFMVLGLLFVGIIT
FT                   MLIGFSDSLWLIGILWIASNWFQSMGWPPATKMLTHWFASKELGTKWAMGATSNQIGGA
FT                   LAMISCGYLIDKFDWRAAFFVPGVVACVVSLFLYNRLRNSPKEVGLSTVEEYKEYPLEA
FT                   IGDYEKLLTPQLLKMVFCNKLIWYVCLANMFVYIIRSGVIYWAPTFLKDLRNISLANAG
FT                   LQIGLYEMIGIPGALIAGVLSDKLFQGRRGPVASICMVLLSLLLVLFWKLPIHSELLSI
FT                   VILSLIGFFVSGPQLLVGIAAADFSTRQAVGTANGLSGLFGYLGAAIAGVGVGWISDNY
FT                   GWNGVFIFFSISALLGGGLFALIWNRSAKKYI"
FT   gene            76545..76967
FT                   /gene="ndk"
FT                   /locus_tag="RC0083"
FT   CDS_pept        76545..76967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="RC0083"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02621"
FT                   /db_xref="GOA:Q92JI4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI4"
FT                   /protein_id="AAL02621.1"
FT                   /translation="MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKY
FT                   EAACFYDEHRARPFFNSLVEYITSGAVVLQVLKGEDAITLNRTVMGATNPAEAEAGTIR
FT                   KDLGESIEANSIHGSDSENSAKREIEFFFNKSEIIE"
FT   gene            76971..78839
FT                   /gene="gidA"
FT                   /locus_tag="RC0084"
FT   CDS_pept        76971..78839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="RC0084"
FT                   /product="glucose inhibited division protein A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02622"
FT                   /db_xref="GOA:Q92JI3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI3"
FT                   /protein_id="AAL02622.1"
FT                   /translation="MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKKA
FT                   MYQILTNYPNLDILYGKVEDIEIKSSKIEAVILNNGSKILCQKIILTTGTFLSGLIHIG
FT                   QKKIPAGRVDEEPSYGLSNTLKQIGFKLARLKTGTPPRIDGRTIDYSKTILQPGDKIPR
FT                   PFSELTNIVNVSQINCFITKTTSETHDIIRENLDKSAMYSGQIEGIGPRYCPSIEDKIV
FT                   RFSTKSEHRIFLEPEGLDDYTIYPNGISTSLPEDVQHKLIKTIPGLENVKVLRPGYAIE
FT                   YDYVDPREISVTLETKKIAGLYLAGQINGTTGYEEAAGQGIIAGINAALAVKDQAPFML
FT                   TRANSYIGVMIDDLTTFGTIEPYRMFTSRSEYRLSLRADNSDLRLTELGMNIGVVSEKR
FT                   KKIFTKKCEDIEKIKSLLNTLSLSTSKLAKMGIQVAQDGTYKTVLDLFKIPNFNVEQAI
FT                   KIFPMLKETQNNNILQLLYIEAKYASYLTRQHADINLFQSEEAQFIPKNIDYFKIPSIS
FT                   LEIQEKLSSHKPTTIGVARRIPGITPAAITAIIIYLKTKYSDGSST"
FT   gene            78820..79398
FT                   /gene="gidB"
FT                   /locus_tag="RC0085"
FT   CDS_pept        78820..79398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RC0085"
FT                   /product="glucose inhibited division protein B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02623"
FT                   /db_xref="GOA:Q92JI2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI2"
FT                   /protein_id="AAL02623.1"
FT                   /translation="MMEVPREIIEKLEIFQKLVKKWNKSINLVSDNTIHNFWQRHILDS
FT                   LQLIQYIDNKEIHLVDIGSGSGLPGIVLSIAGVAQVSLIEADLRKCIFLEKASKISNNN
FT                   IQIINQRIEKVEIDCSILTCRAFSNLNTIFNCIKNISVREKFLLLKGKNYLTEIVEAKE
FT                   RWLFGYLIHQSITCEEGKILEVSNLTKMI"
FT   gene            79395..80162
FT                   /gene="soj"
FT                   /locus_tag="RC0086"
FT   CDS_pept        79395..80162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="RC0086"
FT                   /product="soj protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02624"
FT                   /db_xref="GOA:Q92JI1"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JI1"
FT                   /protein_id="AAL02624.1"
FT                   /translation="MKVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSS
FT                   TGFGISQQQRKNTIYQVLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDRE
FT                   YILMKLLAEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKT
FT                   IEIVEKKLNPKIKIAGILFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAP
FT                   SYGKPAIIYDYKCSGAVAYIELTKEILERYGEK"
FT   gene            80149..81009
FT                   /gene="spo0J"
FT                   /locus_tag="RC0087"
FT   CDS_pept        80149..81009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0J"
FT                   /locus_tag="RC0087"
FT                   /product="stage 0 sporulation protein J"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02625"
FT                   /db_xref="GOA:Q92JI0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JI0"
FT                   /protein_id="AAL02625.1"
FT                   /translation="MAKNKGLGRGLSSLLGEEVISIESEIVQIINIDKIRPNENQPRKN
FT                   FEYDKIKELADSILNNGLLQPIIVDNNFQIIAGERRWRACKLAKVLEIPVIIKNLDARE
FT                   SMEIALIENIQRTDLTVMEEARGFKYLIENFNYTAEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKVNENILSMGQARCLINHEHAEVIADYIINNDLNVRQTEELVRQWYKNEYTKSP
FT                   NNNNKIGKRFLKDNATDNDLELLVKALSEKFGIKITIENYPLGGKLIFHYKDLEELDLI
FT                   LLKLN"
FT   gene            81267..82934
FT                   /gene="abcT1"
FT                   /locus_tag="RC0088"
FT   CDS_pept        81267..82934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT1"
FT                   /locus_tag="RC0088"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02626"
FT                   /db_xref="GOA:Q92JH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JH9"
FT                   /protein_id="AAL02626.1"
FT                   /translation="MSYQYVYEMVGLSKIINGKRILKETNLSFLPKAKIGIIGPNGAGK
FT                   STLLKIMAGIDKEFEGKATAKIGIKVGYLPQEPYLDASKNVFDNIIEGLHEKKKLIDEF
FT                   NYISNKFAAEIADEEMQKLFDKQAELQEKIDNCDGWNLEREIEIAMLALRCPAKEADIT
FT                   KISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLEDYLKHYEGTVIVITHDRY
FT                   FLDNVTEWILEIDRGNCIPWESNYSSWLEQKQKKLALESKEDDDRKKQLNRELEWIRQT
FT                   PKARQSKNKARITAYQELLNKQQEQKTDPTQIIIPNGPRLGDFVIEAEHIAKKFNNKIL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKSTLFNIITGKIMPDSGSIKIGQTVKLGYVDQSRDH
FT                   LDDNKTIWEEISEGLDELQLGNRIIKSRAYCAAFNFRGGDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIDTLRALEDAILDFAGCVLVISHDRWFLDRITTHIISYD
FT                   KENNATWFEGNYQDYHEYMLSTNGESILNPKYKHKKLI"
FT   gene            82937..83254
FT                   /locus_tag="RC0089"
FT   CDS_pept        82937..83254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0089"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02627"
FT                   /db_xref="GOA:Q92JH8"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH8"
FT                   /protein_id="AAL02627.1"
FT                   /translation="MSLTQILLILFVGILVTTPHDIFIIIKELKKIKAYLINIKSSIVK
FT                   NIDEPLETEQVNFYLKKIINLEGYYHGSYDLTTIKEKYYTLIINNDLIENESVPDITEK
FT                   H"
FT   gene            83290..84114
FT                   /gene="kdsA"
FT                   /locus_tag="RC0090"
FT   CDS_pept        83290..84114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="RC0090"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02628"
FT                   /db_xref="GOA:Q92JH7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH7"
FT                   /protein_id="AAL02628.1"
FT                   /translation="MQKVVKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTS
FT                   KLEIPFIYKSSFDKANRTSVHGIRGVGIEKGLEILSKVKSEFDCPIVTDVHSESQCTET
FT                   AEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGVKDIL
FT                   FTERGACFGYNNLVSDMRSLAIMAELNVPVVFDATHSVQQPGGLGGSTGGERKYVELLA
FT                   KAATSVGIAGIYMEVHQDPDNAPSDGPCMMKLDNLESILIKLKKYDKITKEK"
FT   gene            84596..85135
FT                   /locus_tag="RC0091"
FT   CDS_pept        84596..85135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0091"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH6"
FT                   /protein_id="AAL02629.1"
FT                   /translation="MLLEAIKYFKVSLSIDPIEECSFILREIFNIPKNKKEVEKYLSLK
FT                   KDLYISLEEFLFKLNLIPLAAFEYLKAASIASPQEEQKLLLKVHKVYSTEMEENTVFIR
FT                   SMLDKGKMEDLSIVTKEADRTKFLSDTQTIINDFVSLPELQAKEWPEVQQNQNEQLTNN
FT                   QQEVNKCQLIQDIGIG"
FT   gene            85273..85491
FT                   /locus_tag="RC0092"
FT   CDS_pept        85273..85491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0092"
FT                   /product="cation efflux system protein-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02630"
FT                   /db_xref="GOA:Q92JH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JH5"
FT                   /protein_id="AAL02630.1"
FT                   /translation="MVCDDLIRQSQGLKILSTEQCKGQGLNLRKSQAETLKQSLIVLNK
FT                   SKNNMFILTLDSNASDNEEDKDNNVNK"
FT   gene            complement(85658..85990)
FT                   /gene="hesB1"
FT                   /locus_tag="RC0093"
FT   CDS_pept        complement(85658..85990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hesB1"
FT                   /locus_tag="RC0093"
FT                   /product="hesB protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02631"
FT                   /db_xref="GOA:Q92JH4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JH4"
FT                   /protein_id="AAL02631.1"
FT                   /translation="MTITITDRAFERVCELVKLEKDKNLVLRISVDSGGCSGLMYNYEL
FT                   VSKDNIEQDDYVITKHNATIIIDPISQKFILDCTLDFIEELGSSYFNVSNPQAKAKCGC
FT                   GNSFSV"
FT   repeat_region   86075..86173
FT                   /note="REP01, repeated element"
FT   gene            86219..87373
FT                   /gene="dgtP"
FT                   /locus_tag="RC0094"
FT   CDS_pept        86219..87373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgtP"
FT                   /locus_tag="RC0094"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02632"
FT                   /db_xref="GOA:Q92JH3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH3"
FT                   /protein_id="AAL02632.1"
FT                   /translation="MLASYASDPLKSRGRLYKEIPTSYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEGDHYRNRLTHSLEVSTVARSVASTLNLSNDLAETIALAHDLGHTPFGHA
FT                   GERALNECMREYNGFSHNAQSLKILTLLEKRYAAYNGVNLTWEVLEGIVKHNGPILGEI
FT                   NEYIAEYNKQNDLELSTYASAEAQIAALADDISYISHDLEDSIGAKIIDFHSLAELKYI
FT                   DQHVVELKSKFKNISSSCLIYEVVRKLIHELITDLLWQTKENLNKEKITNIDEIRNLNY
FT                   QIVDFTEKTNKNIKETKKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNW
FT                   KMLIDSNETYSKARVVADYIAGMTDRFAIQEYNQLCSTSYITCF"
FT   repeat_region   complement(87348..87455)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            87487..89217
FT                   /gene="argS"
FT                   /locus_tag="RC0095"
FT   CDS_pept        87487..89217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="RC0095"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02633"
FT                   /db_xref="GOA:Q92JH2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH2"
FT                   /protein_id="AAL02633.1"
FT                   /translation="MNIFNQLKQDIIVASRQLYNNQEIANTATIEIPKDSFNGDLSSNI
FT                   AMIIAAKESIAPREVALKFKEVLITLPYIASIEIAGPGFINFTIKADSWQASIKDILQH
FT                   EEKFFEIDIDKSRNINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVSYSVTKEYYV
FT                   NDAGSQINDLVSTVLLRYKEALGEQITIPAGLYPGEYLIPLGQILAKEYGNKLLTMNYA
FT                   ERFKIIKSFAVEKMLDLNRKDLADLGIKHDIFFSEQSLHDKGEIEETVKLLERMGLIYE
FT                   GTLPAPKGKIHEEWDNRVQKLFKSTKYGDSQDRPIEKADGSWSYFASDLAYAKDKIERG
FT                   ANHLIYVLGADHSGYVKRIEAIVKALGKEQVKVDVKICQLVNFVENGVPVKMSKRLGSF
FT                   ASVQDVNHEVGKDIIRFMMLTRQNDKPLDFDLVKVKEQSRENPIFYVQYAHVRTISILS
FT                   KAKELMPESYNNFESGKYDLSLLSSEEEIEIIKLLASWTKTLEASAKYFEPHRIAFYLI
FT                   NLASKFHSMWNFGKENSDYRFVIESNKELTLARLALASAIQKVIASGLEVIGVEPMNKM
FT                   "
FT   repeat_region   89270..89337
FT                   /note="REP01, repeated element"
FT   gene            89390..90064
FT                   /locus_tag="RC0096"
FT   CDS_pept        89390..90064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0096"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02634"
FT                   /db_xref="GOA:Q92JH1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH1"
FT                   /protein_id="AAL02634.1"
FT                   /translation="MINNIFIKIFLVFLVCMSAIYFGYQYYQNSKPVITIYPDELPTKI
FT                   KPSIIENNQIAAVHSTIYENLIAKDTNIKTVKLLPDPEKPMSIDSRNQSQSDESFDEIS
FT                   NLIALIEPNNNAKNETDLNIIKLEKGSKDKVSNAKNCKNNESYKVQLGSVKSEAEAMKE
FT                   GERIKKQFPKILKNVVITTKKVKYDDGKFFYLILAGDYGSLSQAKAVCKKLAYNKQSCV
FT                   LK"
FT   repeat_region   complement(90079..90198)
FT                   /note="REP02, RS3-like repeat"
FT   gene            90242..92458
FT                   /gene="parC"
FT                   /locus_tag="RC0097"
FT   CDS_pept        90242..92458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="RC0097"
FT                   /product="topoisomerase IV subunit A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02635"
FT                   /db_xref="GOA:Q92JH0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JH0"
FT                   /protein_id="AAL02635.1"
FT                   /translation="MKEAKVENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALIHLINHPKAEINDIINFVKGPDFPTGGIII
FT                   DKAEVINAAYTTGRGSLRVRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLVSNIRDESTDIIRLVIEPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNILEILQEFLYHRQNIVTRRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREE
FT                   DEPKAIMMEWFKLTEIQVEAILNTRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPK
FT                   ELWKIVKKEIKTVQTKFGLNTVIGARRTSFEEVTLTNQVVDITAFITKEPITIICSKMG
FT                   WVRSLKGHNTDLSTIKYKEGDAEKFILEAYTTDKILIVSSEGRFFTLLADNISKGKGTG
FT                   ESIKLLVDIGNNDITNILVYKPDQLLLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDG
FT                   HVCIACLPVNGDSIACIGESRKLLVFNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKE
FT                   DGLGWNNNGKVKLEKNIVAFLGKRGSTGKLPPMGFPKNNRFSSY"
FT   gene            complement(93159..94475)
FT                   /locus_tag="RC0098"
FT   CDS_pept        complement(93159..94475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0098"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02636"
FT                   /db_xref="GOA:Q92JG9"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG9"
FT                   /protein_id="AAL02636.1"
FT                   /translation="MKKLLLAASIICLASAGLAEENPTPVISNSDTEIKLEGFYLFENG
FT                   YVKQDHLILFDKNVTDNRKKLGFYTEAAFAATIAKTINDVIAGAKIVLQPTTRAKTSTN
FT                   YNGSHIFIETSYGKVELGSPADASAKLRITGSQVTAGTGGWSRYALLDGQYMRYNGLKS
FT                   DFDTNASFYLESYSNSFDQINDKAERARRLNFFTPKMKGFQAGVSYTPDTANTGGNRDI
FT                   NNLTLASSGRNGVSVSKTGIKTVKLENNETMTINQNIRDAFSAGLTYEHEISEDADLKL
FT                   SVTGEYGKPARRLIHAKMDGTTIQVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGNLGK
FT                   SLTAKEYYKVGRDTYYYNGAVAYGQGPIKTSLEYLKTSRYKNTVDAVSLATEYKIMPGL
FT                   LPYAEISHFQAKGKPVYYPEAPSKTTRGTVGLIGTKLKF"
FT   gene            94755..95327
FT                   /gene="dcd"
FT                   /locus_tag="RC0099"
FT   CDS_pept        94755..95327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="RC0099"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02637"
FT                   /db_xref="GOA:Q92JG8"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG8"
FT                   /protein_id="AAL02637.1"
FT                   /translation="MIMAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSY
FT                   GYDARVSNEFKIFTNINSTTVDPKNFSEYNLVDREVDVCIIPPNSFALGRTIEYFKIPR
FT                   DVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLK
FT                   SDQICDTSYADRQGKYMKQVGVTLPLT"
FT   gene            95373..95831
FT                   /gene="secB"
FT                   /locus_tag="RC0100"
FT   CDS_pept        95373..95831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RC0100"
FT                   /product="protein-export protein secB"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02638"
FT                   /db_xref="GOA:Q92JG7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG7"
FT                   /protein_id="AAL02638.1"
FT                   /translation="MSTINTDTNETMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQI
FT                   DLSLDINITNLSEENFYEVELNIEAIARNEKYKLFQIELKYAGVFNLINIDSEQHPVLL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            96056..96769
FT                   /gene="czcR"
FT                   /locus_tag="RC0101"
FT   CDS_pept        96056..96769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcR"
FT                   /locus_tag="RC0101"
FT                   /product="transcriptional activator protein czcR"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02639"
FT                   /db_xref="GOA:Q92JG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JG6"
FT                   /protein_id="AAL02639.1"
FT                   /translation="MRVLLIEGEPEMANLIELTLASEGIVCDKASVGVEGLRLGKVGGY
FT                   DLVILDLMLPDINGFEILLRLRAAKIKTPILILSSLTDTYQKITGFSSGADDYLTKPFV
FT                   REELIARIKAIVRRSKGHAASVFRFDKVSINLDTRSVEVDGKKVHLTNKEYAILELLIL
FT                   RRGTILTKEMFLNHLYSSVDEPEMKIIDVFICKLRKKLSDAAGGRDYIDTVWGRGYMLK
FT                   EYDELQQKEILAQGA"
FT   gene            96773..97594
FT                   /locus_tag="RC0102"
FT   CDS_pept        96773..97594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0102"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02640"
FT                   /db_xref="GOA:Q92JG5"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG5"
FT                   /protein_id="AAL02640.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDVTLLFKIPRINNRNELGINSNNLPFY
FT                   GVDVWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESVKEL
FT                   ERIILQDLSNVTHAKVTGRIFPINTKVEFGVPSGKNIDDLDIVCNNYGAPDNSLIEYED
FT                   VLVEEEINSHLLKSNCLVTGQPDWGTIVIKYKGKKLKYDSFLKYLISFRNCNEFAEQCA
FT                   ERIFTDIKNAISPDFLSIYIVYARRGGIDICPYRSTDKSYTLPSDKRFIRQ"
FT   repeat_region   complement(97668..97691)
FT                   /note="REP03, repeated element"
FT   repeat_region   97738..97757
FT                   /note="REP03, repeated element"
FT   gene            complement(97903..98463)
FT                   /locus_tag="RC0103"
FT   CDS_pept        complement(97903..98463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0103"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02641"
FT                   /db_xref="GOA:Q92JG4"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JG4"
FT                   /protein_id="AAL02641.1"
FT                   /translation="MNSQKTLPLLPKATAIWLIENTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAQSIKGLNPIANGQLTLEEIERCSKDPNANLQISYSPAYELMKNQKKKRAKYTPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLIGTTKITIDAIRTRSHWNMNSIRPRDPVLLGI
FT                   CSQIDLNKIVESLKPPQNPTKES"
FT   gene            complement(98518..99915)
FT                   /gene="pntB"
FT                   /locus_tag="RC0104"
FT   CDS_pept        complement(98518..99915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="RC0104"
FT                   /product="NAD(p) transhydrogenase subunit beta"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02642"
FT                   /db_xref="GOA:Q92JG3"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JG3"
FT                   /protein_id="AAL02642.1"
FT                   /translation="MSLQIIQLLYLVAAVCFILSLKFLSSQKQARLGSTIGILGMAIAV
FT                   IVTFFLPDFTHKLPIIATILLGAVIGGIIALKISMTAMPQLVAGFHSFVGLAAVFVAYA
FT                   TVLAPENFSIGIAGSLPINALIEISVGVSIGALTFSGSIIAFLKLQGLMKSSPLKFYGQ
FT                   QYICLLTAIILVILVISFIRSENIFLFNLIVFLSLLIGVLLIIPVGSADMPVIVSMLNS
FT                   YSGFAAAGIGFTLSNSLLIITGALVGSSGAILSYIMCKAMNRSLIKVIFGAFLPAPTGI
FT                   NKDIDDDKIAKTSCPEDAAHLLLNTSSVIIVPGYGMAVAQSQHIIKEMVDILERSDINV
FT                   RFAVHPVAGRMPGHMNVLLAEANIDYEKVLELEEINRDFATTDVVLVIGANDVTNPAAK
FT                   NDPNSPIYGMPVLDVEKARTILFIKRSMASGYAGIKNALFYHDNTFMLFGDAKKVVEEI
FT                   VKFLNED"
FT   repeat_region   complement(99949..99985)
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(99992..100027)
FT                   /note="REP03, repeated element"
FT   gene            complement(100056..100790)
FT                   /locus_tag="RC0105"
FT   CDS_pept        complement(100056..100790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0105"
FT                   /product="hypothetical outer-membrane protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02643"
FT                   /db_xref="GOA:Q92JG2"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG2"
FT                   /protein_id="AAL02643.1"
FT                   /translation="MLRIVKKLGIILFVSTISINSFAKSMYDDVDSASDYDSTPYYENE
FT                   GSLVFKMRLGGVVSSAKQKGLPTPTSPQPVSVGEVAKNGYGGDASTTIFFNNYLATELS
FT                   LGFNVLRTKYTSLAAVAHNYGVDNVKLGKHKPIYMIPATITGQFHIAPYGGIRPYIGIG
FT                   YHGSYMLTQATGLKIRNGHGAVGQIGVDFYAKDDTLINIDVRQFFLNPKLEYKPNLVGN
FT                   KTMTSKVKLNPLIVSIGIGFTF"
FT   gene            100945..101829
FT                   /locus_tag="RC0106"
FT   CDS_pept        100945..101829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0106"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02644"
FT                   /db_xref="GOA:Q92JG1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JG1"
FT                   /protein_id="AAL02644.1"
FT                   /translation="MNDALKTYLTGIGWFLLSLVSSSANDVISKYLGTRLHSFEVAFFR
FT                   FFFSSIVLLPFVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLTIAPVTTATVVSF
FT                   SIPLFTLILAVFFLNENIIWPRWVVTVVGFIGLVVTLKPHAEDFNPEILYFVLAAISFA
FT                   MLDIINKKFVIKESMISMLFYSAIVTAIVSLPVASQYWLTPSSFELALLFVLGSSGSLI
FT                   LFFLLKAFSMVDATATAPYRYLELVISVIAAYFIFNEFPDKSTLHGAVIIIPTTLFIIY
FT                   SEKKAMNRKHESQ"
FT   gene            101816..103072
FT                   /gene="proP1"
FT                   /locus_tag="RC0107"
FT   CDS_pept        101816..103072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP1"
FT                   /locus_tag="RC0107"
FT                   /product="proline/betaine transporter"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02645"
FT                   /db_xref="GOA:Q92JG0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JG0"
FT                   /protein_id="AAL02645.1"
FT                   /translation="MNRSKLVFSSGIANTFEWYDYVLFGYFAPIIGTKFFPNDDANTSL
FT                   LQVFLVFAIGYLARPLGGIFFGVIGDRFGRKVALTSALFCMSAPTVLIGILPTYHTIGI
FT                   TATILMICVRILQGLSMGGVLTGSISFVIEHTSHKHQGFTGSISMSSICSGLLLGSFVS
FT                   YIVKNILTASQFDSFGWRIPFLLGFFILFAAFYIKKNTHETPNFKNLKEQKKILQSPLK
FT                   KVITNYWFDILISIFINAPGSIIFYLTTIYLVSFLKISRNFTENEVNSLASVCYVIMIA
FT                   VTLLSGYLSDIIGRRKIFVINLIIIIVTTPFLLNNFENGAFTSVIISQLILAILAASYI
FT                   GPEPALQAELYPTNIRNTALSISYNTATSIFGGTTPLVFEYLVHKTGHVTSAVYYVILS
FT                   CIFALIALFFYKNRSLDKI"
FT   gene            103353..103538
FT                   /locus_tag="RC0108"
FT   CDS_pept        103353..103538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0108"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF9"
FT                   /protein_id="AAL02646.1"
FT                   /translation="MAMRLVTAEEIPKLHKLVQDNKMILACQTKEKTLKILSDYLQKEF
FT                   GMHANETTIASYDGYI"
FT   gene            103652..103723
FT                   /locus_tag="RCRNA03"
FT   tRNA            103652..103723
FT                   /locus_tag="RCRNA03"
FT                   /product="tRNA-Thr"
FT   gene            103905..104207
FT                   /gene="secG"
FT                   /locus_tag="RC0109"
FT   CDS_pept        103905..104207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RC0109"
FT                   /product="protein-export membrane protein secG"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02647"
FT                   /db_xref="GOA:Q92JF8"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF8"
FT                   /protein_id="AAL02647.1"
FT                   /translation="MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAK
FT                   TVGNFLTKSTIILTTLFLINAIVLANLSSKKKSDLVSKINEIEENQAENSLPIAK"
FT   repeat_region   complement(104292..104317)
FT                   /note="REP03, repeated element"
FT   repeat_region   104332..104362
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(105109..110496)
FT                   /gene="sca2"
FT                   /locus_tag="RC0110"
FT   CDS_pept        complement(105109..110496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca2"
FT                   /locus_tag="RC0110"
FT                   /product="190 kD antigen precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02648"
FT                   /db_xref="GOA:Q92JF7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="PDB:4J7O"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF7"
FT                   /protein_id="AAL02648.1"
FT                   /translation="MNLQNSHSKKYVLTFFMSTCLLTSSFLSTSARAASFKDLVSKTPA
FT                   WEKHNSTQQQNIWKDLTPNEKIKKWQEAALVPSFTQAQNDLGIKYKETDLSSFLDNTRH
FT                   KARQARAEILLYIERVKQQDFDTKKQAYINQGVVPTDIEAATNLGISYDPSKIDNNVEH
FT                   DQKVRRAEKDKKAVIELYVSSINRGIKYKHYVDNDIIPEIQEVRTALNMNKDDAQSFVA
FT                   SIRTEIMENAKGQYIADSHIPTEKELKKKFGISRDDNRDGYIKSIRLKVMDKEKPQYIA
FT                   DSHIPTEKELEQKFGADKGEATNYIASIATQMMLDKKSYYIDNNIIPNADELMNEFKIG
FT                   PVKATSYINQIRAGIEANQFLNNNDTTKPSTGRSQKKSGSKNDHWYMSNQSINNTGTSA
FT                   RIVTGREKKQRYFFDPISTFKTYFNTKASKGNLTQSQHNINRIIQQEENIEEFKNLIKT
FT                   DPIAALTLQVDSSYKQEAVTTILSDFNDDTIQRVLFSNDKGKLDFNTNIDVKNRPILQE
FT                   LLENSSSEEKTKFAERIQDYATRNISNSQFEEKARLDLIKLAASKDKSSVENFLTLQLE
FT                   LKNRMQPYVVNSVYILTPEIVKEINIELKNKGLIRDSLTKDYMIKLAKEVNNHTLNSVI
FT                   KVILSDSKILSNETNKILGLAVSNNANNLEQTQSGIPNPPPLPLNGGIPNPPPLPLNGS
FT                   MPPPPLHSQGFSSNSKHFDLNQLQTEYPHIHSLYVQFTHNTTVQSKAPLQPTASSATST
FT                   GRSTPETAYAKLYAEYRTETGGTKANDLQDQLIKRQADLTNVIRQILTESYANQGADEK
FT                   TLLNLFSISTPEIAEKAKEAFNTLAQDQYIKDITVNGKKTITSEEIIKNLFNEDTDDAI
FT                   KRILLSSCKISEELKRPIKLEFNKSELIRELQGKQNPFKQLEFAYINTKNFDQDIFGNR
FT                   IDELINNPNILTIVQQATFLTKEDTNLRKTINSDQAQAKLDDLRTAILSTIKIEELITA
FT                   NLPQHDFIAIVKEKDPELLKEFLKATTLTVTGNNNLDQLRLALPSFTGMSNEQIRILSN
FT                   KLKMSIILKALKECSQEKATQYIHTGNMPPPPPPPPPLPDSQDLELAYLKSLGITKANT
FT                   STFKTTPKTYHFSSDIALRYKEFTLSGQKSAGYKAKYSDADLLKKAIVESVAFEHSKNL
FT                   SKAHQNNKYFEQIQKAVNTMYSSFIGHRTELEQKIHNIYTSKLLELTKDKEFIKYVEDN
FT                   IILNKKLTKAFTSADSDFIDSRTELEQKIHNIYIQQLTKYPEEEVKEAFNTASLDFIGP
FT                   RTEIGQEVHNIYKSQLLELTKDTELCLFTQQVLAEATELEQKYGSDIQSENSNNEKKVE
FT                   RLDQEKLQLFKQENEATNDESSTKDDTQPEDSNKKSEQSDSKTALSPRLLSSNDSKNDK
FT                   SSDDKKSLLALRSSDEDDTGYATDEEELEESNSTTDEELKKDVVLESEDEAIDVSFKTE
FT                   AITEQDEVTQRQQVSDDTSGKVAILVQATSTLHKPVHYNINDRLTVAAIGAGDEETSIN
FT                   RGVWISGLYGINKQRIWKNIPKYQNRTTGITIGTDAEFINSHDVIGIAYSRLESQIKYN
FT                   KKLGKTTVNGHLLSIYSLKELIKGFSLQTITSYGHNYIKNRSKNINNIIGKYQNNSLSF
FT                   QTLLNYKYRTKYDLHFIPNIGFQYDYSRASNYKEYNVDIENLMIQKKSNQLFESSLGGK
FT                   IVFKPIVTTNNIVLTPSLYGNIEHHFNNKNTKVNAKATFKGQTLQETIITLKQPKLGYN
FT                   IGSNILMSRKNINVLLEYNYYTHRKYQSHQGLIKLKVNL"
FT   gene            110730..112109
FT                   /gene="cysS"
FT                   /locus_tag="RC0111"
FT   CDS_pept        110730..112109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RC0111"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02649"
FT                   /db_xref="GOA:Q92JF6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF6"
FT                   /protein_id="AAL02649.1"
FT                   /translation="MQIQFHLYNTLSRTKEVFNPQDQANVKMYVCGPTVYYNPHIGNSR
FT                   SGVVYDLLYRIVIKIFGEKAVKYVRNITDVDDKIIDRAALLGVTIDELTDKVTKEFHKN
FT                   MAYLGCMLPSIEPKATKHIDVMIAIIERLIAKDHAYIADNHVYFDVLSAPNYTELSNRN
FT                   LEEMFEGVHVENSKTKKNPQDFVLWKPAKQNESANMNFESPWGLGRPGWHIECSAMSYK
FT                   YLGENFDIHGGGADLIFPHHTNEIAQSRCAFPSSTYAKYWVHNGFLTVNGEKMSKSLGN
FT                   FITVRDLMDKQIQGEVVRLFLLSSHYRRPLDYNDKAIEDAKKTLDYWYRAIENINVQKI
FT                   DLPHDFMQSLLDDMNTPLAVKIINDYAKGVFISKTEEERQLNASAIITCANFIGLMNKT
FT                   PHEWFNSGVDELYVNELVNKRLEAKKQKNWLLADQIRNQLLEEKIILEDRPDGTTIWRK
FT                   E"
FT   repeat_region   complement(112160..112202)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(112208..112251)
FT                   /note="REP01, repeated element"
FT   gene            112356..113243
FT                   /gene="rpsB"
FT                   /locus_tag="RC0112"
FT   CDS_pept        112356..113243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="RC0112"
FT                   /product="30S ribosomal protein S2"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02650"
FT                   /db_xref="GOA:Q92JF5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF5"
FT                   /protein_id="AAL02650.1"
FT                   /translation="MSKIPSVNIKALLDAGVHFGHKTSRWNPKMASYIYGERDDVHIID
FT                   LRQSVALMSVALNAIYETVKKDGKILFVSTKIQASDIIAEYAEKCGQYYVNHRWLGGML
FT                   TNWKTIAGSIEKLNKLDKTLENEEALMGYTKKEILNMSRKKDKLLLSLAGIRNLNSKPD
FT                   LLVVIDTNKEHIAINEAVKLNVPIVAVVDTNSNPDNVDYPIPGNDDSIRAIRLYCSLFA
FT                   DAALQGLEESMKASGVDMGAMQEHTDKGLTSKNVSKLKQTKKFSKTKNIDEETNTEFEQ
FT                   ALNDADENKNSDNA"
FT   repeat_region   113272..113320
FT                   /note="REP03, repeated element"
FT   repeat_region   113322..113341
FT                   /note="REP03, repeated element"
FT   gene            113440..114369
FT                   /gene="tsf"
FT                   /locus_tag="RC0113"
FT   CDS_pept        113440..114369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="RC0113"
FT                   /product="elongation factor EF-Ts"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02651"
FT                   /db_xref="GOA:Q92JF4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF4"
FT                   /protein_id="AAL02651.1"
FT                   /translation="MSEINISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRK
FT                   KGLAAAAKKAGRIASEGLTAAKVDGLTGVVIEVNSETDFVARNEQFQDLVKDIANLAVI
FT                   AKTIDTLKTFKMQSGKSVEEEIIENIATIGENLTLRRMDILEISEGAIGSYVHNEVVPN
FT                   LGKISVLVGLASNAKDKAKLEALAKQIAVHVAGNNPQSIDDSSLDQALVERERKVFFEK
FT                   SKEEGKPDNIIAKMVEGRIRKFFSEVVLLQQNFLFEPKLTVAEVIKNAEKELGAEIKIA
FT                   KFIRYELGEGIEHEEKNFADEVAAITQG"
FT   repeat_region   114462..114490
FT                   /note="REP03, repeated element"
FT   repeat_region   114516..114557
FT                   /note="REP03, repeated element"
FT   gene            114842..115168
FT                   /locus_tag="RC0114"
FT   CDS_pept        114842..115168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0114"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02652"
FT                   /db_xref="GOA:Q92JF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JF3"
FT                   /protein_id="AAL02652.1"
FT                   /translation="MSRTQEEYAAQIYVAEEHRRRQANYSDNDAELLEVIIVCAGYACY
FT                   KAVEGAVKVTVTGSKIIENAYKIGSGQIAVLGTDAESKITYITKLFYLSILRLEVIRVL
FT                   PLSR"
FT   gene            115165..115353
FT                   /locus_tag="RC0115"
FT   CDS_pept        115165..115353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0115"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF2"
FT                   /protein_id="AAL02653.1"
FT                   /translation="MTTNRVDPLEQTSPNTPTSKREKAKIYGKKLVDSAKIGAKTLSNA
FT                   YKVTIGTIEVVGPGSDF"
FT   gene            115343..115534
FT                   /locus_tag="RC0116"
FT   CDS_pept        115343..115534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0116"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JF1"
FT                   /protein_id="AAL02654.1"
FT                   /translation="MIFNSTGKEKFIFSEPTKLKVVQKEFKTENGYKCGIVLEETIEAS
FT                   LTLRLNNKRIVRLKNLEA"
FT   gene            115531..115749
FT                   /locus_tag="RC0117"
FT   CDS_pept        115531..115749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0117"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02655"
FT                   /db_xref="GOA:Q92JF0"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JF0"
FT                   /protein_id="AAL02655.1"
FT                   /translation="MIVPDTTEDTGETFEISLILKYSDGANMPKADPAFLKIHYGRDGK
FT                   LNKLSLPNPPIILHNQWYPALTVYKGE"
FT   gene            complement(115894..117288)
FT                   /gene="kdtA"
FT                   /locus_tag="RC0118"
FT   CDS_pept        complement(115894..117288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="RC0118"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02656"
FT                   /db_xref="GOA:Q92JE9"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JE9"
FT                   /protein_id="AAL02656.1"
FT                   /translation="MMLLYYALSFILLPVYFIIILIRLLIGKEDIRRIQERFAIGKHRQ
FT                   DDSLDFMQTSANKEEFKGDTSLRTTTYTLIREDEGLGSTYKLPLEASDARRLIWINAAS
FT                   IGESMVALTLIHNISKRYPDVRFLVTSWTNSSAKILTAKLPKIAVHQFLPIDNIIFTRK
FT                   FLRNWQPDLGIFIESELWPCTINEGAKQCKLLLVNARISDKSFKAWLQRKSFFQLILKN
FT                   CSKIIVQSERDLQKFNELGVSDAVNLGNIKFANEKLPVNQEELSKLSLHLDNKRVVLFA
FT                   STHPEDEEVILPIIKNLKEQFLDCYIILIPRHPERVKSIIDNCKSHNLSATAKSQNDLP
FT                   VLSDDLYIVDRFGEMGLFFSVATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTD
FT                   IAKGVLQNEAAIQIKNGEDLLTKLTYLLRSNNALELTTYRENALKFIKDNQKVLDEYLN
FT                   VITKFL"
FT   repeat_region   complement(116999..117142)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(117285..117941)
FT                   /locus_tag="RC0119"
FT   CDS_pept        complement(117285..117941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0119"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02657"
FT                   /db_xref="GOA:Q92JE8"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE8"
FT                   /protein_id="AAL02657.1"
FT                   /translation="MRKVFKKFLKNNKYVLSIITILLYWYLRFVYFTSKQKFIFYDNGN
FT                   KEKFLNEQGVIFAFWHNMLALSPSMFIGHKNIYALISPHLDGKILNDLVGKFGCRVIVG
FT                   STNKNPIGALRNIIGKLSQGANIIVTPDGPKGPVYKVNSGITEIAYRYNTKLITIVSST
FT                   SRCFRLKSWDKLIIPLPFGTIKIIVGSPLELTNDKIQNHISLEQQLASLTESLKK"
FT   repeat_region   complement(117980..118025)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(118037..118069)
FT                   /note="REP01, repeated element"
FT   gene            complement(118092..119297)
FT                   /gene="aatA"
FT                   /locus_tag="RC0120"
FT   CDS_pept        complement(118092..119297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="RC0120"
FT                   /product="aspartate aminotransferase A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02658"
FT                   /db_xref="GOA:Q92JE7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JE7"
FT                   /protein_id="AAL02658.1"
FT                   /translation="MSIISTRLSSIKPSPTLAVVKKTLELKKAGVDIITLGAGEPDFDT
FT                   PDNIKEGAIKAIKDGFTKYTNVEGMPLLKQAIKDKFKRENNIDYELDEIIVSTGGKQVI
FT                   YNLFMASLDQGDEVIIPAPYWVSYPDMVALSTGTPVFVNCGIENNFKLSAEALERSITD
FT                   KTKWLIINSPSNPTGASYNFEELENIAKVLRKYSHVNVMSDDIYEHITFDDFKFYTLAQ
FT                   IAPDLKKRIFTVNGVSKAYSMTGWRIGYGAGSKTLIKAMTIIQSQSTSNPCSISQMAAI
FT                   EALNGPQDYIKPNALNCQKKRDLALSILKRVKYFECYKPEGAFYLFVKCDKIFGHKTKS
FT                   GTIIANSNDFAEYLLEEAKVAVVPGIAFGLEGYFRISYATSMEELEKACIRIEKTIDVI
FT                   PA"
FT   gene            complement(119619..119813)
FT                   /locus_tag="RC0121"
FT   CDS_pept        complement(119619..119813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0121"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02659"
FT                   /db_xref="GOA:Q92JE6"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE6"
FT                   /protein_id="AAL02659.1"
FT                   /translation="MNSISGTSFRKNLSSVLNTVENDHVPYLIKRKNHKNIILLTEEEY
FT                   ESTKETLYLLSNLGLMRIE"
FT   gene            119956..120960
FT                   /locus_tag="RC0122"
FT   CDS_pept        119956..120960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0122"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02660"
FT                   /db_xref="GOA:Q92JE5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE5"
FT                   /protein_id="AAL02660.1"
FT                   /translation="MLGKIKDKIKHYCLTIINVPNFIKNKILEFKNYISDCKYKFSHLT
FT                   ETNYQLGLDHLYRGNLNDALLRFKLVDKFFNPNDSKVYSQLGWVYFLKNNYRQAIEYLE
FT                   KSNEKYKPIFINFLKNYKDITEIPQEICGKYRDLTAQYYPTIFNNDKNIHLPYRFVNEA
FT                   LKQISDLPDNYSILELGSNIGLVGYEIQKRFPERLTLTGVEVSALMNKLQATYYPNTKI
FT                   YDQIYNIAIDEFLKQNSNKFDIIFSFCGLSFTNNLIEYFNLIYSSLNKQGYFALCLPNA
FT                   TKTQFSVKRKEFIFNLNEINNFLQKNNFTILTSEEIILAENNKYSIIVCKKTA"
FT   gene            120938..121720
FT                   /gene="vacJ"
FT                   /locus_tag="RC0123"
FT   CDS_pept        120938..121720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacJ"
FT                   /locus_tag="RC0123"
FT                   /product="vacJ lipoprotein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02661"
FT                   /db_xref="GOA:Q92JE4"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JE4"
FT                   /protein_id="AAL02661.1"
FT                   /translation="MFVRKQHKSMRILIILSIILCSLSIRADLEYVDNEIYNYNGGSNE
FT                   NGCVEVYDPYEKFNRKVFVFNSVLDYIILRPLAVGYKNITNDYVKARVNSFVSNVDTPL
FT                   TAINYGLQLNYDKTMKSVWRFLINTTLGIGGLFDVAGKVGLPSDRQTFGSTLAHYGVAP
FT                   GPYLVLPIIGSTNARDMTDSVITNYALNPLMYYTHNDFDLGVLAVSKINDRYVVLPFSD
FT                   YVMKNSTDPYVAIRSALHRVREASVQYPENFKCPKPKN"
FT   gene            121632..122339
FT                   /locus_tag="RC0124"
FT   CDS_pept        121632..122339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0124"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02662"
FT                   /db_xref="GOA:Q92JE3"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE3"
FT                   /protein_id="AAL02662.1"
FT                   /translation="MWLLDQHYIVFVKHRFNILKILNVLNPRINEIKEDYMQKIITGLF
FT                   LLVMTFYAYSNEKVPAGLNSYVTNLVNEASSILNDSKLSERVKIAKARELMSQNLDFDW
FT                   MAKYTLGRNGIKTLSGGQVQEFIKVYSKYVTKSYTDLIKDYKGKQPKIVGVRPLSSTDF
FT                   MVAMNIISNKEQDPIKVEYLVREMKGNGKDVFKVSDIITEGVSLIGAQQDEFTDTLKNQ
FT                   GFKALIQKLESRS"
FT   repeat_region   complement(122403..122501)
FT                   /note="REP01, repeated element"
FT   gene            122822..123172
FT                   /locus_tag="RC0125"
FT   CDS_pept        122822..123172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0125"
FT                   /product="ribose-phosphate pyrophosphokinase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02663"
FT                   /db_xref="GOA:Q92JE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE2"
FT                   /protein_id="AAL02663.1"
FT                   /translation="MPYFGYARQDNINSQNIIPAKLIADFLEKLGVNHVITIDLHSDKI
FT                   EQFFNIPVSNLEPINLYIPFLSTYSNFVIVTPDKGSINRVQKISNLLNIDSAYINKERD
FT                   INNNCEIDINHK"
FT   gene            123153..123320
FT                   /locus_tag="RC0126"
FT   CDS_pept        123153..123320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0126"
FT                   /product="ribose-phosphate pyrophosphokinase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02664"
FT                   /protein_id="AAL02664.1"
FT                   /translation="MISITSSVEGKNCMLIDDIIDSGETIVKAARFLKEHSALSVSAFI
FT                   THAVFSAGRF"
FT   gene            123292..123516
FT                   /locus_tag="RC0127"
FT   CDS_pept        123292..123516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0127"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02665"
FT                   /db_xref="GOA:Q92JE0"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JE0"
FT                   /protein_id="AAL02665.1"
FT                   /translation="MQCFLPAGSKNSIIDLLENEANKEEFVGNTERSIAAYTLVREDAS
FT                   TGLTYKLPLEASYARGLIDNIFITDTRNK"
FT   repeat_region   123333..123476
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            123583..124650
FT                   /gene="alr"
FT                   /locus_tag="RC0128"
FT   CDS_pept        123583..124650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="RC0128"
FT                   /product="alanine racemase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02666"
FT                   /db_xref="GOA:Q92JD9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD9"
FT                   /protein_id="AAL02666.1"
FT                   /translation="MSLCTVEINLSTIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQI
FT                   SKALIEENCRHFFVASSEEGVNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNL
FT                   KQIEIWQKFSNLKNRLLPCYLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHL
FT                   AISEEIDNPYNLEQLNRFKAYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLN
FT                   PLTKNPVTLKAPIIHLQNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSNQGE
FT                   VFINSRSVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYE
FT                   VLTNLGSRYKRKYIG"
FT   repeat_region   complement(124657..124693)
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(124705..124736)
FT                   /note="REP03, repeated element"
FT   repeat_region   124744..124775
FT                   /note="REP02, RS3-like repeat"
FT   gene            124807..125586
FT                   /locus_tag="RC0129"
FT   CDS_pept        124807..125586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0129"
FT                   /product="ABC transporter permease protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02667"
FT                   /db_xref="GOA:Q92JD8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD8"
FT                   /protein_id="AAL02667.1"
FT                   /translation="MLFNIANSVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLII
FT                   RQLLFIGFHSLPVVAMTTFFSGAVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLA
FT                   GLMVAGRVGASIAAEIATMRVTEQIDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGD
FT                   IIGVMGGYLVGVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV"
FT   repeat_region   complement(125588..125613)
FT                   /note="REP04, repeated element"
FT   repeat_region   complement(125636..125665)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   repeat_region   125690..125711
FT                   /note="REP04, repeated element"
FT   gene            125739..126494
FT                   /gene="mkl"
FT                   /locus_tag="RC0130"
FT   CDS_pept        125739..126494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="RC0130"
FT                   /product="ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02668"
FT                   /db_xref="GOA:Q92JD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JD7"
FT                   /protein_id="AAL02668.1"
FT                   /translation="MSVEEFKIKIRSLYKSFANHKVLDGIDLDVKKGSSLVILGGSGSG
FT                   KSVLIKNIVGLIKPDKGKIFIDNVEIQDISSKQKFEIMDGIGFLFQGGALFDSLNIRDN
FT                   ITFETKKLSKKEKNDLAGAKLNAVGLSPRILELYPAELSGGMQKRVALARAICSTPSIL
FT                   FLDEPTTGLDPVMANVINELIIKIQEELEATTITITHDMISAAKIAKEVAMIYQGKIKW
FT                   YGSKDEMRNSDNPYLKQFINGLTTGPIEV"
FT   gene            126496..126744
FT                   /locus_tag="RC0131"
FT   CDS_pept        126496..126744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0131"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02669"
FT                   /db_xref="GOA:Q92JD6"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD6"
FT                   /protein_id="AAL02669.1"
FT                   /translation="MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIF
FT                   SPAKFRIIVIGTMLGLSCAYFTYKYIVPIFISLLNGP"
FT   gene            complement(126803..127030)
FT                   /locus_tag="RC0132"
FT   CDS_pept        complement(126803..127030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0132"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD5"
FT                   /protein_id="AAL02670.1"
FT                   /translation="MIEQDLIKVRIIGGNDSPESSKYLEDIRTTLNGIDNNTNMINIIG
FT                   LDACKNIHPNSFELDGYHGGVRALDCRILN"
FT   gene            complement(127305..127601)
FT                   /locus_tag="RC0133"
FT   CDS_pept        complement(127305..127601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0133"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD4"
FT                   /protein_id="AAL02671.1"
FT                   /translation="MNLKDQEQTKIVNNLIAKTDYLLSNNLNPLESVRSEINKTLALTH
FT                   STYQQDSNIKKSWIQKSVQKIKDLFINIFSSNKTKNEPKLNLTSDKILKKYKY"
FT   gene            complement(127873..128370)
FT                   /locus_tag="RC0134"
FT   CDS_pept        complement(127873..128370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0134"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02672"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD3"
FT                   /protein_id="AAL02672.1"
FT                   /translation="MARLALGAAYKTQNRKENSIAQYAYSYSLQQGIVDYEAVRVEQHK
FT                   VGFSDQEKIGTDNIQQCVAVILHDPLTKKTALAHVDRFTYAGSLTHDVISNFPPNTQLE
FT                   AYLVGGRDRSAVSISVSDGNIRKVTQELTNHFNVNIKSADIEDKGAPLGIIFDPITSNC
FT                   SG"
FT   gene            complement(128370..128753)
FT                   /locus_tag="RC0135"
FT   CDS_pept        complement(128370..128753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0135"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02673"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD2"
FT                   /protein_id="AAL02673.1"
FT                   /translation="MPSSFPEYISNLNPKPLSTKEQIDHNQAAFCIMKDLNYIDNHLVA
FT                   LKQLQQAEQIAIGQTDSNFLSYINAMIGRSYQQLGLFDNAIQQFQDSIENSFEAKQYYN
FT                   VENSYKELVTAHQPQGTLAKLKN"
FT   repeat_region   complement(128954..129070)
FT                   /note="REP04, repeated element"
FT   gene            129131..129424
FT                   /gene="rpmB"
FT                   /locus_tag="RC0136"
FT   CDS_pept        129131..129424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RC0136"
FT                   /product="50S ribosomal protein L28"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02674"
FT                   /db_xref="GOA:Q92JD1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD1"
FT                   /protein_id="AAL02674.1"
FT                   /translation="MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAG
FT                   EYRLSVNARCISSVEKAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKSL"
FT   gene            129421..129657
FT                   /gene="rpmE"
FT                   /locus_tag="RC0137"
FT   CDS_pept        129421..129657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="RC0137"
FT                   /product="50S ribosomal protein L31"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02675"
FT                   /db_xref="GOA:Q92JD0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JD0"
FT                   /protein_id="AAL02675.1"
FT                   /translation="MKSSIHPEYKKFLIKVGSDVFETMSTHPTGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFGSKKEAS"
FT   repeat_region   complement(129681..129720)
FT                   /note="REP01, repeated element"
FT   gene            129858..129931
FT                   /locus_tag="RCRNA04"
FT   tRNA            129858..129931
FT                   /locus_tag="RCRNA04"
FT                   /product="tRNA-Met"
FT                   /note="fMet"
FT   gene            130197..130907
FT                   /locus_tag="RC0138"
FT   CDS_pept        130197..130907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0138"
FT                   /product="hypothetical GTP-binding protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02676"
FT                   /db_xref="GOA:Q92JC9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC9"
FT                   /protein_id="AAL02676.1"
FT                   /translation="MPSRNDDLIFTQAMPYLHPIRKQIMTTQKIVPTKSTDGSKLFRHQ
FT                   AKFVAGAMNINQILNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINF
FT                   FNLADKLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRGIKEND
FT                   KKVADLLLANKREFQIIFTKSDKVTDHKNLHDEAQNFLATLNYSCNVMYVSNRSKEGAR
FT                   ELKASLAKCIKPQK"
FT   gene            130855..131778
FT                   /gene="argB"
FT                   /locus_tag="RC0139"
FT   CDS_pept        130855..131778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="RC0139"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02677"
FT                   /db_xref="GOA:Q92JC8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JC8"
FT                   /protein_id="AAL02677.1"
FT                   /translation="MQENLKLVWQNASNLKNKEVDSISSLNNIAIIKNIIKCSSELKNQ
FT                   AIVLKLPATIIIDDKLFTAFIESVRLLEMCGAKIYIVHDHIDLRSSSLISQIDENFSQK
FT                   ISKISDYSSLNNPIIMEILSSYVNKLIVTKLSSIGCYAVGISGKDANLLQAKKSKLSYR
FT                   KIVNHDVINIGFLSEPIMINPEILLNFADNNIIPVIAPFASDDQEKTHLLNVNLTLATI
FT                   ASALSAEHLILPYEILQVSETFPYNIKIRDINLLKSMLDDSNNFIEEALIKIAVNALEN
FT                   NNGYVHFVNSEAPNSILSTMFDININ"
FT   gene            131791..132078
FT                   /locus_tag="RC0140"
FT   CDS_pept        131791..132078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0140"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02678"
FT                   /db_xref="GOA:Q92JC7"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JC7"
FT                   /protein_id="AAL02678.1"
FT                   /translation="MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAAALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
FT   gene            132168..134585
FT                   /gene="virB4"
FT                   /locus_tag="RC0141"
FT   CDS_pept        132168..134585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="RC0141"
FT                   /product="virB4 protein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02679"
FT                   /db_xref="GOA:Q92JC6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JC6"
FT                   /protein_id="AAL02679.1"
FT                   /translation="MKLFRTRAAKELRSKQERPTSHFIPYKCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILYKPDTGGVAIVEYFLKKLRQKSNK
FT                   TAWENDMKEMKENLQEMSTRVINTFRSYGARLLGVRQTQSGSYCEILEFLSSLINCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEARSPLGKKYAGMISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFVNRTVAIGKMQLQQNRMIQSGDKATSQIAEINTALDMATSGDIAF
FT                   GEHHLSLLCSANNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVR
FT                   KSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQ
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLAKQDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQKARVFGFDMTELLKDPVSLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSRISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGIDA
FT                   VVAKVSLDGMDNIISVLSGRVETVILLDQIREKHGNDPDKWLPIFYAAVKTL"
FT   gene            134703..137684
FT                   /locus_tag="RC0142"
FT   CDS_pept        134703..137684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0142"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02680"
FT                   /db_xref="GOA:Q92JC5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC5"
FT                   /protein_id="AAL02680.1"
FT                   /translation="MKLFPRSILITLVLSFALNLGIVTKIHAKDTLDSIVDILSGLTCE
FT                   TQGVGDLLRTEFSHTCIVAPFFTFAVMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFP
FT                   GGQCTRENRIDPKNPELRFALCNNAKLIVSRAKSVAESALAIAKAVLTGSDPWDDIKTA
FT                   WANKKKEYHVPYSGKPGDDGFAFDLGFPVIYWKVIQDKDRICVSTKGFTGDVPVGCKYM
FT                   KEPFPKSMYNSFMDVADKDFIEDPNKTPTDPLALVSCSAAGDGCYQKAYNASKTAVVMT
FT                   SPLIECMRQMIARLLISKDVCSFDNVSQVVNLVSRQDSVFFQFQVGMYKIVTAFLTLYV
FT                   MFFGFKLLLAGEVPPKSEYINFILKMIFVTYFSIGINITPGNGSPYDRLDGMIQWAFPF
FT                   LLDGINGLASWVMNAAPSGLCKFNNLSYDGTVSYIALWDALDCRVAHYLGLDILSTLLV
FT                   ENAYRSHDFLNFDFFSFSAPPYIYLLIPAIISGNMMLVSLALSYPLLVISVAAFMVNAT
FT                   IMCMISIVILGILAPLFVPMFLFAYTRNYFESWVKLMISFLLQPMVVVTFMITMFSVYD
FT                   YGFYGKCQYKSKLIHNSIEDKIQGGITSKRDVLIFYINNDWDDTSQYPDKDAVESCQNS
FT                   LGYMLNNPITTVFNFTKDSVSEIVGSKPGSTPTDKFLAKFQFLSGVVLGPGMFFMSPKV
FT                   LFEKIKNILLALVMACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMAV
FT                   LATAGAATKGGDQIASRGGVGDLKAGQGGGASDLEVGKGGLPNDNIAASGGTSAPAVTT
FT                   PTASSSVASSSPKTVSSEARSDVVTPPAPTEAVSPPPASIRTSISTLAPRVGKIIRDNN
FT                   QESKKEIDNTPPSQEKVDNAAPQEKVDSTSKGTGVIDYSFNLKEHDNPTGVKQIRENAE
FT                   IRDKRVKVEKAWNELVARGGGRVREQEGGEISERRANAEKAWDELVKSGVVTEKKDNSS
FT                   NENS"
FT   gene            137671..139656
FT                   /locus_tag="RC0143"
FT   CDS_pept        137671..139656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0143"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02681"
FT                   /db_xref="GOA:Q92JC4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC4"
FT                   /protein_id="AAL02681.1"
FT                   /translation="MKTLKTLKIFIIVFIASVSLASFAGFGESCSSLPTTSDGYLETDT
FT                   AYGYIIRNIDMKDPRGNCNSVASSITFCFKNVEGSSSPCTMYTLNEGDSKKISDLSTDN
FT                   NPDLGANPVLKNIVLTVKKWDNDLCLVMPTSRGPMPVACKSLSATPTPPPSEDKNCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSETLNKIFFAGKSCSAQDQNSRITNLAAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNTEYASTEKIALFVIKFLFVAYFSIGLGPLDFSGGQP
FT                   TKENGMLKYGLPLLTGAAPDFAQMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNRVLGNVVGNGPRGNNTPIPNFDPEGKNDRPKDLSKAGALRFFTV
FT                   MFGFFMAGNVIILAAGLVFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTR
FT                   TKAYFDGWLKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYERGDIRFSTFE
FT                   LRLPVGGADKCQESFGYKMLEYYAGKGWEEHLLILFPIKSIVRDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFASDLTNGPNMDAVTASPTKIVGLVKKGAAFLKDAAMASQGKPLVGD
FT                   KPGVGGKRKEGEQQGGDLASGSGGGK"
FT   gene            139663..142563
FT                   /locus_tag="RC0144"
FT   CDS_pept        139663..142563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0144"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02682"
FT                   /db_xref="GOA:Q92JC3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC3"
FT                   /protein_id="AAL02682.1"
FT                   /translation="MQGNLLKVLGVLAIVATLVCFIFAALGMIGAVKVGDSCYMRYASD
FT                   GQGGADSIIGTITLNANANYVNTAKMLSDGTTLLVPDPTRYGEWLNTQVLVENSQPVNL
FT                   QVVGQVSLCLAYIPKDNLQRTGAGSNLDDNGQMIPIPRINDANNPPVSLIMDAKNNEWR
FT                   NIAELYANDRVLVSVSPNFANTDATVKDAFKGAEVTQDCSENKTTYNPICGKYSVYSGE
FT                   YVNACELKEKYWNCEVTWRCPTWHEQIGCDWGALGCVASCKKIPECTTKCMAWVNITRP
FT                   APENYLDDGSFTFSWSDNTGKLFIDYSALQCSYNANIPPVDKCPDRVRDRRIKDKDYIG
FT                   GVHCTSGICSDGDFQKNRRFWYTADGKGGKGPTGLIYQMNDAGSVSQALPSKLEFAKFV
FT                   ADTDQPPDYKGKDGKYLYKVIYNIPFNSNIAKSYLQYRLWSPTSQDSSKNTGGYVLNIK
FT                   QTKCYRENGNSFNDTFDDRGRVQYIIVKPSENPNTSGKTYSPQGISVDSEGKYSFNANE
FT                   AGYIWMKILNDPGNNLRDYKDSEGSYKVHFSTSLKVGSFTIKVMNPLLQLFKTKVQGAA
FT                   TSIFKNMVCYKANDSSSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQKELVIRIAKI
FT                   GVVSGLMNGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNPFMFLDAVMSK
FT                   IFFSQTFIAQLLALLSLGLSGIIYFIITFIAVCIVIITALRAVAVYIMAFMATCILIGI
FT                   APLFISFLLFDFTRYLFDNWVRFTIRYMMEPVVMMAGIIVLTQLFTIYLDFVLGYSVCW
FT                   KCALPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAYGM
FT                   YGYVEFSGRIVVKLTSAVGPSATEIGGKMSHDAGQKVLSSIGMDDKTRQGITGRAEARL
FT                   KQRNKTLDQAEKNRKNTQKEGGEKTNEEPPKPETPK"
FT   repeat_region   complement(142581..142673)
FT                   /note="REP01, repeated element"
FT   gene            142737..145412
FT                   /locus_tag="RC0145"
FT   CDS_pept        142737..145412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0145"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02683"
FT                   /db_xref="GOA:Q92JC2"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC2"
FT                   /protein_id="AAL02683.1"
FT                   /translation="MKILKSLVLLVLFMAMPAKADDAFSWMSTSFGGLKSLFGCLEVPE
FT                   FTSFQEGNIGISLSTAGIWQSTGNTVQKGKLLKINWSTSGITLEPRKYLVLYRIDPRFS
FT                   MPQVFIKTYNYSKLQFEALGFPRFVTDNNSETPGTIPPDKDLDALSFTKMSDFVKYFNY
FT                   SNGNSRIEVKAGDVVNISLVGKDNFFSPNTLKLPNTVDNILTQELDSSIFAASALYTQS
FT                   NLGDFDNRIIYSSAEQVCNMIDKERKSVCSGTGTATKYKNTDNGVIVGKPMITGAVQYF
FT                   MGLIKACPANAGINTSPACYYDQGRGMIIKVGGQVIKGQDQSFVNSGSTQSSFIYYQAT
FT                   SGGIMDFTSDWQVSNMFSNSVLMNDWSRNFSNYASFVDYINKNDWSANFLYFGCYSMIV
FT                   EIGNGANLINPDDQQNIKLEYLITSDGTLPDPSVRGMPVDYNFATDAPQDGYLWLRVVN
FT                   PNSNIQGVVSVNYANYTGTTWFSDIIYNGAIKPITDQFRTFSQNFYIKLVKNSAVQNLA
FT                   KTALTLYVTIFGLMFVTGALKLTAVEVITRICKIAIVAFLIREESWSFFNTYFFSAFTD
FT                   GIDFFVTNVVGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIY
FT                   SLITYFRAILEVIIGYVIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQ
FT                   PTILLIFFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLGIPIHFSFTLPFLPGI
FT                   PFYVPDVPEISSSNILTNNANTFLVLFTTALLFYSYCLMSYSLVTFVNIVVGMLTNVTP
FT                   ARISGNYQERSDPVGAVMQDIDSVTKPIKKAAMAPARVFKDKIIDQNYKARKAEVGGEF
FT                   TNKFLAERNDVKKEEGEKKE"
FT   repeat_region   complement(145430..145528)
FT                   /note="REP01, repeated element"
FT   gene            145565..149026
FT                   /locus_tag="RC0146"
FT   CDS_pept        145565..149026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0146"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02684"
FT                   /db_xref="GOA:Q92JC1"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JC1"
FT                   /protein_id="AAL02684.1"
FT                   /translation="MNKNIFITLLISLLLLSGCTGDTCIDPDDFGFIKFNVSARYDPEE
FT                   ITSRQEGNQVAPWRDSAYKVNGYPLTIMVRPWSYILGDKNTSGQLSAWCPWYGQKNNTT
FT                   TLAAFCVKLQPCTFWDNTRLDMCTPNPANQNDAMISNAPCIMTNGVGLYFLIAAKNTDP
FT                   NISPDSQSKPQGITQHLGEELTSGYEFYSTSSTGQFSKAGGINYQYKGEDKSKYAQSPL
FT                   YFKIIDKFYNDNSGQYRLVIKSGVTDTRADPLQFLTDLIKGVLFGKDGIIKKTYQQIID
FT                   TSGYRMSVSAILTLYIMFTGFSFLIGNINLTHVELIVRILKVSIVSILLSTDKAWTFFH
FT                   DYLFVFFIDGVQQILQIINEASATGPGSQSLLGLLISPQTLSKLFSLLFVDWLGFIYII
FT                   LYLIALYFIFFLIFKATIIYLTALITIGMIIIMGPIFICFMLFNITRSLFENWLRQLIS
FT                   YALQPIILFTGIAFISMIIRTEIYSTLGFAVCKHDFPNLGPINEIFGSFLEDIDPSLGH
FT                   SIFYWWFPVPMKGGINNFHKANILVPKDHIVVDDSCKNDPDKCKHCAAYECIDERYIEL
FT                   PFLDLVKDAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGTSGNLTE
FT                   IQKVNQQSYESAAKQMNRPLNYVAKTVSAPVTSRVSAGKEQVRMFFAEKFENMMMGRLE
FT                   KQALGSSANKTVQNEVKRKYGIDSKDVKMNAITDYENGIAGLLKNLPKGNELKAKELSQ
FT                   MKFTQLRDKIAANKYGVKDYAALSKEQKAELDKSLKDANLRELASDANFTRDYQDAYKN
FT                   AHQEMSGRGVGLFGKNIGVLRSWQEIKHRVDTKRKLKEEKRVGIGEKIYAGYTGIKRGV
FT                   LTAIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKLKDDEKAREHEELQMHINKEA
FT                   LAAQADILSPEYLARLEKAGRHSDVEYYQELAQRKLIHEVHGRLFEEGEPVMMGDRFMR
FT                   EKATDSQMRDMIDNAHRKHAEFIDGDRYIRRQEHYDIMHEKAQENLEQTYKELKDHFKR
FT                   DDIKIEEMPALIAQKVKDTAEGAEIDQKITEELNNFNADVKNYEYSTEVLNKIEDRKQA
FT                   ITDEVNAQIDKINKYRENAKMQTYVKPIVNEGRKLRKLEDHLRNMK"
FT   repeat_region   149306..149427
FT                   /note="REP02, RS3-like repeat"
FT   gene            149960..150427
FT                   /locus_tag="RC0147"
FT   CDS_pept        149960..150427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0147"
FT                   /product="phosphate acetyltransferase (Pta)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02685"
FT                   /db_xref="GOA:Q92JC0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JC0"
FT                   /protein_id="AAL02685.1"
FT                   /translation="MVVATFPKPFIITDAAINIRPTLEDKRDIVQNAIDLMHMIREDTQ
FT                   VRVAVLSVVETVTSAIPTTLDAAALSQMVDRGQITNAIVDGPLAFDNAISLFAAEAKCI
FT                   SSSVSGNADILVVPDLESGNMLAKQLKYLGQAVMAYGGYRSWSPCSYYFNK"
FT   gene            150702..150935
FT                   /locus_tag="RC0148"
FT   CDS_pept        150702..150935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0148"
FT                   /product="acetate kinase (AckA)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02686"
FT                   /db_xref="GOA:Q92JB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JB9"
FT                   /protein_id="AAL02686.1"
FT                   /translation="MIIDLFEDWWKKQQNLKLIATGRRIVHGEKIFNKLVIINEKVSED
FT                   LRPLIPLKVPCINLIICRYWLYFFKNIKKSHI"
FT   gene            150866..151117
FT                   /locus_tag="RC0149"
FT   CDS_pept        150866..151117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0149"
FT                   /product="acetate kinase (AckA)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02687"
FT                   /db_xref="GOA:Q92JB8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JB8"
FT                   /protein_id="AAL02687.1"
FT                   /translation="MHQPYNLQVLALFLQKYKEISHIACFDTSFHFTNPPITKVFGLPK
FT                   KYYDKGIIRYGFQGLSYKYVSSHFNEMTKEDLPTKRLL"
FT   gene            151180..151548
FT                   /locus_tag="RC0150"
FT   CDS_pept        151180..151548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0150"
FT                   /product="acetate kinase (AckA)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02688"
FT                   /db_xref="GOA:Q92JB7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JB7"
FT                   /protein_id="AAL02688.1"
FT                   /translation="MGFSVLDGVMMGTRTGNLDPGVVLYLIDHEQMTTKAVTELLYKKS
FT                   GLLGMSSESSDMRTLLASNSPDAKFAIDLFVYRIVLEIGKLTAALEGVDCLIFTAGVGQ
FT                   NSTVIREMITEKLFMARH"
FT   gene            152244..152948
FT                   /gene="trmD"
FT                   /locus_tag="RC0151"
FT   CDS_pept        152244..152948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="RC0151"
FT                   /product="tRNA (guanine-n1)-methyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02689"
FT                   /db_xref="GOA:Q92JB6"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB6"
FT                   /protein_id="AAL02689.1"
FT                   /translation="MSILHATILTVFPEMFPGTLGHSLAGQALNKNIWSYDVINIRDFG
FT                   LTKHKNIDDEAYGGGNGLIMRPDVLGSSIDHALALNPNAEMYYPSPRGRVFTQSFAKEM
FT                   LKNKNLIFLCGRYEGIDERVIEEYNVKEISVGDYILSGGEIPTLTILDCLIRLLPGVLM
FT                   NQNTLSSESFEEDGEFKGGLECSLYTRPEIWRGRAVPSVLLSGNHRLINEWKKEQSHMI
FT                   TKLRRPELLKDL"
FT   gene            152966..153382
FT                   /gene="rplS"
FT                   /locus_tag="RC0152"
FT   CDS_pept        152966..153382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="RC0152"
FT                   /product="50S ribosomal protein L19"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02690"
FT                   /db_xref="GOA:Q92JB5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB5"
FT                   /protein_id="AAL02690.1"
FT                   /translation="MNIIDRFEQENISKRTANKKIPDFEAGDTVKVTVKIIDRSIEKDG
FT                   KEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPMVHSIDVVKYGV
FT                   VRRAKLYYLRNRSGKSARIKERHIPIAKTKAAKA"
FT   repeat_region   153446..153544
FT                   /note="REP01, repeated element"
FT   gene            complement(153552..153788)
FT                   /locus_tag="RC0153"
FT   CDS_pept        complement(153552..153788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0153"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02691"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB4"
FT                   /protein_id="AAL02691.1"
FT                   /translation="MSEVVVKEQLEQYISKIERLEQEKADLSQEVKDIFQDASSHGFDV
FT                   KAMKSILKLKKLDKDKLAEQDAMLELYRDTLGI"
FT   gene            153861..154787
FT                   /gene="secF"
FT                   /locus_tag="RC0154"
FT   CDS_pept        153861..154787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="RC0154"
FT                   /product="protein-export membrane protein secF"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02692"
FT                   /db_xref="GOA:Q92JB3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB3"
FT                   /protein_id="AAL02692.1"
FT                   /translation="MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFN
FT                   FGIDFAGGIVIEVRLDQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSSSEENL
FT                   MKNIELIKGFLQSNFPYKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFE
FT                   WYFGLGILIALVHDVILALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENL
FT                   RKYHKKNITEIINLSINETLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAG
FT                   TYSSIFISAPILTMFVNRKFNKKVIER"
FT   repeat_region   154863..154892
FT                   /note="REP01, repeated element"
FT   repeat_region   154893..154925
FT                   /note="REP01, repeated element"
FT   gene            154952..156217
FT                   /gene="nuoF"
FT                   /locus_tag="RC0155"
FT   CDS_pept        154952..156217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="RC0155"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02693"
FT                   /db_xref="GOA:Q92JB2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB2"
FT                   /protein_id="AAL02693.1"
FT                   /translation="MLKEEDKIFTNLHGQQSHDLKSSKKRGDWENTKALLDKGRDFIVE
FT                   EVKKSGLRGRGGAGFSTGMKWSFMPKNLEKSCYLVVNADESEPGTCKDRDILRFEPHKL
FT                   IEGCLLASFAIGANNCYIYIRGEFYNEASNIQRALDEAYKEGLIGKNSCGSGFDCNIYL
FT                   HRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILR
FT                   RGASWFAGIGKPNNTGTKIFCISGHVNKPCNVEEAMGISLKELIEKYAGGVRGGWDNLK
FT                   AIIPGGSSVPLLPKSLCEVDMDFDSLRTAGSGLGTGGIIVMDQSTDIIYAIARLSKFYM
FT                   HESCGQCTPCREGTGWMWRVMMRLVKGNVKKSEIDELLNVTKEIEGHTICALGDAAAWP
FT                   IQGLIRHFRSEIEARIKSDSVV"
FT   repeat_region   156249..156289
FT                   /note="REP01, repeated element"
FT   repeat_region   156296..156370
FT                   /note="REP01, repeated element"
FT   gene            156401..157201
FT                   /gene="lepB"
FT                   /locus_tag="RC0156"
FT   CDS_pept        156401..157201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="RC0156"
FT                   /product="signal peptidase I"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02694"
FT                   /db_xref="GOA:Q92JB1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB1"
FT                   /protein_id="AAL02694.1"
FT                   /translation="MQTDNTKSNTNKTAKQEWGSFAFVICIALLIRILIMEPFNVPTGS
FT                   MKATILENDYIFSTKYSYGYSNYSLSFFDFIPLFKGRIFAREPDRGDIVVFRPPNDMSV
FT                   RYIKRLIGLPGDKIQLIDDVIYINDKKIERTEVGTYISEEGIKYLKFKETLPNGRTYFS
FT                   YKLAPIYGVIYNDRYSNTDVFYVPEGQYFFLGDNRDQSNDSRVNLGFVPFENFIAKAQF
FT                   IWFSTKITWWDNDIGVINLVLKLKPWIESVRLNRIFRNLYNTDA"
FT   gene            157201..157884
FT                   /gene="rnc"
FT                   /locus_tag="RC0157"
FT   CDS_pept        157201..157884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="RC0157"
FT                   /product="ribonuclease III"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02695"
FT                   /db_xref="GOA:Q92JB0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JB0"
FT                   /protein_id="AAL02695.1"
FT                   /translation="MESFEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERL
FT                   EFLGDAVLNLVITEILFRNFANYNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG
FT                   EEVAGGRDNLNNIENATEALIAAIYLDSNIETTHDIIENLWAEFIKVQNLTDYDPKTAL
FT                   QEWAQASDHHLPIYRLIKREGASHSSTFTVLVKVKDYEQTGTGHTIKEAEKNAARSLLH
FT                   RLKND"
FT   gene            157877..158896
FT                   /gene="era"
FT                   /locus_tag="RC0158"
FT   CDS_pept        157877..158896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="RC0158"
FT                   /product="GTP-binding protein Era"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02696"
FT                   /db_xref="GOA:Q92JA9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JA9"
FT                   /protein_id="AAL02696.1"
FT                   /translation="MTNRHLAKFAYREEFKGDTEALAAAVREDASTGSTSQLPLEVQFG
FT                   KMSNQKTVSVCIIGRPNSGKSTLLNRIIGEKLSIVTPKVQTTRSIITGIITLKDTQVIL
FT                   YDTPGIFEPKGSLEKAMVRCAWSSLHSADLVLLIIDSLKSFDDITHNIVDKLRSLNIVP
FT                   IFLLNKIDIESKYLNDIKAFLTENHPDSLLFPISALSGKNIDGLLEYITSKAKISPWLY
FT                   AEDDITDLPMRFIAAEITREQLFLNLQKELPYKLTVQTEKWEDLKDKSVKINQVIVVSR
FT                   ESYKTIILGKNGSKIKEIGAKSRMQMERFFGFPVHLFLFVKVRELWENNQEFYQYMKI"
FT   repeat_region   157886..158020
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   repeat_region   complement(158944..158971)
FT                   /note="REP02, RS3-like repeat"
FT   gene            159014..159487
FT                   /gene="ruvC"
FT                   /locus_tag="RC0159"
FT   CDS_pept        159014..159487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="RC0159"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02697"
FT                   /db_xref="GOA:Q92JA8"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JA8"
FT                   /protein_id="AAL02697.1"
FT                   /translation="MIILGIDPALGSLGWAVVAKETAQLKYLASGIIRTNSKDAIHHRL
FT                   AFINSTLEKVILEYQPNMVAIEETFVNTNSVTSLKLGYARGAIMSLIGRYNLDMREFKP
FT                   NTVKKTVTGYGHAEKDQMLHMIKLLLSGTALITNSDEADAVAIAYTCLVTKNY"
FT   gene            159489..160154
FT                   /locus_tag="RC0160"
FT   CDS_pept        159489..160154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0160"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02698"
FT                   /db_xref="GOA:Q92JA7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JA7"
FT                   /protein_id="AAL02698.1"
FT                   /translation="MNPIIILVAPQMGANIGATARAMKNFGLNELRIVAPRDGWPNEQA
FT                   RSNAVGAVNIIDHAKIFDSLEDSIKDLEYLYATTCIKRAMNKDYVFSQNLPLDYPNSEK
FT                   VGIMFGRENNGLSNEEIAFANKIITINTTEFSSLNIAQAVIIICYELLRNSTPREDIHN
FT                   IQKLATKEEIEHFLVNLFGKLDKAGFFKAPDKKTAMQQSITNIFTRINSLSSPEVQTL"
FT   gene            complement(160162..160770)
FT                   /locus_tag="RC0161"
FT   CDS_pept        complement(160162..160770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0161"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02699"
FT                   /db_xref="GOA:Q92JA6"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JA6"
FT                   /protein_id="AAL02699.1"
FT                   /translation="MAFWLFVLEGITMSVLILILQLSALIFQDQEWLAVISIIENADTL
FT                   LKIDCVRFESTKISSELYKNILKEKKLYMSKINLKLEKFRKAFMTLEDIYLKPTTEDRA
FT                   YIDATIQRFEFTFELAWKFLKEYFSQKGTFLHYPKEVIKEAFVAGIINDESLWIYMLTD
FT                   RSNMISYTYDKKLADEIYNRIRNYVPELKKLLNIIDLKI"
FT   gene            complement(160842..161888)
FT                   /locus_tag="RC0162"
FT   CDS_pept        complement(160842..161888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0162"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02700"
FT                   /db_xref="GOA:Q92JA5"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JA5"
FT                   /protein_id="AAL02700.1"
FT                   /translation="MKIHVLEDDRTGNTHQAIALAEKLTEEYTTIKLEYNCLAKLPNFL
FT                   LKYYPIHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKKKFKDIKLIQIMHPNLPYN
FT                   AFDAVILPYHDQRHCEATKWLKQSQGFFTRLLRQYFVFPRNDDFKNIIPINGAINNVTE
FT                   QFAAANLELQKHYPNLKQFIAVIIGGNNKKFNFHEDEAVLFASLLNKIYTNQKIPFFIS
FT                   FSRRTPHTVKSIIKNNVPSSTIIYYPNEDTGYNPYIAMLSKAKYIISTADSISMCSEAA
FT                   SSGKPLYIFCPPNFNSSKHKIFIKQLVEQKIARIFDKSAIALEEYSYKPLNEAERVAEI
FT                   IKSLIKSW"
FT   repeat_region   complement(161451..161490)
FT                   /note="REP01, repeated element"
FT   gene            complement(161885..162844)
FT                   /gene="mrp"
FT                   /locus_tag="RC0163"
FT   CDS_pept        complement(161885..162844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="RC0163"
FT                   /product="Mrp protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02701"
FT                   /db_xref="GOA:Q92JA4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JA4"
FT                   /protein_id="AAL02701.1"
FT                   /translation="MANLHQRQIIDKIQHITFKDGTFLNEVISDIIIKGNNIGFSIDIS
FT                   GKNKLEAEEIRLKAINKLNEISEVNKITIVFTESKPMEKKVQKPKHFVENVKKIILVAS
FT                   GKGGVGKSTISALIAQQLSLANYRVGIVDADIYGPSIPHIFGINEVPQTKDGRIIPVLA
FT                   QSIEIISIGFFVKDHSAIIWRGPMASKTIYQLLSVTKWDNLDYLIIDMPPGTGDIHLSI
FT                   LENYHLDGVIIVTTPQKISEIDVIRSIDLYQKLNLPILGIIENMSYMLKNNSGGHLSQK
FT                   YNIPLIAQMPITPQIAEACDKSLPLTNLLTLPLEKYLQ"
FT   gene            162950..163990
FT                   /gene="hflK"
FT                   /locus_tag="RC0164"
FT   CDS_pept        162950..163990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="RC0164"
FT                   /product="protease activity modulator HflK"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02702"
FT                   /db_xref="GOA:Q92JA3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JA3"
FT                   /protein_id="AAL02702.1"
FT                   /translation="MLNKKHISILKKSPWKDFDSDKEDNIFTRPRKNQFNFDQFQFPFN
FT                   FNAKTIILAVVAVVALWLASGIYEIKEGEEAAVIRFGRFVRKGYPGLNYHLPAPFEKII
FT                   VEKVKQSRRIEIGYRTNSSLRSGGDNTKNIAGESIMLTGDENIIALNCDVMWHINNLED
FT                   FIFNVQRPAETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNAGV
FT                   MIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAAKIIQEA
FT                   EGYRAEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNKTIINNALLP
FT                   HMAIKP"
FT   repeat_region   163997..164026
FT                   /note="REP02, RS3-like repeat"
FT   gene            164083..164943
FT                   /gene="hflC"
FT                   /locus_tag="RC0165"
FT   CDS_pept        164083..164943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="RC0165"
FT                   /product="hflC protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02703"
FT                   /db_xref="GOA:Q92JA2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q92JA2"
FT                   /protein_id="AAL02703.1"
FT                   /translation="MQQKIYYIIFTIVFGLILISSSLFSVDQRQSAVVFQFGEAIRTIE
FT                   NPGLNIKIPFIQNVEFFDKRLLDVEVEAKELTAADGKRVIVDAYAKFQINNPVMFYKTV
FT                   HDYQGVKIRLTRNLESSMRKVIGKISLSSLLSQERSNVMLNILNQVNGEAKSFGIDVVD
FT                   VRILRADLPKENSAAIYRRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYR
FT                   DAQIIKGDGDEKAAKIYNSAYSVDPEFYKFYRSLLVYKNSLKKENTNFVISPDAEVLKY
FT                   LNLTK"
FT   gene            164972..166507
FT                   /gene="htrA"
FT                   /locus_tag="RC0166"
FT   CDS_pept        164972..166507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="RC0166"
FT                   /product="periplasmic serine protease"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02704"
FT                   /db_xref="GOA:Q92JA1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JA1"
FT                   /protein_id="AAL02704.1"
FT                   /translation="MEYMVNLKIVIVIIVLISSNVVLAKENSRSLKVAAQEENEFTEIN
FT                   SAPLKVSEAARYSFADIVEPLIPAVVNISTIEYVNSKSENAEKDPLQEKVNDFLEKLNI
FT                   PLNLEEVDQTPKSVPLGSGFIIEPNGLIVTNYHVIANVDKINIKLADNTELSAKLIGND
FT                   TKTDLALLKIDSEEPLPFVEFGDSNDARVGDWVIAIGNPFGNLGGTVTSGIISSKGRDI
FT                   DIDTDNIVDNFIQTDAAINNGNSGGPMFNLDQKVIGVNTAIFSPLGTNIGIGFAIPSNT
FT                   AKPIIERLKKDGKVSRGRLGVTIQDLTEDISEGLGLKNTRGVLVAKVQEDGPGDKAGIK
FT                   TGDIIIEFADIPVKNTKKLRVIIADAPIDQEVKVKILRDKKELELPIKITSDNEEVTKD
FT                   STEETNKKEITNKEENNLSITKNNITFGNLTEELRQKYTIPQDKMGIVITNIDEEESSF
FT                   KIGDLITNINQKSIDDISKLEELYENAKKSDKKNILLLIERGSSNMFVPLQVM"
FT   repeat_region   166514..166650
FT                   /note="REP02, RS3-like repeat"
FT   gene            166684..167427
FT                   /locus_tag="RC0167"
FT   CDS_pept        166684..167427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0167"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02705"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92JA0"
FT                   /protein_id="AAL02705.1"
FT                   /translation="MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEG
FT                   FNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDGL
FT                   NVDLFKGEYIEPKDWDEFITQQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPAWVQ
FT                   QNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQG
FT                   ECFVFDDRRAVTDDLSPVERHWLQR"
FT   repeat_region   167456..167489
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   167535..167566
FT                   /note="REP02, RS3-like repeat"
FT   gene            167594..167968
FT                   /gene="sdhC"
FT                   /locus_tag="RC0168"
FT   CDS_pept        167594..167968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="RC0168"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02706"
FT                   /db_xref="GOA:Q92J99"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J99"
FT                   /protein_id="AAL02706.1"
FT                   /translation="MTKTKQEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVS
FT                   ILVWWLILSKYDNNYLQLAECCIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLV
FT                   NITGWCVVVGSVLLTVLLWV"
FT   repeat_region   168008..168081
FT                   /note="REP01, repeated element"
FT   gene            168113..168493
FT                   /gene="sdhD"
FT                   /locus_tag="RC0169"
FT   CDS_pept        168113..168493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="RC0169"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02707"
FT                   /db_xref="GOA:Q92J98"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J98"
FT                   /protein_id="AAL02707.1"
FT                   /translation="MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYF
FT                   TLTNKNNDINIIMLWELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLI
FT                   IIVQLFCIVTIVAFVVALFYKG"
FT   repeat_region   168497..168528
FT                   /note="REP03, repeated element"
FT   gene            168627..170417
FT                   /gene="sdhA"
FT                   /locus_tag="RC0170"
FT   CDS_pept        168627..170417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="RC0170"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02708"
FT                   /db_xref="GOA:Q92J97"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J97"
FT                   /protein_id="AAL02708.1"
FT                   /translation="MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFP
FT                   TRSHTVAAQGGISAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELE
FT                   HYGVPFSRTEEGKIYQRPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKV
FT                   QFFVEYFAIDLLMEDGECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMAIRAGLPLQDMEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYA
FT                   PAAKDLASRDVVSRAMTIEIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRSSALKAAELIKPASPHRSIKEESLEKIINRFDKVRHANGNIL
FT                   VAELRLKMQRTMQSHASVFRTQEVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEAL
FT                   ELDNLLDQALVTVYSAAARKESRGAHAREDYPDRNDEDWMKHTLSSIDEAGKVVLDYKP
FT                   VTLTTLTDEVTAVPPVKRVY"
FT   repeat_region   complement(170428..170460)
FT                   /note="REP02, RS3-like repeat"
FT   gene            170563..171219
FT                   /gene="yqiY"
FT                   /locus_tag="RC0171"
FT   CDS_pept        170563..171219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiY"
FT                   /locus_tag="RC0171"
FT                   /product="amino acid ABC transporter permease protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02709"
FT                   /db_xref="GOA:Q92J96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J96"
FT                   /protein_id="AAL02709.1"
FT                   /translation="MFEYLIKFYPKIFFIVEGTLVTLKYSVIAVIFGLVIGMLLAICKV
FT                   NKNRALRLFANFYTSIFRGTPLLIQLSIIYFASPYIIGIKFSVFMAGAIAFSLNSGAYV
FT                   SEVIRAGINAVDKGQFEAAEALAIPKFLITKDIILPQAVKNIFPSLVNELVNLIKESAI
FT                   ISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN"
FT   gene            171380..171769
FT                   /gene="rpsL"
FT                   /locus_tag="RC0172"
FT   CDS_pept        171380..171769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="RC0172"
FT                   /product="30S ribosomal protein S12"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02710"
FT                   /db_xref="GOA:Q92J95"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J95"
FT                   /protein_id="AAL02710.1"
FT                   /translation="MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKP
FT                   NSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDI
FT                   AGVKGRKQGRSRYGAPRKQVAVTKK"
FT   gene            171796..172278
FT                   /gene="rpsG"
FT                   /locus_tag="RC0173"
FT   CDS_pept        171796..172278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="RC0173"
FT                   /product="30S ribosomal protein S7"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02711"
FT                   /db_xref="GOA:Q92J94"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J94"
FT                   /protein_id="AAL02711.1"
FT                   /translation="MSRRHAAEKRVILPDMKYNSILLSRFINNIMKEGKKALAEKIVYS
FT                   AFNKIEKKHRVDPYQTFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDERRGYALASRWI
FT                   INAASKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKAFSHFSPKKMK"
FT   gene            172290..174389
FT                   /gene="fusA"
FT                   /locus_tag="RC0174"
FT   CDS_pept        172290..174389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="RC0174"
FT                   /product="elongation factor EF-G"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02712"
FT                   /db_xref="GOA:Q92J93"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J93"
FT                   /protein_id="AAL02712.1"
FT                   /translation="MSKINKLEHIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHE
FT                   GGATMDWMEQEQERGITITSAATTCRWQDKIINIIDTPGHVDFTIEVERSLRVLDGAVA
FT                   VFDGVAGVEPQSETVWRQADKYNVPRMCFVNKMDRMGADFYRCVEMLKDRLGAKPLVIQ
FT                   LPVGIEENFKGIIDLIKMKAVIWKDEALGAEYFEEDIPADMKDKAEEYRAKLLDMVVEL
FT                   DDHVMEKYLSGEEVTAEEIKRLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDFLPS
FT                   PIDIGIVKGMEVSTGEEKDFPISVTEPFAALAFKIMNDPFVGSLTFIRIYSGKITSGTT
FT                   VINTVKNKREKIGRMLLMHANNREDVKEASAGDIVALAGLKDTTTGDTLSDIDQQVILE
FT                   RMEFPEPVIELAVEPKSTADQEKMGLALSRLAAEDPSFRVSTDYETGQTVIKGMGELHL
FT                   EIIIDRMRREFKVEANIGAPQVAYRETITKVCEIDYTHKKQSGGAGQFARVKIIFEPLK
FT                   EVKDLKDEDKNKIFVFESKIIGGAVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLV
FT                   DGAFHDVDSSVLAFEIAAKAAFREGMPKGNPKLLEPIMQVEVITPDEYMGDIIGDLNSR
FT                   RGQIQSMDPRGNAQVVTANVPLAEMFGYVNTLRSLSQGRAQFSMIFSHYDQVPSQVADI
FT                   IKAKK"
FT   gene            174538..174610
FT                   /locus_tag="RCRNA05"
FT   tRNA            174538..174610
FT                   /locus_tag="RCRNA05"
FT                   /product="tRNA-Trp"
FT   repeat_region   174659..174771
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            174758..175012
FT                   /gene="secE"
FT                   /locus_tag="RC0175"
FT   CDS_pept        174758..175012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="RC0175"
FT                   /product="preprotein translocase SecE subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02713"
FT                   /db_xref="GOA:Q92J92"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J92"
FT                   /protein_id="AAL02713.1"
FT                   /translation="MPLEVAFCKESNKLPNKNMFKEYKIYKFFEQVKQETYKVVWPTRK
FT                   ELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK"
FT   gene            175028..175606
FT                   /gene="nusG"
FT                   /locus_tag="RC0176"
FT   CDS_pept        175028..175606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="RC0176"
FT                   /product="transcription antitermination protein NusG"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02714"
FT                   /db_xref="GOA:Q92J91"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J91"
FT                   /protein_id="AAL02714.1"
FT                   /translation="MTAQSIDNILSSSEKNVKQWYVVHTASGAEKRIKEDMLRKIAKQN
FT                   MTHFFEDILIPVFGVSEVKRGKNVKVEKKLMPSYILIKMNMTDKSWHLVKNISGVTGFL
FT                   GSKTTPKALTESEIQNIFNNLEAEAKEAKNSKLYEVGEIVTVTDGPFETFMGTVEEIDQ
FT                   EKNRLKVSVAIFGKATPIELNFNQVKKND"
FT   repeat_region   175690..175724
FT                   /note="REP01, repeated element"
FT   repeat_region   175754..175807
FT                   /note="REP01, repeated element"
FT   gene            175877..176314
FT                   /gene="rplK"
FT                   /locus_tag="RC0177"
FT   CDS_pept        175877..176314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="RC0177"
FT                   /product="50S ribosomal protein L11"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02715"
FT                   /db_xref="GOA:Q92J90"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J90"
FT                   /protein_id="AAL02715.1"
FT                   /translation="MSQKAIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFND
FT                   ATQGMEKGIPLPTVITVYEDSSFSFKIKTPPASYFLKKYAKITKGSSATKKEAVVGKVT
FT                   MDDCREIAKLKMPDLNTKNIEAATKIICGSAASMGLEVVGN"
FT   gene            176320..177039
FT                   /gene="rplA"
FT                   /locus_tag="RC0178"
FT   CDS_pept        176320..177039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="RC0178"
FT                   /product="50S ribosomal protein L1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02716"
FT                   /db_xref="GOA:Q92J89"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J89"
FT                   /protein_id="AAL02716.1"
FT                   /translation="MSNKKDVAVKISGGKKIREAREKVKSDTLYNLTNAVERLKSASYV
FT                   KFDPTLEIVMKLGIDSRHSDQMVRGVVNLPAGTGKTVRVAVICKEEREEEAKSAGADLV
FT                   GSTNIIDEIKAGKINFDVCIATPDMMAAIGSVARILGPKGLMPNPKLGTVTLDIKNAIK
FT                   NAKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLKNLNAFIEAVIKAKPAGLKGSYLKAMY
FT                   LSSTMGASVQIDLTSIA"
FT   gene            177150..177659
FT                   /gene="rplJ"
FT                   /locus_tag="RC0179"
FT   CDS_pept        177150..177659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="RC0179"
FT                   /product="50S ribosomal protein L10"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02717"
FT                   /db_xref="GOA:Q92J88"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J88"
FT                   /protein_id="AAL02717.1"
FT                   /translation="MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLRESLKS
FT                   KEAGFKVVKNTLAKIAANQTGLNSIVNLFAGPTAIVYSKEPVEMAKLVVNFAKANDNLK
FT                   IIGGIVDNHVLDEHSIKELSKLPTLNELRGKIVGLLQAPATKVVGVLQAPSSSMARVIQ
FT                   AHASKN"
FT   repeat_region   complement(177683..177804)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            177810..178232
FT                   /gene="rplL"
FT                   /locus_tag="RC0180"
FT   CDS_pept        177810..178232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="RC0180"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02718"
FT                   /db_xref="GOA:Q92J87"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J87"
FT                   /protein_id="AAL02718.1"
FT                   /translation="MLVISQYKKSKKEKIMADLAKIEEQLSSLTLMQAAELVKMLEEKW
FT                   GVSAAAPVAVAAVGAAAPAAEAVAEKTEFEVVLTAAGDKKVEVIKVVKDITGLGLIEAK
FT                   KLVDEAPKPIKSNVKKAEADEIKGKLEAAGAKVELK"
FT   repeat_region   complement(178282..178356)
FT                   /note="REP06, A and T rich repeated element"
FT   repeat_region   complement(178638..178706)
FT                   /note="REP06, A and T rich repeated element"
FT   repeat_region   complement(178929..179040)
FT                   /note="REP06, A and T rich repeated element"
FT   repeat_region   complement(179068..179117)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            179174..183295
FT                   /gene="rpoB"
FT                   /locus_tag="RC0181"
FT   CDS_pept        179174..183295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="RC0181"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02719"
FT                   /db_xref="GOA:Q9RH41"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RH41"
FT                   /protein_id="AAL02719.1"
FT                   /translation="MVSLRDNIEAQPLSHNRRIRKNFGHINLVADIPNLIEIQKNSYEK
FT                   NFLQLNIKDSERKNKGLQSILNSIFPISDSSNIANLEFVKYEFDTPKYDVEECSQRSLS
FT                   YAAPLKVTLRLSIWDIDEDTGTREIKGIKEQEVYMGDIPLMTKNGTFIINGTERVVVSQ
FT                   MHRSPGVFFYHDEGKVHSSGKLLYSARVIPYRGSWLDLEFDAKDVIYFRIDRKRKLYTT
FT                   TLLRAIGMSTEEIIKFYYNSVTYKLVKNKGWAVKFIPQHITAHRLTSDLVDADTGNILL
FT                   KAGQKITPRLAKKYSGEGLNNILVAHETLIGKYLSEDLRDPASDEVLAKIGEMITADML
FT                   NVINDLKIKNVNVLVINPQSGPYIRNTLFADKNQDREAALCDIFRVLRPGEPANIEAAE
FT                   SLFYNLFFDTERYDLSEVGRIKMNSRLELNISEEVTVLTIDDIKNIVRVLVELKDGKGI
FT                   IDDIDHLGNRRVRSVGELIENQFRIGLVRMEKSVIERMSAGDVDTVMPHDLVNSKILVS
FT                   VVKEFFSTSQLSQFMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRIC
FT                   PIETPEGQNIGLINSMATYARINKHGFIESPYRRVKDGCVTDEVVYLSAIEEGKYKIGQ
FT                   ANSKINKDGKLQGEFINCRVEGGNFVMVEPYEVDFIDVTPMQVVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKTDAPFVGTGVEGVVAKDSGASVLALHDGIVEQVDSNRIVIR
FT                   TLEQKVDGSPSVDIYNLLKFQKSNHNTCINQKPLVKVGHYVKKNDIIADGPSTDNGEIA
FT                   LGRNVLVAFLPWNGYNFEDSILISERIVKEDVFTSIHIEEFEVIARDTRLGPEEITRDI
FT                   PNVSEEALRHLDEVGIIYIGAEVKAGDILVGKVTPKSESPITPEEKLLRAIFGEKAFDV
FT                   KDSSLHVPSGVSGTVVEVRVFSRRGVEKDQRAIAIEKQQIEKFAKDRDDELEIIEHFVF
FT                   SWLEKLLVGQVIINGPKQVKVGQTITTEMLKGLSKGQFWQIIVEDANVMNEIEQIKTHY
FT                   DEKKEALDKRFATKVEKLQSGDDLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVIS
FT                   RIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIGQILETHLGWASINLAKKISTLVKEYK
FT                   NKHIGIEQIKKFLIELYGENINSILERPEEEIISFCKKVSKGVHFATPVFDGAKVQDVK
FT                   DMLKLAGQDPSGQVKLIDGRTGEYFDRLVTVGQKYLLKLHHLVDNKIHSRSIGPYSLVT
FT                   QQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDVNGRIKTYDSIVRGENN
FT                   FESGIPESFNVMIKEFRSLCLNVKLEVTSS"
FT   repeat_region   183311..183374
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   183399..183510
FT                   /note="REP04, repeated element"
FT   gene            183553..187671
FT                   /gene="rpoC"
FT                   /locus_tag="RC0182"
FT   CDS_pept        183553..187671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="RC0182"
FT                   /product="DNA-directed RNA polymerase beta prime chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02720"
FT                   /db_xref="GOA:Q9RH40"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RH40"
FT                   /protein_id="AAL02720.1"
FT                   /translation="MSVVNFYGQLSNTQQFDQIRINIASPDQVRSWSFGEVTKPETINY
FT                   RTFKPEKDGLFCARIFGPVKDYECLCGKYKRMKNRGITCEKCGVEVTVSRVRRERMGHI
FT                   ELAAPVAHIWFLKSLPSRISTLLDMTMRDVEKILYFENYVVVDPGLSILQKGELLTEEE
FT                   LQKAKDKYGEDAFTASIGAEVIQQMLKELDFSKLKQELYEELQTTSSEVKKKKLVKRLK
FT                   LVENFLESENKPEWMIMDVLPVIPPEIRPLVMLDGGRFATSDLNELYRRVINRNNRLKK
FT                   LIESKAPDIIVRNEKRMLQEAVDALFDNGRRGRAAKNANKRPFKSLSDMLKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIYSKLELYGIATTIKAAKR
FT                   MVEAEKSEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHIPLSIEAQLEARVFMMSTNNILSPANGRPIIVPDKDIVLGLYYLTLAF
FT                   DNEVGAGMMFSDLAEMEHALYNKFITIHTKIKYRRNQLNAEGKMVPVIIDTTYGRLMVG
FT                   ELLPSNPNIEFKCINKQLTKKDISLVIDLVYRHCGQKATVIFADQLMKLGFKYACSSGI
FT                   SFGMDDMVVPESKSTHINETQLEIKEFEQQYSNGLITYGEKYNKVVDAWSRCTDRVAND
FT                   MMKEIATPPVNDAPNHQKINAIYMMAISGARGSFQQIKQLGGMRGLMTKSNGQIIQTPI
FT                   ISNFKEGLTEFECFNSANGMRKGQIDTALKTASSGYLTRKLVDVAQDCIITEKDCGTDK
FT                   GIEVKSVIEGGEVIVPLAEKILGRTAAIDIFHPVTNDLILNKGELINEAKLEQIESAGF
FT                   DRIMIKSVLTCESTTGICSICYGRDLATGTLVSEGEAIGVIAAQSIGEPGTQLTMRTFH
FT                   IGGAATKGAEVSSVDASYDAKVKIISRNVVINSEERKIVMSRNCELLLLDNNGNEKARH
FT                   KIPYGARLLVDDGDMVIKTQKLAEWDPYTIPIITEKSGKVLFKDMVEGISIRDVTDEAT
FT                   GIPSKVIIESKQYSRGAELRPRIQLLDAKGEVITLSNGLEARYYLPVGAVLSVEDGVQI
FT                   SVGDIIARIPKESTTTKDITGGLPRVAELVEARRPKDHAVIAEIDGRVEFGKDYKSKRR
FT                   IIIHPIDETMSIEYMVPKGKHVVVNEGDFVKKGDLLIDGNPVLQDILKVMGVEVLANYI
FT                   VNEVQAVYRLQGVKIDDKHIEVIIRQMLQKVEVTDSGGTTLLVGEKIDRHEFDEINEKA
FT                   MKNGLKPAEAQLILQGITKASLQTRSFISAASFQETTRVLTEAAIAGKVDKLRGLKENV
FT                   IVGRLVPAGTGYFMDKMRKAAAKLDEENV"
FT   repeat_region   complement(187673..187800)
FT                   /note="REP04, repeated element"
FT   repeat_region   187851..187928
FT                   /note="REP01, repeated element"
FT   repeat_region   187968..187990
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(188079..189239)
FT                   /locus_tag="RC0183"
FT   CDS_pept        complement(188079..189239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0183"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02721"
FT                   /db_xref="GOA:Q92J86"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J86"
FT                   /protein_id="AAL02721.1"
FT                   /translation="MPVYDITSHLIKQKYKMIKASCELNQDMGKIYSLTPHPIRYNCLN
FT                   YLKLLSLPISLAFYITKLCFTANPSWTWIGVNILHEKMGQATAKKILHGLPDEVEPDQN
FT                   IPKIVEYVFRQYEENPTLTPIIEPTFIQKFLAKASNYIPALSRIVKFWNEGGINYSDEI
FT                   QTKRALIDVIYKHIIAKAYEVGKKGGKLEITDVTALFPEINFEEKVNAASANLETEKVE
FT                   VSNEESLISELPVRHLSKPVYREEFKRDTEHSTADIREDASTGSTSKLPLEVKCGKMSI
FT                   DQKHEEATITTNANNSINPLVNLLMLKALHDAIRQEVLKTYVEHCLAEIQISKNQETLE
FT                   NFQYDDSLAKLQLYGNYDNNDTYIFEQPVSYLGQTYEHLTAPIACY"
FT   repeat_region   complement(188400..188534)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            189403..190905
FT                   /gene="pepA"
FT                   /locus_tag="RC0184"
FT   CDS_pept        189403..190905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="RC0184"
FT                   /product="aminopeptidase A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02722"
FT                   /db_xref="GOA:Q92J85"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J85"
FT                   /protein_id="AAL02722.1"
FT                   /translation="MLNVNFVNEESSTNQGLVVFIDEQLKLDSNLIGLDQQHHGLISKT
FT                   IQNKLQFTGKYGQIKVIPSVIKSGEVRYLIIAGLGNEEKLTEAKIEELGGKILQHATGC
FT                   KISTIGLKLTNRISRFTSQTFASLVASGAFLASYRFDKYRTTLKEAEKFAVESIEIFTD
FT                   NSTETAKLFEIKKLIAEAVFFTRDISNEPSNIKTPQVYAERIVDRLEPLGVDVDVIGER
FT                   EMKNLGMGALLGVGQGSQNESKLVVMEYKGGSKDAPTIALVGKGVIFDTGGISLKPSSD
FT                   MHLMRYDMGGSAAVVGTIIAVAGQKLPINIVGVVGLVENMPSGNAQRPGDVVTTMSGQT
FT                   AEVLNTDAEGRLVLADAVWYAQEKFKPKCVIDVATLTGAITIALGNTYAGCFSNNDELA
FT                   DKLIKVGEEVNEKLWRMPLHDEYDAMINSDIADMANIGNVPRAAGSCIAAHFIKRFIKD
FT                   GVDWAHLDIAGVANSNKASALGPKGAVGYGVRLLEKFIKEYT"
FT   repeat_region   190947..190982
FT                   /note="REP01, repeated element"
FT   repeat_region   190993..191037
FT                   /note="REP01, repeated element"
FT   gene            191124..191924
FT                   /locus_tag="RC0185"
FT   CDS_pept        191124..191924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0185"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02723"
FT                   /db_xref="GOA:Q92J84"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J84"
FT                   /protein_id="AAL02723.1"
FT                   /translation="MNTINKPYIFVIGNEKGGAGKTTCSMHLIIALLYQNYSVVSIDTD
FT                   SRQSSLTNYLKNRDLYNKHNPDKPVLVPKHFHISESNVEEQAKSFEPILKNNQDVDYIV
FT                   IDTPGSHTPLSRVVHSYADTIITPINDSFLDLDVIAKVDSKDEIISPSIYSQMIWEQKM
FT                   ERASRDRISIDWVILRNRLSNLDALNKRRVGNVLAKLAKRINFKLAEGFSERVIYRELF
FT                   LQGLTLLDLKTAKYDRAFNSSHVLARQELRNFLDFLGIKAAFKG"
FT   gene            192007..192441
FT                   /locus_tag="RC0186"
FT   CDS_pept        192007..192441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0186"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02724"
FT                   /db_xref="GOA:Q92J83"
FT                   /db_xref="InterPro:IPR021455"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J83"
FT                   /protein_id="AAL02724.1"
FT                   /translation="MSNIAENISKLPEEQEKVNKLVDQYKNLTPEEQKIVDRKLKSHFT
FT                   KEELEQDELKSRMNRIRSNLSKQDQEKLQAGNNSIGEIAKDVLSLVKGIINLVENVAEI
FT                   IKNPKKAIYEWIKGELNQVKPQQQNYQQRPSKPKAAAISR"
FT   gene            192493..194340
FT                   /gene="aspS"
FT                   /locus_tag="RC0187"
FT   CDS_pept        192493..194340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="RC0187"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02725"
FT                   /db_xref="GOA:Q92J82"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J82"
FT                   /protein_id="AAL02725.1"
FT                   /translation="MYIMGKSYNKKIKMHKYRTHNCNELQISDVETEVKLSGWVHRRRD
FT                   HGNLVFIDLRDHYGITQIVFTDQNPQLMEDASRLRYESVITVRGTVVARSEDTINNTLP
FT                   TGHVEVLAVEFSVESAADTLPFVINTEKDAPEESRLKHRFLDLRREKLHNNIILRSQII
FT                   SHIRHLMTASGFTEFQTPILTASSPEGARDFLVPSRMHPGKFYALPQAPQQFKQLLMVS
FT                   GFDRYFQIAPCFRDEDARADRSPGEFYQLDVEMSFVTQEDVFSTIEPVMYDLFTKFTDK
FT                   KVSETPFVCIPYNESMLKYGSDKPDLRNPIIIADVTEIFRDSDFTIFRENIKKGSIVRA
FT                   IPAPKAAALPRSFFDKMIEFAISEGAGGLGYIQFSETGEAKGPVVKFLSPQQLESLKAT
FT                   ASISNGDAVFFASDKKEKAAKLAGKVRIRLGEELDLLEKDCFKFCWITDFPFYELNEET
FT                   GKIDFSHNPFSMPQGGIDALEQAKTTEELLELTAYQYDIVCNGIELSSGAIRNHKPEIM
FT                   YKAFSIAGYSEEEVDKRFGGMIRAFKFGAPPHGGIAPGIDRIVMLLAEATNIREIIAFP
FT                   LNQQAEDLLMNAPSYVEDKALKELSIMLSPSARKNAEKE"
FT   repeat_region   complement(194434..194461)
FT                   /note="REP03, repeated element"
FT   gene            complement(194618..196732)
FT                   /locus_tag="RC0188"
FT   CDS_pept        complement(194618..196732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0188"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J81"
FT                   /protein_id="AAL02726.1"
FT                   /translation="MSKEKTQQELLLQEQLFKALKTNDTELNAKISRTCKGIAESVIDL
FT                   SNDQSPTAESLYISYMALADLNTKDLAKVTTIIKNSFPGDKNKKLREIIDAPLLEHLVM
FT                   IEAIERQVGLDDSRYNADYRKLEEIRNPNDPKKVIDAMLRDKRVAQQAEFEEKGKKAAG
FT                   VSAGYVAKDNAGNTFILKHFYKTHAACQKIQGNHAQRQAMADRRDGVQELIGSTMYQFL
FT                   LHDRAPKEGLVTADEQHPDSLYVRSKFFDNAVTLTEFSGLSGETRVRDNDQNLKKLEGF
FT                   EKAIAACHMLGEVDYHAGNLMVQDGKTITKIDHGRSFLAFHKNFSSMIQSTAEMFTHPG
FT                   VGYSAAIKAGNFSFSIDKYSESLNQMISQFDEKHMEAIVDQKIDELKKAGFDPKNIMLS
FT                   TNIQNFDDLRKHYKSSIKENLVNMQEVAKGAEIVTKFSNVSPEFKNGGWLEAFANSPVK
FT                   DPVLYAIDNNITIEGKDAKEWAYENNYQIKISIGLKKETIKEQQWSKDLDGKWKEKEVE
FT                   VKTDKVEVQISDPAKSMRIQDKSTGEKLASLIVDFTKQATTKNVTDKAVAKFYDNIMKV
FT                   LKKENYLTEQDIKGIKKNLKYQDNIENTTNLLNAKSFKLNSKDTIYYKVGIFCEKRGLP
FT                   SISNYFMKQISPENLNKIHNTEKLIAETIKIGNILQQKKQERLQTKRVETVKEIAFSQL
FT                   QARKERHQQR"
FT   gene            complement(197114..197824)
FT                   /locus_tag="RC0189"
FT   CDS_pept        complement(197114..197824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0189"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02727"
FT                   /db_xref="GOA:Q92J80"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J80"
FT                   /protein_id="AAL02727.1"
FT                   /translation="MIDYTKTLTAASKHKTFDEGLRQYMLKVYNYMALALLLTGVAAVT
FT                   TISVEPIYNLMFQTGFGTIIMFAPLGIALYFFMGFGQMNLPTAQILFWVYAGLTGMSLA
FT                   YLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLF
FT                   LKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN
FT                   LFLYLMRFLGNRRD"
FT   gene            complement(197898..198755)
FT                   /gene="dapB"
FT                   /locus_tag="RC0190"
FT   CDS_pept        complement(197898..198755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="RC0190"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02728"
FT                   /db_xref="GOA:Q92J79"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J79"
FT                   /protein_id="AAL02728.1"
FT                   /translation="MASYNKICGSNYIKYTLRSKDFRCLALVQIKLRLLTVHLLGVYIA
FT                   NMLNIGLSGSTGKMGETILERIDKFKDCKIAAKFNSTNNLDDLDNFCKNSDVIIDFSTP
FT                   EILEKLINYALKHNTKLVIGTTGLQPQHFKLLEKAAQTLPVLYSANMSIGANLLSYLAK
FT                   EVTKILDDYDVEILETHHRNKKDSPSGTAVMLAETIASKKGLNITFNRGNRLRSEKEIG
FT                   ISSLRGGNVHGIHEISFLGDDEIITLKHEALNKNSFSIGAIKAAIWLQDKPSALYSMQD
FT                   IYKI"
FT   repeat_region   198654..198684
FT                   /note="REP04, repeated element"
FT   repeat_region   complement(198770..198911)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            complement(198902..199381)
FT                   /locus_tag="RC0191"
FT   CDS_pept        complement(198902..199381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0191"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02729"
FT                   /db_xref="GOA:Q92J78"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J78"
FT                   /protein_id="AAL02729.1"
FT                   /translation="MAGTVTESQFKDAMSRFPQGVTIITTNCNNELFGFTASSLTSVSL
FT                   KPPLILFCLNKNSFSINSFQKSDKFAISILAENQIDISKHFAKSQSNKFTKIDYELGNK
FT                   TDCPLINGATYHIECNKYASYDAGDHVIFIGEVINTAIKNDLKPLLYFHKSYTKI"
FT   gene            complement(199366..200091)
FT                   /gene="yqiX"
FT                   /locus_tag="RC0192"
FT   CDS_pept        complement(199366..200091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiX"
FT                   /locus_tag="RC0192"
FT                   /product="amino acid ABC transporter substrate binding
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02730"
FT                   /db_xref="GOA:Q92J77"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J77"
FT                   /protein_id="AAL02730.1"
FT                   /translation="MKFLKIFLLSCLLVSCEKKETEKTLIVGTAADNPPYEFIQDGEIV
FT                   GIDIDIIKAISERLNKKVIIKNFDFNGLLAALVSENIDVAVAELSVTPERAEYISFSDN
FT                   YATARFAIIYRTGDNIQNSKDLENKIVGVQLGSVLEKKAHDLSQTINIKVHSLANHLML
FT                   VEELKARVIDAIISEEFQGKKLKENNSNLESSTLEEFSSDFAIGMSKNSGLINEINEAI
FT                   DSLKKDGTINKIMKKWLGQ"
FT   repeat_region   complement(200168..200214)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(200226..200258)
FT                   /note="REP01, repeated element"
FT   gene            complement(200348..201799)
FT                   /gene="gatB"
FT                   /locus_tag="RC0193"
FT   CDS_pept        complement(200348..201799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="RC0193"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02731"
FT                   /db_xref="GOA:Q92J76"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J76"
FT                   /protein_id="AAL02731.1"
FT                   /translation="MAYIEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQV
FT                   SYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFY
FT                   YPIVQNGTMEIPTSTGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIV
FT                   TEPDISSPEEAAEFVKKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIK
FT                   NINSIRNIIKAIEFEAKRQVDLLESGEKIIQETRLFNADSGETRTMRLKEEALDYRYFP
FT                   DPDLLPLVISDELINELKANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKA
FT                   ANECNPKMLTNWLTSELFGQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVF
FT                   EIMFETGKAPDKIVEEKGLVQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVG
FT                   QVMKKTGGKANPTLVNQLLKEKLSS"
FT   gene            complement(201802..203283)
FT                   /gene="gatA"
FT                   /locus_tag="RC0194"
FT   CDS_pept        complement(201802..203283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="RC0194"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02732"
FT                   /db_xref="GOA:Q92J75"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J75"
FT                   /protein_id="AAL02732.1"
FT                   /translation="MTELNKLTVADSIKGLKNKDFTSTELIGAHIKQIEKHRNLNAYVT
FT                   DTFDLALKQAEAADQKYAQNNARTLEGIPFAAKDLFCTKGIRTTACSNILKNFIPNYES
FT                   SVTQNIFDKGGVMLGKTNMDEFAMGSANITSCFGNVISPWKANDDNADLVPGGSSGGSA
FT                   AAVSGFMASAALGSDTGGSVRQPASFTGLVGFKPTYGRCSRYGMISFASSLDQAGIFTR
FT                   SVLDSSIMLEAMMGFDEKDSTSIKAEVPELQSAIGSSMKNMKIGVPLSLGEGSIIEPDI
FT                   MKMWQDTIELLKNAGAEIVDITLPHAKYGVAVYYVIAPAEASSNLSRYDGVRYGLRVER
FT                   ENMTLDEMYEMTRSTGFGEEVKRRIMIGTYVLSSSGMDAYYLKAQKVRRLVANDFNNAF
FT                   AKVDAILLPAAPTAAFKIGEKQNDPTIMYLNDLFTIPASLAGLPCASVPAGLSARGLPL
FT                   GIQIIGKQLDEYNVLKVASTIESGVKHIKFEPKGF"
FT   gene            complement(203286..203741)
FT                   /gene="gatC"
FT                   /locus_tag="RC0195"
FT   CDS_pept        complement(203286..203741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="RC0195"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02733"
FT                   /db_xref="GOA:Q92J74"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J74"
FT                   /protein_id="AAL02733.1"
FT                   /translation="MSHAIKSAIESCITGCIQDLAHKSQDDRNTVTNRQAFTGITSDYT
FT                   TQNNKTMITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTS
FT                   VCNMNARMREDAVTSSDLSSELLDNVSGNSAQLAKEVKYFITPKVVE"
FT   gene            complement(203892..204065)
FT                   /locus_tag="RC0196"
FT   CDS_pept        complement(203892..204065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0196"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02734"
FT                   /db_xref="GOA:Q92J73"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J73"
FT                   /protein_id="AAL02734.1"
FT                   /translation="MTKLVRDLIPEIILKSGRIPVTHIAESYEYKELLKNKLLEEVEEI
FT                   LQDEYMEKLPIY"
FT   repeat_region   204193..204245
FT                   /note="REP03, repeated element"
FT   repeat_region   204268..204287
FT                   /note="REP03, repeated element"
FT   gene            complement(204380..204940)
FT                   /gene="rrf"
FT                   /locus_tag="RC0197"
FT   CDS_pept        complement(204380..204940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="RC0197"
FT                   /product="ribosome recycling factor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02735"
FT                   /db_xref="GOA:Q92J72"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J72"
FT                   /protein_id="AAL02735.1"
FT                   /translation="MDKEHLKKNLQEKMEKALKVLDHELKGLRTGRASVNLLDSVTVEA
FT                   YGSKMPLSQVASLSTPDARTINVQVWDKSMVSSVEKGITIANLGLTPATDGQLIRLPIP
FT                   ALTEERRTALVKLAHKYGEDTKISLRNIRRDGNEALKKLEKDNVIAKDEHHSLSEQVQK
FT                   LTDDYSSKVDSVIKQKEQEIMTV"
FT   repeat_region   complement(205037..205120)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(205121..205155)
FT                   /note="REP01, repeated element"
FT   gene            complement(205229..205969)
FT                   /gene="pyrH"
FT                   /locus_tag="RC0198"
FT   CDS_pept        complement(205229..205969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="RC0198"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02736"
FT                   /db_xref="GOA:Q92J71"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J71"
FT                   /protein_id="AAL02736.1"
FT                   /translation="MKQKMISDINALKYKKVLLKVSGEALMGDKQFGHEYDVIKKIAID
FT                   IKEVIDLGVEVAIVVGGGNIYRGINAALVGMDRASADYIGMLATVINALTLQNVMESLN
FT                   IYTRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVIFAGGTGNPFCTTDSAAVLRAIEMNC
FT                   DILLKATQVDGVYDSDPKKNPDAKKYFTISYKDVITNNLQVMDTAAIAVARENKLPIRV
FT                   FSIKEQGNFARVIQDKGEYTTIEA"
FT   gene            complement(205966..206289)
FT                   /locus_tag="RC0199"
FT   CDS_pept        complement(205966..206289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0199"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02737"
FT                   /db_xref="GOA:Q92J70"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J70"
FT                   /protein_id="AAL02737.1"
FT                   /translation="MLMLTKIKFILYFPWLLLEIWKSAFAVIKIIWQRKIGIEPVFEWV
FT                   DAEGLEEIGEIIYGNSITLTPGTVTLDINNNMLLVHALNKSSITDLQRGIMIKKIKQIL
FT                   KTT"
FT   gene            complement(206273..207832)
FT                   /gene="emrB"
FT                   /locus_tag="RC0200"
FT   CDS_pept        complement(206273..207832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="RC0200"
FT                   /product="multidrug resistance protein B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02738"
FT                   /db_xref="GOA:Q92J69"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J69"
FT                   /protein_id="AAL02738.1"
FT                   /translation="MSNYNLQPPALSKKQLFAFFGMVVGMFMSVLDIQIVASSLSVIAA
FT                   GLAASSDELSWVQTSYLIAEVIIIPITGFLARLLTTRISYFIAALGFTVMSILCSLATN
FT                   IESMIIFRALQGFFGGAMIPTVFSTVFILFPASQRPIVTILIGLVVTVAPTLGPTLGGY
FT                   ITEILSWHFMFLLNVIPGIFVCTVVFLYGDFDKPNYKLLKNFDFLGILLMALTLGLLQY
FT                   VLEEGNKKGWLEDNLILFLSITVVLGFILLIIRELTCINPILDLKTFLYKDFTFGCLYS
FT                   FVMGIGLYGTVYILPLFLFTIAGYDTLQIGATMMVTGGAQFLSAPLAGRMLGLGVDLRL
FT                   MLIIGLGGFALGCHLNSFLTPDSKFAAFVLPQFVRGLSLMFCFIPTNNIALGNMPKERV
FT                   GNASGLYNLTRNLGGAVGLAIISTILTNDTKTFMQYLSENISSTSIMALEQLDSYTELL
FT                   SGKVLNPEKASYLLLANKLNHDAFVIAINNIFNMIGLLFVFIMLLIPFTSNIKLTENVN
FT                   AH"
FT   gene            208063..208266
FT                   /locus_tag="RC0201"
FT   CDS_pept        208063..208266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0201"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02739"
FT                   /db_xref="GOA:Q92J68"
FT                   /db_xref="InterPro:IPR024246"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J68"
FT                   /protein_id="AAL02739.1"
FT                   /translation="MQNPAQKVISFSEHKSDIERIKKSIEEGWAIVKLVPNNDRFIGLL
FT                   EKISHAEDETIYIPPRKKIIVN"
FT   repeat_region   208687..208738
FT                   /note="REP03, repeated element"
FT   gene            complement(208823..208895)
FT                   /locus_tag="RCRNA06"
FT   tRNA            complement(208823..208895)
FT                   /locus_tag="RCRNA06"
FT                   /product="tRNA-Thr"
FT   repeat_region   209027..209056
FT                   /note="REP03, repeated element"
FT   gene            complement(209068..211374)
FT                   /gene="omp1"
FT                   /locus_tag="RC0202"
FT   CDS_pept        complement(209068..211374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp1"
FT                   /locus_tag="RC0202"
FT                   /product="outer membrane protein omp1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02740"
FT                   /db_xref="GOA:Q92J67"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J67"
FT                   /protein_id="AAL02740.1"
FT                   /translation="MTIRSISKLTILLLTIFYYHISLADSVIRKITIEGNHRVERSTIE
FT                   SYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDGNLIVNVTETPFISSVVFSG
FT                   NSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSGRFATTVTPKIENLENNRV
FT                   KVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWFRFLESNDTYDPDRMEYD
FT                   KELLRDFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEKYSFGNITIDNKLTNID
FT                   ITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYPNIMKNANHTADIKFI
FT                   IEKADKVYINKINIINNLKTEDPVIRREFKIEEGDIINRSYIEKGERNLRNLDYFEKVA
FT                   ISLAPTKAKDKYDVNVEVDEKSTSSIGFDLGYNTAGGLFGRFSFLERNLVGTGKLLNAG
FT                   VQVSKNTTSYYGGITAPHFLDRDLSLGVNTFRNYTGRGASVLNTTDQSYKLHSIGVKTS
FT                   LGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKEQMGRFITSAIGHTITYDQTDNKIV
FT                   PKNGYLVSGTQEFAGVGGNNKYIKHEVDGKYYKSFIHNKLTLKLSASGGNITGLGGKII
FT                   RISDRFNLGDYSLRGFANGGVGPREKVTNEGLGGERYYKFSTELNFPTPIPEEFNLTGT
FT                   VFMDLGSVGGVGLNKKQYQTPNGFYNDTSLRASIGFGFIWVTRFAPIRMDWGFPIKKKK
FT                   YDDTQHFHLRFSTHL"
FT   repeat_region   complement(211422..211448)
FT                   /note="REP03, repeated element"
FT   gene            complement(211613..212689)
FT                   /locus_tag="RC0203"
FT   CDS_pept        complement(211613..212689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0203"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02741"
FT                   /db_xref="GOA:Q92J66"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J66"
FT                   /protein_id="AAL02741.1"
FT                   /translation="MLSIIGFIITISILVFIHEFGHYCIARYFNVKVEEFSIGFGKALI
FT                   GITDKKGVRWKICLIPLGGYVKIYGYDRSLMDKTKEVNEKVAFDAKSCLERFLIVAAGP
FT                   LINYLLAIIIFAGFYCYFGKTEIPPIIGNVVASSPAERADLRAGDKIVKVNDKSVKDFG
FT                   DVQREILINGFSSSTLTIERKSEEFIVNIMPQEIIISPPEEKQVNKKTLRIGIIAKNES
FT                   IHTKIGILGGLWEAINTTIDMSALTLNAISQMIVGKRSFDEIGGPIAIAKESGKSIAGG
FT                   TQMYLLFIAMLSVNLGLLNLLPIPVLDGGHLVFILYEAITGKLPHPKTKNILLQLGAII
FT                   IIFLIIIAVSNDIQNLFS"
FT   repeat_region   212791..212818
FT                   /note="REP02, RS3-like repeat"
FT   gene            212971..213441
FT                   /gene="nusB"
FT                   /locus_tag="RC0204"
FT   CDS_pept        212971..213441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="RC0204"
FT                   /product="N utilization substance protein B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02742"
FT                   /db_xref="GOA:Q92J65"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J65"
FT                   /protein_id="AAL02742.1"
FT                   /translation="MSSNKINKKSIARIAAVQAIYQNILQNNDDMDDIMQNVLSFYQNN
FT                   NAITDLPENLKISLSISHFKMLVKSVFENIHKLDEIIDNHLTNDKDPAHMPILLRALLR
FT                   VSICELLFCPTTPAKVVINEYTDIANDMLNEHEIGFVNSVLDKIAKEHTRLI"
FT   repeat_region   complement(213425..213452)
FT                   /note="REP04, repeated element"
FT   repeat_region   complement(213508..213539)
FT                   /note="REP04, repeated element"
FT   gene            213576..214259
FT                   /gene="ftsJ"
FT                   /locus_tag="RC0205"
FT   CDS_pept        213576..214259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="RC0205"
FT                   /product="cell division protein ftsJ"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02743"
FT                   /db_xref="GOA:Q92J64"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J64"
FT                   /protein_id="AAL02743.1"
FT                   /translation="MTNNLSGYRNKFVRVKTSKKRTVSSSNWLRRQLNDPYVAKARIDG
FT                   FRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQVASKLIKASDNNLNNKIISIDV
FT                   LEIEHVAGVEFVQKDFFEADTEELIIQALDGRADIVMSDMASNTIGHKATDHIRTLLLC
FT                   EQAFEFALKVLKPSGHFIAKIFRGGAENELLHKVKREFKTVKHFKPSSSRSESTEIYLV
FT                   ALNKK"
FT   gene            complement(214310..215371)
FT                   /locus_tag="RC0206"
FT   CDS_pept        complement(214310..215371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0206"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02744"
FT                   /db_xref="GOA:Q92J63"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J63"
FT                   /protein_id="AAL02744.1"
FT                   /translation="MPTYKNSKHISTKKLAYIGLDLAYKTDDLNIYKLKASKVNEQLTD
FT                   SGWEILTASCDNINTAKYAYKAVAFINKDTKEVHIASAGTKFNIYDLLDDLLIALHYLP
FT                   TKLTPIQDFVNEIINKLGGLSKATEYSFNTSGHSLGAIIADLTLVEIHSRNLHFNKSTT
FT                   FDSPGSKPIIERGIEKNLFTGKVTTPIKELATHSKIYNAKHNLINITNKHFGQTTMVLP
FT                   GKKTTLSQSEEWASYLYNFAKQKVTKYLGINGIVEGFEEIIAGISKHGLVNFSDLKQNI
FT                   TLTIDDWEAATPKYAKNTLNLKNNLYNQIVETETGANLVGMYNNFQSCNQEYAQEVQTT
FT                   GDISNYNLYPLIY"
FT   gene            215542..216495
FT                   /locus_tag="RC0207"
FT   CDS_pept        215542..216495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0207"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02745"
FT                   /db_xref="GOA:Q92J62"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J62"
FT                   /protein_id="AAL02745.1"
FT                   /translation="MLKLLIQNLFGSNKPITYLSLIEKAKADYGFYTKLASGSFFVGVS
FT                   SLFSFSSWLSKIPLITWGVFGTSYGAKGIMESNEQIKLFTQAHEATKFEEYLATSGLGS
FT                   FVYATAIDKNGIDKFTGKYIEGTNAKIISNAITRVPTLSLTGDGVGYKYNGGYEIVEST
FT                   DRALYQAIPGVKGQYTNKLVLDTSILPLHSCIIQQLIQNGYSSDDIEKALSLGTVAKRE
FT                   SYKNNQLAEYKPNLTSKLWHGTEKAIQNKVVELSKEIQKYAEINAAYEELFNYHTSSTS
FT                   EEQEEQFYSFDYNNLNGDQTQILGDEGDAGYISDIA"
FT   gene            complement(216554..216994)
FT                   /locus_tag="RC0208"
FT   CDS_pept        complement(216554..216994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0208"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02746"
FT                   /db_xref="GOA:Q92J61"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J61"
FT                   /protein_id="AAL02746.1"
FT                   /translation="MPSLQHTKILPYKPQELFDLVWDVKSYPKFLPWCSASRIISENNQ
FT                   EVIAELVIQLKGFSEKYNSRVTSEITDDGIYLINTVAISGPFEYLKSTWQFVPCTAGTA
FT                   LKFFIDFKMKSVILDKLIGTYFTKATEKMIIAFERRAKEVIK"
FT   gene            complement(216994..217275)
FT                   /locus_tag="RC0209"
FT   CDS_pept        complement(216994..217275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0209"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02747"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J60"
FT                   /protein_id="AAL02747.1"
FT                   /translation="MDDKKDNRHLSKPAYREECTGDTERSTTAYMDILEDVSTGSTSKL
FT                   PLEAKFVKISNNISEKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF"
FT   repeat_region   complement(217111..217254)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            217249..218022
FT                   /locus_tag="RC0210"
FT   CDS_pept        217249..218022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0210"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02748"
FT                   /db_xref="GOA:Q92J59"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J59"
FT                   /protein_id="AAL02748.1"
FT                   /translation="MSIIFFIVHSTKYMKYNRIYINSRLAENSKIELASDHHVHYVKTV
FT                   LRLKVNDGLRLFNGTDGEFLAQINDIGKNNLSVRLKEQLKKPYTKSTLTLAVAIIKQDK
FT                   LMLAINMATQLGITKIIPLITRWCQFRSVNIERLTKCVIEATEQSERLTPPIIEKAITI
FT                   QDYLKKNNNLMLYANEHEKEENSILRISSSLSNSDITIIVGPEGGFTNDELELLASYKN
FT                   TKSISLGSNILRAETAAITAIAQVRLLGSHCEEIA"
FT   repeat_region   complement(218000..218098)
FT                   /note="REP01, repeated element"
FT   gene            complement(218602..221628)
FT                   /gene="acrD"
FT                   /locus_tag="RC0211"
FT   CDS_pept        complement(218602..221628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="RC0211"
FT                   /product="acriflavin resistance protein D"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02749"
FT                   /db_xref="GOA:Q92J58"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J58"
FT                   /protein_id="AAL02749.1"
FT                   /translation="MLLSKICIKRPVFATVLNLVIVALGAIFFTKLQIRGTPDISVPII
FT                   NVEAHYAGADALYMEQEITTRIEKALKTVKNLDYITSQSSTGESSITLSFLLSTDIEVA
FT                   LNDVRAKISDITYMFPQDMKTPSVTKLDADSFPSLFISIESDQYSDLELTKIVEDNLQT
FT                   PLDKLESVGQSQIYGGREYIMRIEPDSKKLYQHKISLLEIESAIKEQNKDYPAGTIKTK
FT                   SNNFIVTLAGSLSTPEEFGNIILKVQNGGIIKLRDIAKISLTSPDEDIIFRYNGKSSIA
FT                   LGLIKESKANVIDLSHEVTKALERIKESMPKGISMGIAYDAATPVKASIYAVFQTIFEA
FT                   LILVVLVTYLFLASAKITLIPFVTIPVSLIGTFSIMYAFGFSINIFTLLAMILAIGLVV
FT                   DDAIVMLENIFRYNEMGHKPMEAAMLASKEIGFAIIAMTITLAAVFLPVGFIEGFIGKL
FT                   FIEFAWTLAFCILFSGFVALTLTPMMSSRMVTKHNTDLPKFLVKFNDILQFIQNKYIYY
FT                   LKLTFDNQKKFVIIIASSFIVLIISFKFTQKIFVPQEDDGFLQVSLKGPEGSNLESSTK
FT                   VVKEAEKILANYKDILGYLMVIGAGGSDNVFGFIPLKNWGERSCSQETIKNMLNKQFSE
FT                   IPGMSIYAMDPRSMVSGNASSPIEFTIQTNLEYDDLDKISQQFIDIMKTNPIFLNVNRN
FT                   LQSAMPTISIEVNRDKAYLYGMDLANIGKTVQYLLAGQQIGHFRMSNDLYDVILQFNQK
FT                   DRKDISDFSKILIRAKNNNMLPLESIANITEKISVKSYSHYNNSKSVTISSDLAPDRKI
FT                   DDAINEINKIAAKLLDPSNTIIEYIGEIKQMREADSNMLITFVFALIFIYLVLAAQFES
FT                   FTDPLLILLAVPFSITGGVLALWLAGNSLNMYSNIGLITLIGLITKNSIMIVEFANQLR
FT                   AKGVKVQEAIIESSKLRLRPILMTTLAAVVGALPLVFADGASAAARNSIGFVIVGGLSI
FT                   GTIFTIFVIPVIYHTFKKD"
FT   gene            222017..222436
FT                   /gene="hupA"
FT                   /locus_tag="RC0212"
FT   CDS_pept        222017..222436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="RC0212"
FT                   /product="DNA-binding protein HU"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02750"
FT                   /db_xref="GOA:Q92J57"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J57"
FT                   /protein_id="AAL02750.1"
FT                   /translation="MMYIIASCIYCFIKKHQYILTYQRRIDFIMSTHNTKEPKKMNKTE
FT                   FIAFMTDHGHNHKHASHKTLTKAEAEKALNLVLDSVISAIKSHHNINITGFGSFEIHHR
FT                   KAREGRNPKTGAKMKIDAYNQPTFRAGRKMKEACN"
FT   gene            222576..223385
FT                   /gene="holB"
FT                   /locus_tag="RC0213"
FT   CDS_pept        222576..223385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="RC0213"
FT                   /product="DNA polymerase III delta subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02751"
FT                   /db_xref="GOA:Q92J56"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J56"
FT                   /protein_id="AAL02751.1"
FT                   /translation="MILQPLIIERLEFNLKHNKLYNSWLIEAENIEQALKDLEEFIYIK
FT                   LFKNSIPLDNNPDYHFIARETSATSNAKNISIEQIRKLQDFLSKTSAISGYKVAIIYSA
FT                   ELMNLNAANSCLKILEDAPKNSYIFLITSRAASIISTIRSRCFKINVRSSIHHTKNELY
FT                   SEFIQSIADNKTLDFIHRFTTKDRELWLDFIDNLLLLMNRILKKSANVNIELLDLENKI
FT                   FNKLSNRHPSYLLQKFTDIKKLIYNTIDYDLDLKTSYILVVNEFSSN"
FT   gene            223586..224935
FT                   /gene="ffh"
FT                   /locus_tag="RC0214"
FT   CDS_pept        223586..224935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="RC0214"
FT                   /product="signal recognition particle protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02752"
FT                   /db_xref="GOA:Q92J55"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J55"
FT                   /protein_id="AAL02752.1"
FT                   /translation="MFKTLTQNLTKIFDKLVSSGILTEAQIDAAMRDIRVALLESDVAL
FT                   PVIKDFIAEVKQKALGQEVIKSVSPGQMIIKIIHEEMINLLASSKSETKLNLNSKPPVN
FT                   FLMVGLQGSGKTTASSKLALRLRNQNKKVLLVSLDTYRPAAQEQLAILANSVQINSLPI
FT                   VQGEKPLDIVKRAIAEAKISAYDVVIYDTAGRTQIDKAMMEEALAIKKIVEPTETLLVI
FT                   DSMTGQDAVVTASSFNEKLAISGLILSRIDGDSKGGAALSVKYITKKPIKFLSSGENLI
FT                   DLEEFDAERLASRILDMGDIISFVEKAASIVDREEAEKTAAKLKKGKFDLNDYLQQMRS
FT                   IKKMGGFGSILSMLPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTPKERKNPDIINASR
FT                   RKRIAVGAGTTVQKVNILLKQYKQISEIMKKVSKMNPKNLLRSGIGKLFS"
FT   repeat_region   complement(224956..225090)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   225122..225151
FT                   /note="REP03, repeated element"
FT   gene            complement(225636..225932)
FT                   /locus_tag="RC0215"
FT   CDS_pept        complement(225636..225932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0215"
FT                   /product="prolyl endopeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02753"
FT                   /db_xref="GOA:Q92J54"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J54"
FT                   /protein_id="AAL02753.1"
FT                   /translation="MENEVWVKHGRVSVLANIRGGGEFGPEWHEATQGIKRQTGLNDFI
FT                   AVAEDLIKQNITSPEYLGIKGGSHGGLLVSVAMTQCPDLFGAIACEVPILDTI"
FT   gene            complement(225956..226321)
FT                   /locus_tag="RC0216"
FT   CDS_pept        complement(225956..226321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0216"
FT                   /product="prolyl endopeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02754"
FT                   /db_xref="GOA:Q92J53"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J53"
FT                   /protein_id="AAL02754.1"
FT                   /translation="MRMLFSKVVTFTLENHEWTKPVTLLSYENTIFGMLSDDEEEDALI
FT                   TIENSIVPPTIYLWDKTHELKVIRKPLYPFDSKNYVVDQKEATSSDGVKIPYFIVYKKG
FT                   TKIVRIQHYLKHTAVFK"
FT   gene            complement(226648..226809)
FT                   /locus_tag="RC0217"
FT   CDS_pept        complement(226648..226809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0217"
FT                   /product="prolyl endopeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02755"
FT                   /db_xref="GOA:Q92J52"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J52"
FT                   /protein_id="AAL02755.1"
FT                   /translation="MHQEEVTDSLYPSLLYIWKRGEPIEKAKKLFEIPKNYIRVSASKL
FT                   LPIIFLHL"
FT   gene            complement(226910..227494)
FT                   /locus_tag="RC0218"
FT   CDS_pept        complement(226910..227494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0218"
FT                   /product="prolyl endopeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02756"
FT                   /db_xref="GOA:Q92J51"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J51"
FT                   /protein_id="AAL02756.1"
FT                   /translation="MIKHYSNSKKTLNKAFNLIDIIKIIKKITHYFIIFCVQAMGSNNE
FT                   QIYNPKNTKFLEETEALKWAKEPTDKTAKACQSMPTYKVVKKELESVCYDQRNTPFGAI
FT                   RKGYMYNFWMDYKNPQGLWRRTLVENYSKDKPKWEVLIDFDKLSKKLGKKVMYRGESDC
FT                   FQNPNRFLITMSFGGKDEMFFRAWDLEKKIL"
FT   repeat_region   complement(227522..227687)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            227671..228873
FT                   /gene="hemN"
FT                   /locus_tag="RC0219"
FT   CDS_pept        227671..228873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="RC0219"
FT                   /product="probable oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02757"
FT                   /db_xref="GOA:Q92J50"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J50"
FT                   /protein_id="AAL02757.1"
FT                   /translation="MSTKPKLALAKIQNMRVMANDLSIYIHWPFCVSKCPYCDFNSHVA
FT                   STIDHNQWLKSYETEIEYFKDIIQNKYIKSIFFGGGTPSLMNPVIVEGIINKISTLAII
FT                   DNQTEITLETNPTSFETEKFKAFKAVGINRISIGVQSLKEDDLKKLGRTHDCMQAIKTI
FT                   EAANTIFLRVSFDLIYARSGQTLKDWQEELKQAMQLATSHISLYQLTIEKGTPCYKLFK
FT                   EGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISNYAMIGYECLHNLTYWNYNSYLGIG
FT                   PGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVGIQTNTKLTHQEIIEEMLMMGLRL
FT                   SKGINISTLEQKLNTKLENILDMNNLKHYQALDLIRLDENIYLTDKGLMLYSYIVPRLI
FT                   I"
FT   repeat_region   complement(229421..229455)
FT                   /note="REP01, repeated element"
FT   gene            complement(229522..229716)
FT                   /locus_tag="RC0220"
FT   CDS_pept        complement(229522..229716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0220"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02758"
FT                   /db_xref="GOA:Q92J49"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J49"
FT                   /protein_id="AAL02758.1"
FT                   /translation="MLHTVQMTKKSDNLSPIVDYLILGIVHKGHENLPIVYIVYISLKA
FT                   ILNQLSYQDILIGLTTSQS"
FT   gene            complement(229730..230050)
FT                   /locus_tag="RC0221"
FT   CDS_pept        complement(229730..230050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0221"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02759"
FT                   /db_xref="GOA:Q92J48"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J48"
FT                   /protein_id="AAL02759.1"
FT                   /translation="MKENKDLYLVDTKYVNYTKEIKDAVNNNAEIIHIKNIDQKNYNIM
FT                   TPYDGEVQISGIEELICHMYGVIGIIGSLPVLYKEDKNIIRAVAPRRNSHNEHSSQSPY
FT                   ND"
FT   gene            complement(230244..230432)
FT                   /locus_tag="RC0222"
FT   CDS_pept        complement(230244..230432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0222"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02760"
FT                   /db_xref="GOA:Q92J47"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J47"
FT                   /protein_id="AAL02760.1"
FT                   /translation="MLSELKNAFYVIPAKAGIQGKAKLKYSYQKEDNRIEFLQGDSNKV
FT                   EAIFPKEKISEIVHPIL"
FT   repeat_region   complement(230377..230404)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(230483..231682)
FT                   /gene="gltP"
FT                   /locus_tag="RC0223"
FT   CDS_pept        complement(230483..231682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="RC0223"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02761"
FT                   /db_xref="GOA:Q92J46"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J46"
FT                   /protein_id="AAL02761.1"
FT                   /translation="MKLWQKVTLGLILGIIFGIYLPQYVNYIKPIGDIFLRLIKMIITP
FT                   LIFFSLVSGITSMNDNSALGRVGMKAVAAFLGTTFFATVFGLTVALVLKPGVGVHIDFT
FT                   SSGTTNRTSFNIIDFFVNIVPDNAVGAFANGDVLQVVFFAIFVGITLNKMKSIGEPITD
FT                   LIHVMSKLILKMISFVIQLSPYGAFALTGWIVGMQGVEVMISLSKLVVAVVVAMTFQYL
FT                   VFGLLICVFCRVSPIPFYKKSFEYQILAFSTSSSKATLATTMQVCRAKLGISESSTSFV
FT                   LPIGASINMDGFAINLSLTTIFFAQMMGVTLAPHDYLVIILTSTLGSIGGAGIPGASLI
FT                   MLPMVLSSVHLPIEGVAIIAGIDRILDMLRTTINITGDATITMIIDNSEDTLDKEVYLS
FT                   "
FT   gene            complement(231723..232037)
FT                   /gene="cutA"
FT                   /locus_tag="RC0224"
FT   CDS_pept        complement(231723..232037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="RC0224"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02762"
FT                   /db_xref="GOA:Q92J45"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J45"
FT                   /protein_id="AAL02762.1"
FT                   /translation="MQDCCLILTTTNDLQIAEKIASVLLELNLTACIQIDDVKSYFRWN
FT                   GRVTLETEYRLVIKTKSSNYNEIENKLLEIHNYELPQIIKINIDYGFQKYLEWINQNNK
FT                   "
FT   gene            complement(232040..232558)
FT                   /locus_tag="RC0225"
FT   CDS_pept        complement(232040..232558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0225"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02763"
FT                   /db_xref="GOA:Q92J44"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J44"
FT                   /protein_id="AAL02763.1"
FT                   /translation="MLRQLLRNFPHNDVVPFLLFEKKVKSFKERKYIIMIKCTRRIEFD
FT                   AGHRIIEHQNKCQFLHGHRYVLEIAIAANKTDKLGMVIDFGLIKDLAKKWIDENFDHSL
FT                   ILHQDDKEMGQQIENCTGQKIYYMQNNPTAENIATHLKNEIFPKLFVSQNFFVTSLKLY
FT                   ETPNCFVEV"
FT   repeat_region   complement(232520..232619)
FT                   /note="REP01, repeated element"
FT   gene            complement(232626..233813)
FT                   /gene="sucB"
FT                   /locus_tag="RC0226"
FT   CDS_pept        complement(232626..233813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="RC0226"
FT                   /product="dihydrolipoamide acetyltransferase component"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02764"
FT                   /db_xref="GOA:Q92J43"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J43"
FT                   /protein_id="AAL02764.1"
FT                   /translation="MRVKIIVPSLGESITEATIAKWYKKQGDSVKTDELLLEIETEKVT
FT                   LEVNAPCNGTIGKISKTEGANVAVGEEIGEINEGASANTAGTNNESAKAQAVTQPTSEK
FT                   PAVANNTLAPSVQKLVTENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNE
FT                   ERVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKL
FT                   GFMSFFVKATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMG
FT                   FAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHK
FT                   TEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL"
FT   repeat_region   complement(233909..233955)
FT                   /note="REP01, repeated element"
FT   gene            complement(233978..236764)
FT                   /gene="sucA"
FT                   /locus_tag="RC0227"
FT   CDS_pept        complement(233978..236764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="RC0227"
FT                   /product="2-oxoglutarate dehydrogenase e1 component"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02765"
FT                   /db_xref="GOA:Q92J42"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J42"
FT                   /protein_id="AAL02765.1"
FT                   /translation="MGEDFKKTGYLFGGNAVFVEELYKQYLANPASVDQTWQEFFAGIK
FT                   DNNTLLNKSTAKIIIPDEIKKESLNNNLSSEDLNSLKAKEMINAYRKHAHYLANLDPLG
FT                   LELRKTKNDLKLNIETFGLDSGQLEENINITDEFVGTWNCKLSELVTKFDKVYTGSIGV
FT                   EFEQIENVAGKNWLYNKLESEVTFSSEDKKTILNDLVEVEGFEQYLHTKFPGAKRFSIE
FT                   GGDASIVAMSKAIDLSMHQGVSEIVIGMAHRGRLNTLTKVVGKPYKAVIADFISGSVFP
FT                   DELNVSGDVKYHLGYSSDRTLEDKKIHLSLADNPSHLEAVNPIVAGKVRAKQDILGDTK
FT                   RSKVKAILVHGDAAFCGQGVVAESLSMSPLAAYDIGGILHFVINNQLGFTANAADTRAS
FT                   RYSTEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGD
FT                   EPMYTQGKMYNIIKNKLTPGNIYANELVKSGVIDNNYFAKLKEEFKAKLDKEYEQAKSY
FT                   KQEAHFLGGLWQGISRTRTQATITGISKKTLHDLGTKLCEIPKDFAVNPKLVKLFEARK
FT                   ATLTADQPIDWATAEQLAFASLLASGTNIRLTGQDSGRGTFSHRHSVLHNQIDGTTYIP
FT                   LNNLSKEQAKYEVADSNLSEYAVLGFEYGYSLANPKNLVLWEAQFGDFANGAQIIFDQF
FT                   ISSSETKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAENNMYVTYPTTPASIFH
FT                   LLRRQILDDTRKPLIVMSPKSLLRHKYAVSKLDELGENTTFLPVLDEVTKVDTNNITKV
FT                   ILCSGKVYYDLFEMRGNNSNIAIIRLEQLYPFEKKLVASLLKKYNRTQEFIWCQEEPKN
FT                   MGTWCYIVSHLNDALKEAGIKNEFKYVGREESASPAVGSLQVHNKQQEKLLRTALGI"
FT   repeat_region   236800..236833
FT                   /note="REP01, repeated element"
FT   repeat_region   236849..236886
FT                   /note="REP01, repeated element"
FT   gene            complement(236898..238388)
FT                   /locus_tag="RC0228"
FT   CDS_pept        complement(236898..238388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0228"
FT                   /product="thermostable carboxypeptidase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02766"
FT                   /db_xref="GOA:Q92J41"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J41"
FT                   /protein_id="AAL02766.1"
FT                   /translation="MNNNYTKLENEFATISHFNNILSILYWDVDVNMPMGSGESRTNEI
FT                   VTLTSLVHSMLKSPILKELLSKAKEESKNLDEWQNGNIREIERKVTDANCIDEQLQKKL
FT                   VAATTKAALVWREARKHNDYNLFKSHLQKVLDYTKEVAKVRADAFNCGLYDSLIDMFDP
FT                   SRKSSEIKQVFSVLKKELPQLINKVLEKQKTEKELVKHSKLAPEMQKRIGKRIMGIMQF
FT                   DLTKGRLDESTHPFCGGTPNDIRLTTRYDKDNFISGLMGIIHETGHALYEQNLPEMYKG
FT                   QPVGLAKGMAFHESQSLFMEMQVGRSREFTEFLAKLLRDEFAVKSEEYSAASLYRKITR
FT                   VMPDFIRVDADEVTYPMHVILRFEIEEMLINGDLNLDELPSCWDSKMQEYLGVKPVSFS
FT                   NGCLQDIHWSHGNFGYFPAYTNGAIIASMVMKKVKEMHSNIKDDILKGDFSNLNNYLNK
FT                   NFRNLGSLKNSADLLKSASGEEKISPEVYIRYLEGKYL"
FT   repeat_region   complement(238401..238541)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(238565..240202)
FT                   /gene="recN"
FT                   /locus_tag="RC0229"
FT   CDS_pept        complement(238565..240202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="RC0229"
FT                   /product="DNA repair protein RecN"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02767"
FT                   /db_xref="GOA:Q92J40"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J40"
FT                   /protein_id="AAL02767.1"
FT                   /translation="MFYSLSVKNFILIDELEIEFNKGLCVITGETGAGKSILLDAILFC
FT                   LGYKTSNNIIKRGKDYAVVNIIFSLNEEIKNFLVQNFIEPEELLFVKCLQKAEGRKNFF
FT                   INNQVVTKALMQQLATYLFELHGQNNNISLLEANTQRDILDSYGNLLDFRAELSKCYQA
FT                   WQNTRKEMAEITLKQNSIEQEIDYLSFATEELTKLNIQTGEEEKLANLRKDLQNKDKDL
FT                   QLIKDIIEQINNPEINTSINRAEKLLARQGNNERFEAIVTSLEEAYNNLEEARQELSNL
FT                   LDSFNYEEYNLEETEERLFLIKAISRKYNVPADALGVFLDKSLEQLSILKNKIANSNEL
FT                   KAQEVLLQKKYYELASNLSAKRLIVAKHLEESLHQELKQLKMAKAIFEIEINTKEPTAD
FT                   GNDDIVFKASTNPGTAAAAINKIASGGELSRFMLALKTALFDKMVKPSIIFDEIDVGIS
FT                   GEVADKVGERLKKLSSVTQVIVITHQPQVAGKADLHIKIEKTQLEKETKVTVKALNLAE
FT                   RQEELARMISGKTITKASLKAAKELLHL"
FT   gene            complement(240210..240965)
FT                   /locus_tag="RC0230"
FT   CDS_pept        complement(240210..240965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0230"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02768"
FT                   /db_xref="GOA:Q92J39"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J39"
FT                   /protein_id="AAL02768.1"
FT                   /translation="MKLTKLLSTLLVIGLVLGGCKNKKNSDDIVVPIATLYNEGITLLE
FT                   KKKYKNAAEEFGRVLYQHPGNEMTPQAELMQAYSLFLAAQYEEAVDVLDMFIKLHPANV
FT                   DIAYAYYLKALSYYMLISDVNHDQSRTFLAKDSFEDVIAKFPNTKYAIDSSLKIDLVND
FT                   HLAGKEMMVGRFYLKKKNPMAAINRFEEVIDNYQTTSHSVEALYRLAESYMMLGLSDEA
FT                   KKYASVLGYNYPDSQWYSYAYRLVQNHQN"
FT   repeat_region   241055..241196
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(241198..241368)
FT                   /locus_tag="RC0231"
FT   CDS_pept        complement(241198..241368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0231"
FT                   /product="cation transport regulator ChaB-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02769"
FT                   /db_xref="GOA:Q92J38"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J38"
FT                   /protein_id="AAL02769.1"
FT                   /translation="MLRIFIAKLLIMAFEPYKDADKRRGNDSRETVAHKVAWSAVEKKY
FT                   HKNDKGHWVEK"
FT   gene            complement(241505..242626)
FT                   /gene="dnaJ"
FT                   /locus_tag="RC0232"
FT   CDS_pept        complement(241505..242626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="RC0232"
FT                   /product="dnaJ protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02770"
FT                   /db_xref="GOA:Q92J37"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J37"
FT                   /protein_id="AAL02770.1"
FT                   /translation="MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKDAEKKF
FT                   KEINAAYDVLKDEQKRAAYDRLGHDAFQNQQSRGGGGNHGGFHPDINDIFGDFFSDFMG
FT                   GSRRSSRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGSGSEKGETV
FT                   TTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIP
FT                   AGVENGTRIRHTGEGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAAL
FT                   GGEIEVPVIEGGKVNLTIPAGTQNGDQLRLRSKGMSKMRSTIRGDMLTHIHVEVPKNLS
FT                   KRQRELLEEFKKESINEKENDGSFFNKMKSLWS"
FT   repeat_region   complement(242655..242702)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(242713..242746)
FT                   /note="REP01, repeated element"
FT   gene            complement(242755..244638)
FT                   /gene="dnaK"
FT                   /locus_tag="RC0233"
FT   CDS_pept        complement(242755..244638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RC0233"
FT                   /product="dnaK protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02771"
FT                   /db_xref="GOA:Q92J36"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J36"
FT                   /protein_id="AAL02771.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGKEPKVIENAEGERTTPSIIAFANG
FT                   EKLVGQSAKRQAVTNPRNTIYAVKRLIGRNFIDPMVRKDQGIVPYNIVKADNGDAWVEA
FT                   DNNKYSPSQISAFILQKMKETAENYLGDKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFEKSASKTIAVYDLGGGTFDVSILEIADGVFEVKSTNGDTFLG
FT                   GEDFDTRILNHLIDVFKKENGIDLSKDPLALQRLKEAAEKAKKELSSAVTTDINLPYIT
FT                   ADSSGPKHLNIKFTRAELEKLVDDLIEKTIEPCRKALQDAGFKASDIQEVVLVGGMTRM
FT                   PKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIDRNTTIPTKKSQIFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPL
FT                   APRGLPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEQNA
FT                   DEDKKRKELIEAKNAADSLVYSTEKTLTEYGDKLSSDDKGAVEAALAALKAVLESEDTA
FT                   LIKEKTESLTAASMKIGEAMYKAQSESQPAAESATNDEKIVDADFQDVEKK"
FT   gene            244702..246195
FT                   /locus_tag="RC0234"
FT   CDS_pept        244702..246195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0234"
FT                   /product="heat shock protease"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02772"
FT                   /db_xref="GOA:Q92J35"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J35"
FT                   /protein_id="AAL02772.1"
FT                   /translation="MILQEVTMKKLPILLKLLFIINLVFLNNIVLASSETSTIIFEKAK
FT                   KAIVTIDTRIAVSAYDDTSSWTGTGFINDKNNGYIITNTHVVGGASIGTYFVTFYNGEQ
FT                   AEAKLIYYDIWQDYAVLKVESKDIPASATQISFASELPKLNQKVFVVGNTEAKGFSFHT
FT                   GYLSDLYNIEGLMPQCTYVINLNTTGGASGSPVLNDKIEAIGVLYGGGKTHSLALHGDY
FT                   VARTLESLKNNKQPGRKHIGIISELYSLNKAVRHHNFPKEEMDKYIKKFPDSRNRVISI
FT                   KAVLAGSPAAKSLKAGDIIWAVNDKELGGNLALFDREMDNFKGIAIKLTIFRDGKKLEQ
FT                   AVDLYDVNNNKIAKMINFGGAVFFEADDYFSNKSGIPLKALSIASVQSGSSFSSIPTFF
FT                   TKDYKNVYRLQIFEMKDLALSNLDDLVKLLPAITKEKFITVRFRNYQPYYANFGYNELI
FT                   SSHDDMIADVTLDSIDTKPYILKYNTISHDWDMENIKLQ"
FT   repeat_region   246425..246527
FT                   /note="REP01, repeated element"
FT   gene            247010..247210
FT                   /locus_tag="RC0235"
FT   CDS_pept        247010..247210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0235"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02773"
FT                   /db_xref="GOA:Q92J34"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J34"
FT                   /protein_id="AAL02773.1"
FT                   /translation="MIKDASGLTPSYYNTSKEILEILQNCERDIIDRLNIEPWHGWAED
FT                   KIFRDDMSIIGKNKHTIMELV"
FT   gene            complement(247351..247698)
FT                   /locus_tag="RC0236"
FT   CDS_pept        complement(247351..247698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0236"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02774"
FT                   /db_xref="GOA:Q92J33"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J33"
FT                   /protein_id="AAL02774.1"
FT                   /translation="MLLNQLILSIPIYIHTALVKIRAYFPLLEKVTLIKYSLTENIETL
FT                   KVNTDEANTVKITKEDLKKSFELYEEKLIILAQKLSLQTSISYDAYNPQTEYYPLIGED
FT                   GNINYIPITEL"
FT   gene            247866..248339
FT                   /locus_tag="RC0237"
FT   CDS_pept        247866..248339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0237"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02775"
FT                   /db_xref="GOA:Q92J32"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J32"
FT                   /protein_id="AAL02775.1"
FT                   /translation="MRSLFVIIIFFLMSSCNLKPVYSEKYSRNNDLEAIEVEPIRTIEG
FT                   AEFYHRLTSILPQKAQAKYLLKVKLIATTMPATIEKNSNVLREYINQLVRYKLIDIESQ
FT                   KVLIEEQFYQNTSYNAIFTPYATNVERDKTGIDLAYQAAEEIRSRLILYFTRK"
FT   gene            248347..249321
FT                   /locus_tag="RC0238"
FT   CDS_pept        248347..249321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0238"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02776"
FT                   /db_xref="GOA:Q92J31"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J31"
FT                   /protein_id="AAL02776.1"
FT                   /translation="MKFYFSQIGRLFELITSGKIRALLLYGPDKGYIEKICKHLVHSLN
FT                   MLQTSIEYADLNISSLEILLNSSNFFGQKELIKIRSVGNSIDQNLKTILNSDYINFPVF
FT                   IGEEMTSSGSIRKFFETEEYLAAVACYHDDEAKIERIILGKVEKTNKVISKEAITYLKA
FT                   HLKGDHDLICSEINKLIYFVHDAREITLNDVLEVISSEITANGSDLAMYFSKKDYSNFL
FT                   QELDILKKQNINEVLIIRALIRHYLNLYIVLSKVKNGERLELAIKSLSPPIFYQYINDF
FT                   TKIANGLSLTECLKTLKVLQQAEVDYKLNPASFDLFQSILQSK"
FT   repeat_region   249326..249451
FT                   /note="REP04, repeated element"
FT   gene            249456..249995
FT                   /gene="coq7"
FT                   /locus_tag="RC0239"
FT   CDS_pept        249456..249995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coq7"
FT                   /locus_tag="RC0239"
FT                   /product="ubiquinone biosynthesis protein coq7"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02777"
FT                   /db_xref="GOA:Q92J30"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J30"
FT                   /protein_id="AAL02777.1"
FT                   /translation="MPRPDFSDPDKQIHEIIRVNHAGEYGAKRIYQGQLKYIKSQNDRI
FT                   LIKEMLDHEEVHLNYFEKKLLEKEVRPTFLLFFWHHYGFLLGALSSLMGIKTAMLITES
FT                   VEEVIEKHYEQQINYLENENVEPELLNNIIKFRLDEIEHKNIAIMNDSTEAIFAEITSK
FT                   IVKIICRISIILSKKI"
FT   gene            250470..251396
FT                   /gene="coxC"
FT                   /locus_tag="RC0240"
FT   CDS_pept        250470..251396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="RC0240"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02778"
FT                   /db_xref="GOA:Q92J29"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J29"
FT                   /protein_id="AAL02778.1"
FT                   /translation="MRIADYFCSLLLVIIRKYKITICNNMSQKIILNNSYSITKSHLFH
FT                   IVDPSPWPVLTSFALLLLVIGGVSFMHGYKFNIYILSAGIISVGYCLYSWWRDIVKEGI
FT                   VEHQHTSPVRKGLQIGMALFILTEIVFFGVFFASFFKSSLSPVGLLDGVWVVKQGIWPP
FT                   PTIKTFEPFDIPFINTLILLLSGTTVTWAHYALEEKNQKDCVTALALTILLGIFFTTMQ
FT                   AYEYYHAAFKFTDGIYASNFYLATGFHGAHVIIGTIFLIICYFRAKRGDFTTEGNGHLG
FT                   FECAAWYWHFVDVVWLFLFTFVYIFGS"
FT   gene            251552..251911
FT                   /locus_tag="RC0241"
FT   CDS_pept        251552..251911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0241"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02779"
FT                   /db_xref="GOA:Q92J28"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J28"
FT                   /protein_id="AAL02779.1"
FT                   /translation="MNFPIRKLNEELIDYNLSLRILFTILSVAIIIVAFDSLAGNVGDP
FT                   VGEALCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAIIILFKAPDIV
FT                   NMVSSDTNSSNCGVS"
FT   repeat_region   252046..252125
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(252255..252887)
FT                   /locus_tag="RC0242"
FT   CDS_pept        complement(252255..252887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0242"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02780"
FT                   /db_xref="GOA:Q92J27"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J27"
FT                   /protein_id="AAL02780.1"
FT                   /translation="MHITCPNCQTRFIVTSNQIGINGRRVKCSKCSHLWYQKLDYNTST
FT                   LNDFKDKVNTGTIKTPIKNHYNANVPVILPYIPPKKKYNIFPILWTSFIIFCLVILLID
FT                   SFKFLDKYDQLKIEEINLGKSRHIGGMKIFYKLSNESDYLISDPIIKVRVMDTNNQALD
FT                   EYVSITKLQTKIPAKQAIYLEMNIEGIPITAKYIDIVIGNRLGLLFK"
FT   gene            252939..253787
FT                   /gene="dapD"
FT                   /locus_tag="RC0243"
FT   CDS_pept        252939..253787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RC0243"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02781"
FT                   /db_xref="GOA:Q92J26"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J26"
FT                   /protein_id="AAL02781.1"
FT                   /translation="MAIKQLKDMSSLIKEIEEAWQIKDKLLQDSSKLITLKQTLNDIIE
FT                   SLNQGTIRVCEKQENSWHVNEWVKKAILLYFITTESQLYNNNYNSWYDKVAPKFSADTD
FT                   KNTFKEAAIRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIG
FT                   KNCHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSST
FT                   KIVYRDTGEIIYGRIPAYSVVVPGVLPAKEAGKPGLYCVVIVKQVDKTTRAKVSINDLL
FT                   R"
FT   repeat_region   253853..253939
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(254086..254409)
FT                   /locus_tag="RC0244"
FT   CDS_pept        complement(254086..254409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0244"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02782"
FT                   /db_xref="GOA:Q92J25"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J25"
FT                   /protein_id="AAL02782.1"
FT                   /translation="MTQTIASCYSKIGDMLFNLGREDPAIIFYRKNNKLDSILKCYDSL
FT                   INKAEKPIKYDLYMAQGNELCFQKQQETDAAESYFKAAGVVRDPQKQRDTMLMAYNILR
FT                   KPK"
FT   gene            complement(254789..254986)
FT                   /locus_tag="RC0245"
FT   CDS_pept        complement(254789..254986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0245"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02783"
FT                   /db_xref="GOA:Q92J24"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J24"
FT                   /protein_id="AAL02783.1"
FT                   /translation="MLKEQESLIENLHTQIQINVECIINTIQSIFEDFNVYTPLNYSKF
FT                   FNYKGYIKPYLPSSPIQYRL"
FT   gene            complement(255082..255381)
FT                   /locus_tag="RC0246"
FT   CDS_pept        complement(255082..255381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0246"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02784"
FT                   /db_xref="GOA:Q92J23"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J23"
FT                   /protein_id="AAL02784.1"
FT                   /translation="MGMSNGVPDTVQELINVFFIQKLVQMTDKLKFILVAKEETVKSPS
FT                   IFNRIIDDFKNIFPTEEHKTFKGNVICVITQHNENNHENIIPMYKIALLLTRIY"
FT   gene            complement(255368..255526)
FT                   /locus_tag="RC0247"
FT   CDS_pept        complement(255368..255526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0247"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02785"
FT                   /db_xref="GOA:Q92J22"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J22"
FT                   /protein_id="AAL02785.1"
FT                   /translation="MLLRTTLRLTVKNLHLINYLLLKQRRKFSINMNRLYMIPKNLKLQ
FT                   KKYFGNV"
FT   gene            complement(255563..255715)
FT                   /locus_tag="RC0248"
FT   CDS_pept        complement(255563..255715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0248"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02786"
FT                   /db_xref="GOA:Q92J21"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J21"
FT                   /protein_id="AAL02786.1"
FT                   /translation="MKFKIPTEIEIKPFTEEETALDALKANILNALTEVNYSLIPAGKT
FT                   PEATE"
FT   gene            complement(255730..258120)
FT                   /gene="pbpC"
FT                   /locus_tag="RC0249"
FT   CDS_pept        complement(255730..258120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="RC0249"
FT                   /product="bifunctional penicillin-binding protein 1C"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02787"
FT                   /db_xref="GOA:Q92J20"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J20"
FT                   /protein_id="AAL02787.1"
FT                   /translation="MSLKTKLLFITLSSIIILYFAIPPAPLLKDVSFSQRVFDRNGELM
FT                   RISLSKDDKYRIFTPIREIPASFIETVLLYEDKHFYAHFGVNPVSLAKAFYSTYLQNNR
FT                   KIGGSTITMQVARLRYGINSSTILGKIHQIIKAIHVELHYSKDEILEAYLNLVPYGSNI
FT                   EGIAAGSYIYFNRDLKDLNLIDILSLAVIPQNPLKRGGNDINIFKARKYLFTEWLTIHP
FT                   QDIIYNKLISLPVKFNQNKKLPFIAPHFTLDILANNDSPIIHTTIDKNLQAAIEQQVRL
FT                   YINDRKKYGINNASVILIDFTTMEVLASIGSGEFFNNDICGQINGTKSHRSPGSALKPF
FT                   VYALSFDQSLIHPLTLLKDTPTYYDYYKPENFDSRFAGGLSARESLIKSRNIPVIFLAS
FT                   KLKNPNFYEFLQQAKISGLRKPENYGLSIVLGTAEITLEELTTLYAMLANFGTYKPLRK
FT                   VLDSTMSFLRKQESIKNYLNVGTKISYDLLDSRFRGNDTGEDKDDTDIVLLSPEASYLT
FT                   LDIIKDTTRPITYNNTRHNLPIYWKTGTSSSFRDALSVGIFGKYVLAVWVGDFKGQTHG
FT                   TFTGNIAAAPLFFNIIEAIARPNKDEDLILSKINALNITKVKVCADTGDIDNDMCPVKA
FT                   ETLFIQGKSPIKQSGIYRKMLIDLKTGMPTCNFIKGQTEYKTVNLWPTDMLAVYQKAGI
FT                   HILPKPIPTNHCNRLINWHHQKPKIIYPLKNSVHSIKNSDNITFSAISDNKTNNIFWFV
FT                   ENELIATAKPNEAVIWKAKAGEFIIRAISDSGESDSIKIYIKE"
FT   repeat_region   complement(256632..256669)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   256704..256731
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(258192..258231)
FT                   /note="REP01, repeated element"
FT   gene            258698..258994
FT                   /locus_tag="RC0250"
FT   CDS_pept        258698..258994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0250"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02788"
FT                   /db_xref="GOA:Q92J19"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J19"
FT                   /protein_id="AAL02788.1"
FT                   /translation="MTGEARADIEIYYILNHTADYQILTPAQKLNVIKGIQDRTDFGDL
FT                   VDDLMPGERRLFNNAIIEVTRLQAVVPVLNGARERREARAAGVEVVDLTVIQQ"
FT   gene            259239..259442
FT                   /locus_tag="RC0251"
FT   CDS_pept        259239..259442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0251"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02789"
FT                   /db_xref="GOA:Q92J18"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J18"
FT                   /protein_id="AAL02789.1"
FT                   /translation="MLNTLNQETALLNKFKSVATPEAKHKLLDQFKNYVNQNLVELESK
FT                   QSSIPIRQSVMKLADPAIVVNY"
FT   gene            259449..259643
FT                   /locus_tag="RC0252"
FT   CDS_pept        259449..259643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0252"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02790"
FT                   /db_xref="GOA:Q92J17"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J17"
FT                   /protein_id="AAL02790.1"
FT                   /translation="MDKLKEAYIDNGKIKIVNENDKVVDEQGLKSYNKILKDAGLITKD
FT                   LDGKKMQALINNFDALNNE"
FT   gene            259731..260000
FT                   /locus_tag="RC0253"
FT   CDS_pept        259731..260000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0253"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02791"
FT                   /db_xref="GOA:Q92J16"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J16"
FT                   /protein_id="AAL02791.1"
FT                   /translation="MAGVVPPPPPLPGGVAAPPPAGVGIRLAIARDIANLDAIGDDELK
FT                   LAGYKSKGKRRCCIKRKNSCTGTGCRQSSRRSFCSSEYFRQNIS"
FT   gene            260055..260336
FT                   /locus_tag="RC0254"
FT   CDS_pept        260055..260336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0254"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02792"
FT                   /db_xref="GOA:Q92J15"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J15"
FT                   /protein_id="AAL02792.1"
FT                   /translation="MRLGAATDLGMTIKTLLTLEERKSSLESLTLFSEAKPDKAQLMIK
FT                   AENIWNRLKDDDVIKQISRQALTLNNKIANKEFFKELFNEEEHNAIDR"
FT   gene            260988..261203
FT                   /locus_tag="RC0255"
FT   CDS_pept        260988..261203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0255"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02793"
FT                   /db_xref="GOA:Q92J14"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J14"
FT                   /protein_id="AAL02793.1"
FT                   /translation="MVAGGLPLPTRIGYNGLGMDGLVRKRNSLKPIVNLFPKKNTAVAV
FT                   AVAYIAPTSKIGDKIRNRCSSYSSFS"
FT   gene            261436..262359
FT                   /locus_tag="RC0256"
FT   CDS_pept        261436..262359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0256"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02794"
FT                   /db_xref="GOA:Q92J13"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J13"
FT                   /protein_id="AAL02794.1"
FT                   /translation="MNQDAGLMQQLKANNSRLAAIIEAAAVNEAEVATRHPESAAAQAV
FT                   ANGDVSYGGVVVVAPAVAFVVPVAPLVLPADPEEDAEEVIAVPAVAAPLAPAPVVINME
FT                   DVGVVPPPVEEAPHTGAEIMIVQRIERIVPLEGNIEGFDDKDDFNIEEDYENDDYNIIQ
FT                   ERTKVEVSSSTNKSESKDSEVSLANSKQEEARQEEEAKVVASIKEAAEASIAEAVRVEA
FT                   AEVVEMQNAVKQDEEMIGAIYNPIHDITQMSCNIISHRMFSSAVVAAGDEDEKVLDKSL
FT                   WIAGTYGTIIRKKVLLVIKVMLRVVL"
FT   gene            262278..262550
FT                   /locus_tag="RC0257"
FT   CDS_pept        262278..262550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0257"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02795"
FT                   /db_xref="GOA:Q92J12"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J12"
FT                   /protein_id="AAL02795.1"
FT                   /translation="MDCRYLRYYNTQKGFAGYKGHVAGGTIGFDIGSDNYKDLVGIAYT
FT                   KLDSKFKSNGSRSNTNIDSHIVTLYGQKELPKNFMIQAWYKIRPL"
FT   repeat_region   complement(262955..262983)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(262984..263004)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(263040..263073)
FT                   /note="REP01, repeated element"
FT   gene            complement(263126..263572)
FT                   /locus_tag="RC0258"
FT   CDS_pept        complement(263126..263572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0258"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02796"
FT                   /db_xref="GOA:Q92J11"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J11"
FT                   /protein_id="AAL02796.1"
FT                   /translation="MSENTIFKNILIPIDLNDKKSIKGILSKALMLATNFQAKLHFMYV
FT                   IPEFGTKMFEDYLPKHWRTEKKEKYKAQIKELIKQYIPDEIATDYYIGSGAVYDEIIKH
FT                   SNEIKADLIIISAVRLQLKDYMLGPNASKIVRHSDISVLVVRDE"
FT   gene            complement(263582..264574)
FT                   /locus_tag="RC0259"
FT   CDS_pept        complement(263582..264574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0259"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02797"
FT                   /db_xref="GOA:Q92J10"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J10"
FT                   /protein_id="AAL02797.1"
FT                   /translation="MVNIKKTKIPQIIQISFMNNFKLATIISIFLICSNIYAAPKVIKI
FT                   GTGSILKGYYAIGLDLCKTITNDDKNNEHITCEVVATNGSIENLKLLQQGKIDLALVQA
FT                   NIAVEAYEGIGYYHDQEKMQNLRQVLNLHDEFFTVIVKDEDTIKGFADIDGKKITNGPA
FT                   FSSSHITYDIVRSLYKFAKEPEELHINYEDSSDQLCNKEIDAIIMMVGHSNPLVNLIAN
FT                   KCKIDFISIDNDKITELIKQNRAFHKAILHKGLYPGITDNQTTVKVSAILVTRDEANRD
FT                   ILDKFIGAFHRNVANFKLSNYLLNNLDINYFADTKNFVLPKHDSVRNKN"
FT   gene            complement(264528..265598)
FT                   /locus_tag="RC0260"
FT   CDS_pept        complement(264528..265598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0260"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02798"
FT                   /db_xref="GOA:Q92J09"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J09"
FT                   /protein_id="AAL02798.1"
FT                   /translation="MIRKILLFVFLAFTIIWFATAYTIKNNVVSLMKNSESDNLKISYN
FT                   VVKFSGYPFNWKITVTDPKVKLIDHVNSKEFTCENIVLNIAFSTKRAVLNFGPFIREVD
FT                   NYGDKTFTYDVRSDDDIKGIGKFNKPLYKISKDDNLKEILKSIQLNNKALLIFKDNQEI
FT                   FKINDLAFLIRKQNLASEENISLFLNMNYYSEKDILNFKNANLDIAASLKFAEDGEDSA
FT                   ILQNFNIERFIFTCDNDSKINLNGDLQLFANKLPKGKLYFELENYNSIVDKLLPNNIIF
FT                   SKNIIKTIIAKAITKASDVQLNTEQNDSNSAYKNIEKAKFDIEFSDKGINIGAINLLEL
FT                   KLGEHKEDQNTTNNSN"
FT   gene            complement(265611..265949)
FT                   /gene="fdxB"
FT                   /locus_tag="RC0261"
FT   CDS_pept        complement(265611..265949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /locus_tag="RC0261"
FT                   /product="ferredoxin"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02799"
FT                   /db_xref="GOA:Q92J08"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J08"
FT                   /protein_id="AAL02799.1"
FT                   /translation="MSGKIKVTFIINDGEEKTVEAPIGLSILEIAHSNDLDLEGACEGS
FT                   LACATCHVILEEEFYNKLKKPTEAEEDMLDLAFGLTDTSRLGCQIILTEELDGIKVRIP
FT                   ATTRNIKL"
FT   gene            complement(266013..267800)
FT                   /gene="hscA"
FT                   /locus_tag="RC0262"
FT   CDS_pept        complement(266013..267800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="RC0262"
FT                   /product="heat shock protein hscA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02800"
FT                   /db_xref="GOA:Q92J07"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J07"
FT                   /protein_id="AAL02800.1"
FT                   /translation="MQIIEIREPEQADFKQERQIAVGIDFGTTNSLIAIAANRQVKVIK
FT                   SIDDKELIPTTIDFTSNNFTIGNNKGLRSIKRLFGKTLKEILNTPALFSLVKDYLDVNS
FT                   SELKLNFANKQLRVPEIAAEIFIYLKNQAEEQLKTNLTKAVITVPAHFNDAARGEVMLA
FT                   AKIAGFEVLRLIAEPTAAAYAYGLNKNQKGCYLVYDLGGGTFDVSILNIQEGIFQVIAT
FT                   NGDNMLGGNDIDVVITQYLCNKFDLPNSIDTLQLAKKAKETLTYKDSFNNDNVSINKQI
FT                   LEQLILPLVERTINIAQECLEQAGNPNIDGVILVGGATRIPLIKDELYKAFKIDILSDI
FT                   DPDKAVVWGAALQAENLIAPHTNSLLIDVAPLSLGMELYGGIVEKIIMHNTPIPISVVK
FT                   EFTTYVDNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGYIRAEVTFSIDADGI
FT                   LSVSAYEKISNTSHAIEVKPNHGIDKTEIDIMLENAYKNAKIDYTTRLLQEAVIEAEAL
FT                   IFSIERAIAELTILSSESEISIINSLLDNIKEAVHARDWILINNSIKEFKSKIKKSIDT
FT                   KFNIIINDLLKGKNINQIK"
FT   gene            complement(267791..268291)
FT                   /gene="hscB"
FT                   /locus_tag="RC0263"
FT   CDS_pept        complement(267791..268291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="RC0263"
FT                   /product="chaperone protein hscB"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02801"
FT                   /db_xref="GOA:Q92J06"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J06"
FT                   /protein_id="AAL02801.1"
FT                   /translation="MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQ
FT                   NLITAAELNNAYSTLKDALKRAEYMLLLQNINLNDEKTRSLLSPLELSIFWDEMEIIEN
FT                   TILFSDLEKIKDKYELMKKLEIDSLKQAFEEQNLSDATIKTSKLKYIGTLLHKLQEKIK
FT                   SCK"
FT   gene            268353..268934
FT                   /gene="rnhB"
FT                   /locus_tag="RC0264"
FT   CDS_pept        268353..268934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="RC0264"
FT                   /product="ribonuclease HII"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02802"
FT                   /db_xref="GOA:Q92J05"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J05"
FT                   /protein_id="AAL02802.1"
FT                   /translation="MEVDLLHFEKKYHNCIVAGIDEAGRGPLAGPVVASAVIVDNANII
FT                   TGIKDSKKLSKKKRELLYEQITSNYVWATAIISHTEIDDINILEATKKACSIAVANLSL
FT                   EPEIVLVDGNMQFKDERFVSIINGDNLSLSIAAASIVAKVTRDRLMLDLSAEFPQYLWH
FT                   KNSGYGTKEHIEAINIHGLSPYHRRSFRCC"
FT   gene            complement(268899..269078)
FT                   /locus_tag="RC0265"
FT   CDS_pept        complement(268899..269078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0265"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02803"
FT                   /db_xref="GOA:Q92J04"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J04"
FT                   /protein_id="AAL02803.1"
FT                   /translation="MWIPKSSSSLRGKTVSFDNLRSLLLFHEIATQPMAARNDYSVSTR
FT                   AIPLTTPKTPTMIR"
FT   repeat_region   268962..269025
FT                   /note="REP01, repeated element"
FT   repeat_region   269026..269056
FT                   /note="REP01, repeated element"
FT   gene            complement(269088..271073)
FT                   /gene="uvrB"
FT                   /locus_tag="RC0266"
FT   CDS_pept        complement(269088..271073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="RC0266"
FT                   /product="excinuclease ABC subunit B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02804"
FT                   /db_xref="GOA:Q92J03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J03"
FT                   /protein_id="AAL02804.1"
FT                   /translation="MNNFSIISEYKPAGDQPKAIDEIIAGLSSKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYYDYYQPEAYIART
FT                   DTFIEKDSSINEQIDLMRHAATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPG
FT                   QSYPRDQLLNDLINLQYERNDIGFERGCFRVKGDNIDIFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLAKLDKAMVFGNSHFVMPQETVNNAISGIEEELQKRLEFLKSQDKPLE
FT                   TQRLNQRTQYDLEMLTETGSCKGVENYSRFFTGRNAGEPPPTLFEYLPEDALLFVDESH
FT                   VSVPQIRAMYNGDRARKKVLVEHGFRLPSALDNRPLKFEEWDKFRPQTVFVSATPGPFE
FT                   LEETGGTVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTIAQGFRVLVTTLTKKMA
FT                   EDLTAYLQELKYKTSYLHSNVHTLERIEILRDLRQGTIDVLVGINLLREGLDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSAGRVILYADKMTKSIDKAVSETLRRRQIQQE
FT                   YNEKHGIIPKTINRAIHALAEFEKIDSKLDKKQAHTLFDNPAKLKTHIDKLKKEMLKAA
FT                   SNLEFEQAVKLRDQLKTLEEAALELS"
FT   gene            271144..271452
FT                   /gene="grxC1"
FT                   /locus_tag="RC0267"
FT   CDS_pept        271144..271452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC1"
FT                   /locus_tag="RC0267"
FT                   /product="glutaredoxin 3"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02805"
FT                   /db_xref="GOA:Q92J02"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92J02"
FT                   /protein_id="AAL02805.1"
FT                   /translation="MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQE
FT                   EKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLEKEGRLDKLLENQPKTTSPAAGA"
FT   repeat_region   complement(271464..271562)
FT                   /note="REP01, repeated element"
FT   gene            271512..271868
FT                   /locus_tag="RC0268"
FT   CDS_pept        271512..271868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0268"
FT                   /product="multidrug resistance protein (Atm1)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02806"
FT                   /db_xref="GOA:Q92J01"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J01"
FT                   /protein_id="AAL02806.1"
FT                   /translation="MLLFDEIVTLPTVARNDDLVSTRAMPACNGAENYQKMFKNKTRKN
FT                   SFSLLLPYLWSKDFDIRLRIVTSLICLVIAKVINIFVPIVYKYIINGLNKNFALSVMIG
FT                   IIVAYGGTKILVQQ"
FT   gene            271953..272153
FT                   /locus_tag="RC0269"
FT   CDS_pept        271953..272153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0269"
FT                   /product="multidrug resistance protein (Atm1)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02807"
FT                   /db_xref="GOA:Q92J00"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92J00"
FT                   /protein_id="AAL02807.1"
FT                   /translation="MRFHITRNTGGLSRSIERGTKGIEVVLRYSLFNIFPTSVEIILVS
FT                   GMLWYVYSIWFAVTILITMIV"
FT   gene            272417..272974
FT                   /locus_tag="RC0270"
FT   CDS_pept        272417..272974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0270"
FT                   /product="multidrug resistance protein (Atm1)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02808"
FT                   /db_xref="GOA:Q92IZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ9"
FT                   /protein_id="AAL02808.1"
FT                   /translation="MILSANAINQNKMTVGDLIMVNTYLFQLSILLSILGFAYREIKNA
FT                   LVSMEDMFKLLDIPVEVEDALNAKELIILKGAVSFDNVSFAYNQARPILHNISFTIKSG
FT                   KTLAVVGSSGTGKSTISRLLFRFYNINSGNVTIDGQDIREVTQQSLRKSIGIVPQDTVL
FT                   FNDTRYITTSHTVIIQQATMKL"
FT   gene            273125..273352
FT                   /locus_tag="RC0271"
FT   CDS_pept        273125..273352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0271"
FT                   /product="multidrug resistance protein (Atm1)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02809"
FT                   /db_xref="GOA:Q92IZ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ8"
FT                   /protein_id="AAL02809.1"
FT                   /translation="MMRQQVRLVLKAEKLIQARLKEISDHHTTLIIAHRLSTIIDADEI
FT                   IVLDNGYIVERGNHKTLLQHKGYYAELWYK"
FT   repeat_region   complement(273429..273455)
FT                   /note="REP10, short repeated element"
FT   repeat_region   273522..273564
FT                   /note="REP01, repeated element"
FT   gene            273816..274067
FT                   /locus_tag="RC0272"
FT   CDS_pept        273816..274067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0272"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02810"
FT                   /db_xref="GOA:Q92IZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ7"
FT                   /protein_id="AAL02810.1"
FT                   /translation="MNVPTTRSENLRWLKLEQFKCNHGSNYMFNKNNKLLSKILPFSKK
FT                   NKDLEKLRSKFKQRLAEQVTVDEITRIEQRSLYLESIK"
FT   repeat_region   complement(274266..274291)
FT                   /note="REP02, RS3-like repeat"
FT   gene            274436..277153
FT                   /gene="gyrA"
FT                   /locus_tag="RC0273"
FT   CDS_pept        274436..277153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="RC0273"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02811"
FT                   /db_xref="GOA:Q92IZ6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IZ6"
FT                   /protein_id="AAL02811.1"
FT                   /translation="MTDKSSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPV
FT                   HRRIIYSMHEAGNHASKPYRKSARIVGDVMGKYHPHGDSAIYDALVRMAQDFSLRLPLV
FT                   DGQGNFGSMDGDAAAAMRYTESRMAKVSYKLVEDIDKETVSFNPNYDGSEEEPSVLPAM
FT                   FPNLLVNGSGGIAVGMATNIPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGS
FT                   MILGISGIRSAYLTGRGSIIMRGRAEIENIGNNRQAIIITEIPYMVNKARLVEKIAEMV
FT                   KEKRIEGISDLRDESNKNGVRIFIELKKDVVAEVVLNQIYACTQLQTSFGVIMLALKDG
FT                   LPKVMNLKEVIAAFVSFREVVITNRTIYLLNKARDRAHILLGLTIAVSNIDEIIRIIKA
FT                   SNDSNAAKQELMARQWEALNILPLVKLVDDKAMLNEQGKCNFTEVQAKAILEMRLQRLT
FT                   AMEKNKLEEDLKNLITEITEYLNILGSRTRLLEILKEELIKVKEEFATPRLTSIEFGEF
FT                   DQDIEDLIQREEMVVTVTLGGYIKRVPLSSYRAQKRGGKGRSGLSMRDEDITTQVFVGS
FT                   THTPMLFFSNIGQVYSLKLYKLPLSNPQGKGRPMVNILPLKANEHITNIMPLPENQDER
FT                   DNLNIMFATAKGNIRRSDLLDFKKLQSNGKIAIRLDEDDKLIDVKPCKEDEHILLATKA
FT                   GKALRFPVESLRVIKSRTSDGVRGMKLAKEDSVISMTVLKGISSTKEDRDAYLSVPWEQ
FT                   RLEIAKGEAFNPEELGVSLTAPAIVEMANSEEFILTVTENGFGKRSSAYGYRITDRGGS
FT                   GIINMDINDKTGLVVGVMPVKMDDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLD
FT                   DGEKVVSVSLIAETAESEEDSELEEEGLEQSEEV"
FT   repeat_region   277292..277315
FT                   /note="REP03, repeated element"
FT   repeat_region   277345..277441
FT                   /note="REP01, repeated element"
FT   gene            277731..278051
FT                   /locus_tag="RC0274"
FT   CDS_pept        277731..278051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0274"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02812"
FT                   /db_xref="GOA:Q92IZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ5"
FT                   /protein_id="AAL02812.1"
FT                   /translation="MLNPLMSLEVQRLLYSISLSISIIGLFLPLIIFGLLFKSVVMLAK
FT                   DATRIVFLILLLVCGSNVCSTFISYYVGIYIYQFALSMISPICDDRICSVWLYLSCLFY
FT                   FK"
FT   gene            278248..278538
FT                   /locus_tag="RC0275"
FT   CDS_pept        278248..278538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0275"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02813"
FT                   /db_xref="GOA:Q92IZ4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ4"
FT                   /protein_id="AAL02813.1"
FT                   /translation="MAYAILKSYGLAEPTLFNYFTFYFVLAKFSVAAIPGGRIIVMLPI
FT                   LEQYLGFNTNMMSLITALYILFDPVITCANVLGNGAFVKLIDNIYSVTQKA"
FT   repeat_region   complement(278625..278676)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            278869..279054
FT                   /locus_tag="RC0276"
FT   CDS_pept        278869..279054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0276"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02814"
FT                   /db_xref="GOA:Q92IZ3"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ3"
FT                   /protein_id="AAL02814.1"
FT                   /translation="MMWLLIAIGLTVAVLIIGVVSMAIEGKFDKKFSSKLMTLRVFFQA
FT                   VAIFLLIIMYFYKVNL"
FT   gene            complement(279081..279296)
FT                   /locus_tag="RC0277"
FT   CDS_pept        complement(279081..279296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0277"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02815"
FT                   /db_xref="GOA:Q92IZ2"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ2"
FT                   /protein_id="AAL02815.1"
FT                   /translation="MHWGDIEEIAEQLEEHCSDQYNEKKISLLKLEKLIRDLKDFEDGE
FT                   KKVEEVTLEEILDKWEELREEIREID"
FT   gene            279505..280032
FT                   /gene="def1"
FT                   /locus_tag="RC0278"
FT   CDS_pept        279505..280032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="RC0278"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02816"
FT                   /db_xref="GOA:Q92IZ1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IZ1"
FT                   /protein_id="AAL02816.1"
FT                   /translation="MSILPIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGA
FT                   GLAAVQVGVLKRILVIDIQDHDSVARPKDFYPLFIVNPEIIEKAEELVTANEGCISLPE
FT                   QRIEVARPESIKIRYLDYHGKSRELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVV
FT                   LRKLKKLKNNIV"
FT   gene            280029..280940
FT                   /gene="fmt"
FT                   /locus_tag="RC0279"
FT   CDS_pept        280029..280940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RC0279"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02817"
FT                   /db_xref="GOA:O33519"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33519"
FT                   /protein_id="AAL02817.1"
FT                   /translation="MKVIFMGTPEFAVPALKKLITHHEVKAVFTQQPKAKGRGLNLAKS
FT                   PIHQLAFEHQIPVYTPSTLRNDEIINLINKVNADIIVVIAYGFIVPKAILEAKKYGCLN
FT                   IHPSDLPRHRGAAPLQRTIIEGDRKSSVCIMRMDTGLDTGDILMKEDFDLEERITLEEL
FT                   HNKCANLGAELLIKTLANIDNIVPITQPSDGVTYAHKLTKEEGKINWHESAYKIDCKIR
FT                   GMNPWPGAYFSYNDKIIKILEAEYLNADHHFTSGTVISDKLEIACGSGILRVKKLQQES
FT                   KKALNIEEFLRGTNILKDTVLK"
FT   gene            281122..281538
FT                   /locus_tag="RC0280"
FT   CDS_pept        281122..281538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0280"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02818"
FT                   /db_xref="GOA:Q92IZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IZ0"
FT                   /protein_id="AAL02818.1"
FT                   /translation="MKKTPHGKTSQYEISGFINKAGAHINDPKQIKEISKLYAHAVFAD
FT                   LQKNILGKFDKNGNLSITKDCAIDENPVFRKDGKLLWVKTQSGLINREGEMTAVNHILQ
FT                   KGRFLFEDLGGNVDTKLGTTNLNKKPTKPILKRG"
FT   gene            281797..284557
FT                   /gene="rrl"
FT                   /locus_tag="RCRNA07"
FT   rRNA            281797..284557
FT                   /gene="rrl"
FT                   /locus_tag="RCRNA07"
FT                   /product="23S ribosomal RNA"
FT   gene            284830..284948
FT                   /gene="rrf"
FT                   /locus_tag="RCRNA08"
FT   rRNA            284830..284948
FT                   /gene="rrf"
FT                   /locus_tag="RCRNA08"
FT                   /product="5S ribosomal RNA"
FT   gene            285348..286025
FT                   /locus_tag="RC0281"
FT   CDS_pept        285348..286025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0281"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02819"
FT                   /db_xref="GOA:Q92IY9"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="InterPro:IPR024698"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY9"
FT                   /protein_id="AAL02819.1"
FT                   /translation="MPRLIILKESALEYDRIYINNLKYSWQIKSLEIVLNYLNILEDKI
FT                   FIVNSDCIIQATRLIVPSVPFIPVKGTPLPLWLKKDLRNIFIKDNSKVYDKIYISRKYA
FT                   STRKIVNEEELIEKIERSGLKVIYLELSFPYEQARLFNKAKIIVGSHGSGFANFIFAAP
FT                   KCKVVEIDHGTTPSRSFYKRMANYMSCDYYPFYVDHQTTEEHLEDDIKINIDEFIKFLR
FT                   GHL"
FT   repeat_region   286006..286070
FT                   /note="REP06, A and T rich repeated element"
FT   gene            complement(286073..287125)
FT                   /gene="n2B"
FT                   /locus_tag="RC0282"
FT   CDS_pept        complement(286073..287125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="n2B"
FT                   /locus_tag="RC0282"
FT                   /product="putative ATPase n2B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02820"
FT                   /db_xref="GOA:Q92IY8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY8"
FT                   /protein_id="AAL02820.1"
FT                   /translation="MIKSSTSLIQDSKQTALREELKQLAAALNKPKSLFKFFNQNNLES
FT                   GIYLYGPVGSGKTMLMNSFCEELTTPKIIIHYQNFMQEIHKSMHKLQTANQKDIIPKIA
FT                   KNYTKQTKVLCIDEFEIKDITDAMIIGRLFNELIKQNIFIFITSNTSPNNLYKDGLQRE
FT                   SFLPFIKIINNTFYVKYLDNQHDYRFDKALRVKEARIIYPLTLENQNKLEKIITDISDN
FT                   NLAPQNIQVLGREISFQKVHKRILVTDYNELFTRGLSYIDYVNICQNFNVIIVGNVHTI
FT                   DSNDTNTAVRFINFIDNAYFYKILLFMSLEDNPNKIYQGSARAAEFKRTISRLNEMNSE
FT                   SYLLNNDFKN"
FT   repeat_region   complement(287198..287235)
FT                   /note="REP08, short repeated element"
FT   repeat_region   287248..287329
FT                   /note="REP01, repeated element"
FT   gene            complement(287340..288437)
FT                   /gene="queA"
FT                   /locus_tag="RC0283"
FT   CDS_pept        complement(287340..288437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="RC0283"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02821"
FT                   /db_xref="GOA:Q92IY7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IY7"
FT                   /protein_id="AAL02821.1"
FT                   /translation="MKLSDFDFDLPSELIAQYPSSERDNSDLLIAVTPPIKTKFYNIID
FT                   YLKEGDLLVFNNSKVIKAKLNLGKNITINLNQKLSDDNWSAFAKPARKLHVNDEFYFDN
FT                   HKVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTTGSKT
FT                   YLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEGIQA
FT                   TFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAEIINKAKQEGKRIIAVGTTTLR
FT                   TLESSCNNGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKEMH
FT                   ELYKYAIKEAMRFFSYGDATLLCRK"
FT   repeat_region   complement(287904..287935)
FT                   /note="REP03, repeated element"
FT   gene            288604..288807
FT                   /locus_tag="RC0284"
FT   CDS_pept        288604..288807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0284"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02822"
FT                   /db_xref="GOA:Q92IY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY6"
FT                   /protein_id="AAL02822.1"
FT                   /translation="MIIDDIIRNKFHEILSSKDIEENMGFNNIYKIKRYEFFRESFVKE
FT                   FKALIEDPNTEVYTLEGEAKSF"
FT   gene            289197..289589
FT                   /locus_tag="RC0285"
FT   CDS_pept        289197..289589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0285"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02823"
FT                   /db_xref="GOA:Q92IY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY5"
FT                   /protein_id="AAL02823.1"
FT                   /translation="MVRDKEAIYEPLKALLTLESTLRKNDYKKIKAIDKKDLAAFVQWK
FT                   AAILPVVKDVSKNDSIKQPLIELVGKIAKLIPPLEFLCILKIEDIIDSNATDKIELPKS
FT                   AIKAMTECGLLQVEATGDIVAHNDLV"
FT   repeat_region   complement(289612..289636)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(289657..291426)
FT                   /gene="abcT3"
FT                   /locus_tag="RC0286"
FT   CDS_pept        complement(289657..291426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT3"
FT                   /locus_tag="RC0286"
FT                   /product="multidrug resistance ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02824"
FT                   /db_xref="GOA:Q92IY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY4"
FT                   /protein_id="AAL02824.1"
FT                   /translation="MIKYPTLSKSTFSLSIYFLKFDKVKMTLLTVICILLGMIPAIDSI
FT                   LLQKIIDLIESFSDKNANNLLSSMIYWAVFYALWWESINIAYRSYDYLYLKTMPIIKGK
FT                   ILNELYNYTQYHSHKFFQDNLAGHISNRITETARSFEMIISIFGEKILRKLAIIVFALI
FT                   ALHSVHYVFATIFILWITVFLGLSVLFSDKINKYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAVADEQTMQFFMFKLRYALGTSCSIMIFIMIYYLSKLRSE
FT                   LSISIGDCVLVLTLCINVADDIWDLTQEIGDMFEQVGAFNQGLSLMAPHIITDIANATP
FT                   LDIKEGVIEFRNVTFNYHHNNKLFYNKSVLIPSKQKVGLVGFSGSGKTTFISLVTRLHD
FT                   IEEGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILDNIRYGKKEATLEEVIEAA
FT                   KAAHIHDVIDNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESLIQESMDYLMQNKTVIVIAHRLSTLLNMDRILVFEKGSIIDDGNHAELLKNSKLY
FT                   QKLWNSQVKGLIV"
FT   gene            291606..291878
FT                   /locus_tag="RC0287"
FT   CDS_pept        291606..291878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0287"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02825"
FT                   /db_xref="GOA:Q92IY3"
FT                   /db_xref="InterPro:IPR022715"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY3"
FT                   /protein_id="AAL02825.1"
FT                   /translation="MQEKELSNNFLEEQEKSKEDDSPFFDVKYICQASLLITDSIRKGY
FT                   DVTQLPNGDINVTEVRIVNVHYNWNSEKGKFVKTNQIEFNNSKGG"
FT   repeat_region   complement(291894..291929)
FT                   /note="REP04, repeated element"
FT   gene            292033..293403
FT                   /gene="cydA"
FT                   /locus_tag="RC0288"
FT   CDS_pept        292033..293403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="RC0288"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02826"
FT                   /db_xref="GOA:Q92IY2"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY2"
FT                   /protein_id="AAL02826.1"
FT                   /translation="MEFDQGLLSRIQFAFTISFHIIFPAFTIGLASFLAVIEGLWLKTK
FT                   KPVYQEIYKFWVKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVLGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVSKKVHFISTLIVAVGTVISAFWILAASSWMHTPAGFELRGE
FT                   GFFYPLNWLEIIFNPSFPYRFFHMIMAAYLTTSFVIGGVASFYLLNNRYKEHAKIMLFM
FT                   AVLMALIVAPIQIVIGDLHGLNTLKYQPVKVSAMEGIWNTDKGAAFNLIGFPDGEEEKT
FT                   KYAVEIPYASSLILTHSLDGEVKGLKEWTKEERPPVAVVFFSFRIMVGIGCLMVFIGIV
FT                   GLYLYLKKRLYTTHWFQYWYILMSPSGFIAVLAGWFVTEVGRQPYIVYNILKTVDTVSP
FT                   VLGKYVFISLIAFIVVYVIIFGAGIYYIMHLIKKGIEVIDNKEMYGESGLNNPLLEK"
FT   gene            293411..294430
FT                   /gene="cydB"
FT                   /locus_tag="RC0289"
FT   CDS_pept        293411..294430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="RC0289"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02827"
FT                   /db_xref="GOA:Q92IY1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY1"
FT                   /protein_id="AAL02827.1"
FT                   /translation="MLNFAPYIDLPLVWGGLIATAICLYVLLDGFDLGVGILFPFAPTD
FT                   DCRHKMINSIAPFWDGNETWLVLGGGGLFAAFPLAYSLLMPALYIPIILMLLGLIFRGV
FT                   AFEFRFKAHIGHRYIWDYAFHFGSMITVFCQGLMLGTFVQGIEIEGREFAGGSFDFLTP
FT                   FSVMTGIALIFGYALLGATWLILKTEKTTQDWAYKSALYILFYVALFMGLVSLWVPFLN
FT                   NHINHRWFSVPNLYYLSIVPIVTALIFIKLIKAVKQKKEVKPFIYTILLFLLGYLGLAI
FT                   SIWPYIVPYKVTLETAAAAPESQSLLLIGAGIFLPVILGYTFYCYYIFRGKSSHHPIY"
FT   gene            294566..294874
FT                   /locus_tag="RC0290"
FT   CDS_pept        294566..294874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0290"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02828"
FT                   /db_xref="GOA:Q92IY0"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IY0"
FT                   /protein_id="AAL02828.1"
FT                   /translation="MTKRTVYSTLLILSLTNYKEKIMEIYNTSEARSKLYKLIDYVSDV
FT                   HKPVYIKGKRNNVVIISEEDYRNMEETLYLLSIPNMRKSIIEGRAEPIAKCSDKLNW"
FT   gene            294885..295145
FT                   /locus_tag="RC0291"
FT   CDS_pept        294885..295145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0291"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02829"
FT                   /db_xref="GOA:Q92IX9"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX9"
FT                   /protein_id="AAL02829.1"
FT                   /translation="MYIIRYTIQVQKDAKKIVQAGLKNKVEVLLNIVSTDPWKIYPPYE
FT                   KLVGDFSGCYSRRINIQHRLVYEVYKQEKVVKILRMYTYYE"
FT   gene            295138..295986
FT                   /gene="lgtF"
FT                   /locus_tag="RC0292"
FT   CDS_pept        295138..295986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="RC0292"
FT                   /product="beta 1,4 glucosyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02830"
FT                   /db_xref="GOA:Q92IX8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IX8"
FT                   /protein_id="AAL02830.1"
FT                   /translation="MNKSLTEKISAFIITKNESTRVARAINSVKNITDEVIVVDSESTD
FT                   DTVAIAEKLGAKVVIKPWLGYVGQKSFAESLCVNDWVLNIDADEELSKELQDEIEYIFA
FT                   SHNQDRYLAYQIKLLIMHRNDQKPRMFAPFNKCTRLYNKKFASFANTVNSTTHDSVIFN
FT                   KDVDFAGKIYLLNEAAYHYSGTSIEQLVTKANFYSNEQAKDLVKQGKKLSNFRLTTEMI
FT                   WWFFKAFFIRRYFVFGVDGFVDSIIFAFARFLRLTKLRESSLKSKNVIASDYKERGNFM
FT                   K"
FT   repeat_region   295965..296006
FT                   /note="REP01, repeated element"
FT   gene            296063..297301
FT                   /gene="mpp"
FT                   /locus_tag="RC0293"
FT   CDS_pept        296063..297301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpp"
FT                   /locus_tag="RC0293"
FT                   /product="protease"
FT                   /EC_number="2.3.1.129"
FT                   /note="similar to mitochondrial protease"
FT                   /db_xref="EnsemblGenomes-Gn:RC0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02831"
FT                   /db_xref="GOA:Q92IX7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IX7"
FT                   /protein_id="AAL02831.1"
FT                   /translation="MKENFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEED
FT                   GISHFLEHMAFKGTKTRTAKQIAEAFDAIGGHFNAYTGHENTVYYARVLSENCDKALNI
FT                   LADIIQNSIFSDEEIAKEYQVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTA
FT                   KTLATFTKEHFFNFIDKYYNAANLYLSIAGNIDHDKIVIIAEQLFSSLKQGVKSSFIPA
FT                   KYIGGNGFINKELEQTSLVLGFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKL
FT                   GLAYAVGSYNSAYFDSGVFTIYASTAHDKLELLYKEIKNEIIKMTEQVSTEEILRAKTQ
FT                   LRSNLQMAQEKNTYKSEEIGKNYSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTT
FT                   TSAIIGPNDLQGF"
FT   repeat_region   297329..297427
FT                   /note="REP01, repeated element"
FT   gene            297455..298165
FT                   /gene="purC"
FT                   /locus_tag="RC0294"
FT   CDS_pept        297455..298165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="RC0294"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02832"
FT                   /db_xref="GOA:Q92IX6"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IX6"
FT                   /protein_id="AAL02832.1"
FT                   /translation="MKKKLYEGSSKILYSAEEDFLLIMAFSDKAILETGEIVDISGKGV
FT                   LNNNISSFLMDKLEMIGIENHFIEKINMREQLIQYVEVFPIQVIISSVACSRFVKEFGI
FT                   DEGYVFDKPIIDFKVRSREFKYPIVNEYQILNFGWLTRDEIKAVKEQALRIYDFLSGLF
FT                   IGVGIRLVECKLEFGRVFNGEESIIMLTDEISPDNCRLWHINSNEKLGFELLEKEPNKV
FT                   FESYQLIADRLKEK"
FT   repeat_region   complement(298233..298323)
FT                   /note="REP01, repeated element"
FT   gene            298385..299971
FT                   /locus_tag="RC0295"
FT   CDS_pept        298385..299971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0295"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02833"
FT                   /db_xref="GOA:Q92IX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX5"
FT                   /protein_id="AAL02833.1"
FT                   /translation="MKIRFIIISFIALILVGWGYAAYKFEHQSKENIISILDKYEKYIT
FT                   YDAIKVNKYGFSVTLNKVMLKPIDFYFDEIVIRHIPFLNITKIDSYGNNVKITTAQDEK
FT                   NIFYSPDHHTTIWFRKSLFNREPDYWTLSLSDNKSTLYSSLDAEKLAESDISNSVITNT
FT                   KTSDNLNLLILDGKSTVSFISENYRRNLYDKIFEFLRDQIANDSDTAFFEYGLTKLDIL
FT                   NLPISYNSKLKLKYSDELVALGKLLIQNVSLDQRQDENMHAVIFMQMLGELVKGKPFLV
FT                   ACDIERKGKVESNLYKLNIEKDKIFDFALNIKSTIEPSETYQKTAAEALGSYFSNGLNK
FT                   RAELDKIFKLTSPITQEDGERVMGVFAKINNSEFNLKGQFDPEAKKLSGNTNLVMDDFN
FT                   FAIDIDMPTIDNPLNLESVIKLSDPSVVINNFVHYTNNAIVPVLNKIKDSKEFALNLGK
FT                   QSSVIKQYGFRAIEVFSKNSELKDGESLVVDVKSKDAGLTFNDKAIDQILSDARVLEFI
FT                   NAMAMIDQESK"
FT   repeat_region   complement(299978..300007)
FT                   /note="REP02, RS3-like repeat"
FT   gene            300067..301974
FT                   /gene="thrS"
FT                   /locus_tag="RC0296"
FT   CDS_pept        300067..301974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="RC0296"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02834"
FT                   /db_xref="GOA:Q92IX4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IX4"
FT                   /protein_id="AAL02834.1"
FT                   /translation="MINISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQ
FT                   DLSIVIDNDCKLRILTAQDPECLEIIRHDAAHLTAEAVKELFPETQVTIGPAIENGYYY
FT                   DFARDKPFTTDDLAVIEAKMQELSQKNEQVTRELWDRDKAVEFFKSIGEHYKAEIIASI
FT                   PAGEPITLYRQGNFIDLCRGPHAPSTGVVKHFKLMKVAGAYWRGDSRNEMLQRIYGTAW
FT                   ATKEQLDSYLLMLEEAEKRDHRKLGRELDLFHFQEEAQGMVFWHDKGWSIYNTIEQYIR
FT                   KKIRKNGYTEVKTPVLVDKSLWEASGHWEKFRDDMFALETDDKTLALKPMNCPCHVQIF
FT                   KQGIKSYRDLPLRMSEFGLCHRNEASGALHGLMRVRSLVQDDAHIFCAAEQITDETVSF
FT                   CKLLTEVYKDFGFTDIKVKFSDRPEIRAGSNEVWDKAENALKEAVEQAGFNYTLNPGEG
FT                   AFYGPKLEFVLTDAIGRQWQCGTLQMDFVLPERLDASYVAASGEKKRPVMLHRAILGSL
FT                   ERFIGILIEEYAGRFPLWLAPVQVAIATITSDLNDYALEVQKALIDNGVRTDFNISPDK
FT                   INYKIREFSNQKIPMIAVIGKQEQENKQVAIRRLGTTDQEVLSVEQLIAVVKEENEKYL
FT                   "
FT   gene            302062..302286
FT                   /locus_tag="RC0297"
FT   CDS_pept        302062..302286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0297"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02835"
FT                   /db_xref="GOA:Q92IX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX3"
FT                   /protein_id="AAL02835.1"
FT                   /translation="MRTIINIADSQIKILDKISKKKISRDKIIGQALTSYIASNDHNNK
FT                   AFENAFGLWKDKNLDSVEYQTKLCNEWNK"
FT   repeat_region   302415..302445
FT                   /note="REP02, RS3-like repeat"
FT   gene            302539..302925
FT                   /locus_tag="RC0298"
FT   CDS_pept        302539..302925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0298"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02836"
FT                   /db_xref="GOA:Q92IX2"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX2"
FT                   /protein_id="AAL02836.1"
FT                   /translation="MKIKTYPVSFLWSVIKPYKYWYFVMMLGPIASGFHPIIYNYAVKL
FT                   LLDLFTQNEKIIFARSYKPIIWFVAAQAILDGAWRAHNFAQLKAMPHIFQGMMHKICNH
FT                   CFNVPYTYFQNNLSGSIVGRYGAR"
FT   gene            302858..303130
FT                   /locus_tag="RC0299"
FT   CDS_pept        302858..303130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0299"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02837"
FT                   /db_xref="GOA:Q92IX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX1"
FT                   /protein_id="AAL02837.1"
FT                   /translation="MCRILIFKITFPVLSLEGTGLGDNYYKMYQAIEYQLSKPLLITLL
FT                   SGVALGLTNIKVFVVISTFMAIDLPLALQFFTKLATMEQDKQDSW"
FT   gene            303367..303543
FT                   /locus_tag="RC0300"
FT   CDS_pept        303367..303543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0300"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02838"
FT                   /db_xref="GOA:Q92IX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IX0"
FT                   /protein_id="AAL02838.1"
FT                   /translation="MSLTFLVTENSWHATMELKDFLEDIAAFRSAFTIMQIPQDTIDKK
FT                   CCCIKNLQRGNYI"
FT   gene            303830..304225
FT                   /locus_tag="RC0301"
FT   CDS_pept        303830..304225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0301"
FT                   /product="multidrug resistance ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02839"
FT                   /db_xref="GOA:Q92IW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW9"
FT                   /protein_id="AAL02839.1"
FT                   /translation="MPWAIENAAKAANIHEFIESLPEKYNTIVGERGVKLSGGQRQRIA
FT                   IVRVILKNAPILVLDEATSSLDSHTEQEVQKSINTMLDIENVTIIAIAHRLSTIKHMDR
FT                   IIVMDKGKIVEDGTFKELWEYQVNGFV"
FT   gene            complement(304332..304532)
FT                   /locus_tag="RC0302"
FT   CDS_pept        complement(304332..304532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0302"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02840"
FT                   /db_xref="GOA:Q92IW8"
FT                   /db_xref="InterPro:IPR016908"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW8"
FT                   /protein_id="AAL02840.1"
FT                   /translation="MEKQLAELDSDISIKGRKMSKRIQKCLKKKVFYPIAAPVSGNSYA
FT                   RSNYSNCPSCKKDWQFKNNIS"
FT   gene            complement(304706..304912)
FT                   /locus_tag="RC0303"
FT   CDS_pept        complement(304706..304912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0303"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02841"
FT                   /db_xref="GOA:Q92IW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW7"
FT                   /protein_id="AAL02841.1"
FT                   /translation="MVFYAVIPNKDALHASHLSYHALKDKDELEQLGVIISYKITADYV
FT                   SETPIDIEKNIENAKFLYLYPIA"
FT   gene            complement(305232..305648)
FT                   /locus_tag="RC0304"
FT   CDS_pept        complement(305232..305648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0304"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02842"
FT                   /db_xref="GOA:Q92IW6"
FT                   /db_xref="InterPro:IPR022589"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW6"
FT                   /protein_id="AAL02842.1"
FT                   /translation="MSNSNTHILIAIGCLLALLLIFLMYKKIAARKKNILPAERGNIDD
FT                   SPNVALNSQKPENQKLTLQERIELSWKFLYNITEVILNKFSKEDVIQVNKCGQVLFENG
FT                   VRYEHVVDLAIPQVKSHTQTVEQEQSKGKKALGV"
FT   gene            complement(305845..306327)
FT                   /locus_tag="RC0305"
FT   CDS_pept        complement(305845..306327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0305"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02843"
FT                   /db_xref="GOA:Q92IW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW5"
FT                   /protein_id="AAL02843.1"
FT                   /translation="MTLKKLLPKITKLHNDIKEIREEATSHEKLENIYEKAKKVATISE
FT                   ISKEPTRKIIEIANKNPNNQASLENIVKATKAIPKSKDEVEEKITELKSNIESAIPQDT
FT                   NIDKLNSVKNTIAGNLNEAKTELLKVLHPEASCSEKIESLCKAAEKATKIASNIKK"
FT   gene            307039..308400
FT                   /gene="tolC"
FT                   /locus_tag="RC0306"
FT   CDS_pept        307039..308400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="RC0306"
FT                   /product="outer membrane protein tolC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RC0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02844"
FT                   /db_xref="GOA:Q92IW4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW4"
FT                   /protein_id="AAL02844.1"
FT                   /translation="MRKLITFIVTLLLTSSVAAVDLQGALTEGYKNNEELKAARIKFLD
FT                   SMEQFPRAFSGFMPSAGLQINRQHNKTKYNKKYADRLGLTPRDTDSDQGALTIQQSLFN
FT                   GGSSVAALKAAQAGFRAARGAYYAGEQKILLNLITAYLDCFESKAKYDISESRVRTNIQ
FT                   QVNTVEEKLRLGEATEVDIATARAGLAAAETNKLAAYADFQGKKANFIRVFGIEPTNIT
FT                   MPELPKMLPASLDELTRRAAKLNPDIDSARHNVTAAKALEMAEKGKLLPQVSVQLQSGR
FT                   TYYNPQGDINAINNRSYTTTLSVNIPIYPEGGAQYSRIRSAKNQTRNSAVQLDNVIKQT
FT                   QAGVVSVWEGFEAAKSRIVAANQGVDAAQISYDGTVQEEIVGSKTILDVLTAEEKLYEA
FT                   KITRVDAYKSSVLAAYQMKLLTGELTAQSLKLKVKYFSPEEEFKTIKKKMFIGF"
FT   gene            308402..308800
FT                   /locus_tag="RC0307"
FT   CDS_pept        308402..308800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0307"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02845"
FT                   /db_xref="GOA:Q92IW3"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW3"
FT                   /protein_id="AAL02845.1"
FT                   /translation="MSKDNKKNQDMSIEDILKSIKGVINERKNPIHENDSEDEDVLELT
FT                   EIVNQDEEEKLISTKSAEEVGDIFKNFTDTIKDKKLDNNISSKNALEELVIEMLKPELK
FT                   AWLDKNLPVLVKELVEIEIKKLVQNSKR"
FT   repeat_region   308852..308880
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   308882..308942
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   308943..308971
FT                   /note="REP02, RS3-like repeat"
FT   gene            309017..310729
FT                   /locus_tag="RC0308"
FT   CDS_pept        309017..310729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0308"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02846"
FT                   /db_xref="GOA:Q92IW2"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW2"
FT                   /protein_id="AAL02846.1"
FT                   /translation="MLNNLCKILFFINLLLVIVQSYASPPPLPPSLPAAAVDTKDKDVR
FT                   SSADISFFDKFKQFFSKPKKKDIPPKQASEQTKAAHQEEPKLASQEPNDNEQAEPFIDV
FT                   GNTALPSATSDNVHTNPSHESSVNLASHDIQESNEAEASEPFIDIGSATLPSVTSNEMH
FT                   EAQVASNEHNDTNLASNIIIPNVPRPIVSMPPAQAESYVVPPQRPVQIYKPTNLPPVHK
FT                   PIPLNPPPDANKEEESAALPSITNIPAVSPPVVSPPVTQDNTSSTMPTTVPPAVPRNVP
FT                   APSVMPINQPSTQPITPTSPNTPVTTPSKVIPTTDSSAELNNSQETFVAVSDVPKKQDW
FT                   NTPLIPVVVVKLNQLQPLQINNNQTTNNQEKSPPVSSPNVTIQKQDNNVNNETSELVTK
FT                   FVKDETQMLFLPDDDIVLGKLTEQATLEQMDMYAYIELFQKKAEWIASAERRKVVESFI
FT                   KYGNDINKKKDIYANLSYCSAVENAFRAVDRNNLFGLRALLDVYPILQEKGRSGETLLT
FT                   AAIYNDNYYLAKFLVIRGIKISTLNDECQYPLDIALAQGNANIACMLIKAKGY"
FT   repeat_region   310744..310768
FT                   /note="REP01, repeated element"
FT   repeat_region   310769..310817
FT                   /note="REP01, repeated element"
FT   gene            310939..312927
FT                   /gene="gyrB1"
FT                   /locus_tag="RC0309"
FT   CDS_pept        310939..312927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="RC0309"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02847"
FT                   /db_xref="GOA:Q92IW1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IW1"
FT                   /protein_id="AAL02847.1"
FT                   /translation="MSDLFSFNKEKKNKLVDNNYSAKDIEVLEGLEPVRKRPGMYIGGT
FT                   DSNAMHHLVSEVLDNAMDEAVAGFASIITITMHHDHSITIFDNGRGIPIDNHPKFPDKS
FT                   ALEVILTTLHSGGKFSNNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGKLYSQSYSKG
FT                   EKLTDLICEEASKRLRGTSINFTPDPEIFSEKLHFNPKKIYELARSKAYLYRGVTIEWA
FT                   CEVEVQSDIPKKALISFPNGLKDYLSSKITLDNLVIPGIFAGNIESKSDRIKLEWAICW
FT                   QNNDSSAFVQSYCNTVPTPQGGTHEQGLKSAILRGLKAYGEMIGNKKAANLTIEDILET
FT                   ASVVLSIFIAEPSFQGQTKEKLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVIS
FT                   IAEFRISKKNEKNISRKNATQKLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARN
FT                   RETQAVLPLWGKVLNVASSTLEKIVNNQAIQDLEIALACGSLKNYKKENLRYEKIIIMT
FT                   DADVDGAHIASLLMTFFFLRMPKLVEEGHLYLAKPPLYRLTQSNKTYYAGDEEEKAKLM
FT                   DKLLKASKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLADFQNVDKIVDDLMG
FT                   KKPEKRFQFIYEQALVKMDKIISELDI"
FT   repeat_region   312981..313008
FT                   /note="REP01, repeated element"
FT   gene            313004..314413
FT                   /gene="ctp"
FT                   /locus_tag="RC0310"
FT   CDS_pept        313004..314413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="RC0310"
FT                   /product="tail-specific protease precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02848"
FT                   /db_xref="GOA:Q92IW0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IW0"
FT                   /protein_id="AAL02848.1"
FT                   /translation="MTLCLKNTHIWSIMLLRLIITLFFIINSICAFAEGEKETENKISN
FT                   QEAYKQFQDVFERIEKAYVQVPDRQKMIDEAINGMLNSLDPHSSYYTDEDLEDIVTFTK
FT                   GEFGGIGVEIMYDSGAIKIISPIDDLPAFKAGLKGGDYIVGVNDELVSTLGPNKAIKEM
FT                   RGTPGTKVKLLIIKEEEAKPQELELTREIVKIKPIKAHLEKNNIAYIRITTFNESTISE
FT                   LKAAVKKLKTESKDDLKGIILDLRNNAGGILDQAIAVSDYFIDSGVIVTTKGRTTSSNS
FT                   EIKANEFSLKAPKVPMIVLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQ
FT                   INSRAAVKLTISKYYTPSGRSIQAEGIEPDILIEPAKVEYPEVKKIDKRFSESSLKNYL
FT                   KNDNEKNKDNASKNKDSQKETKAKNNKQEENELSELYKKDYQFARAYDVITGLIINKKL
FT                   ETKERVKQEDK"
FT   repeat_region   complement(314522..314558)
FT                   /note="REP01, repeated element"
FT   gene            314628..316121
FT                   /gene="barA"
FT                   /locus_tag="RC0311"
FT   CDS_pept        314628..316121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="barA"
FT                   /locus_tag="RC0311"
FT                   /product="histidine kinase sensor protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02849"
FT                   /db_xref="GOA:Q92IV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV9"
FT                   /protein_id="AAL02849.1"
FT                   /translation="MNHNKYIVRLSFIILFLNIVINMMFYRYFMIKEMIVKQVALEHTK
FT                   IVELYTDNIWNTHQNVISKLRKFDYLKLLQDQDFINFAKVTTQWFTNLNINISLYDLKG
FT                   NKFITSNMLHMYSVDNYKDDSLVEIVTAKIDKFFLKSFTSKAPLRDAFEGITSHILLPR
FT                   VVIENESDLTVEEASFVTSYIPVINNNLDFPVDAVFEINTNITSQWQNITSLEQKVFIT
FT                   FIIIFIIFCTIIISNTNYARQIIEEQLEINRNLKAQIVKVEKTSSSNTKFFTNISHELR
FT                   TPLNAIIGFSEILMSERDAEKSKNYIKDINDAGKHLLSMINDILDLSKASADKLKVDSI
FT                   DLDLNKLIRSSLILVKTRADQAEVALISRLPKEHVVIKADPKRLKQVFLNLLSNAVKFT
FT                   NSGGSVTIALEKDELAKLVYIKVIDTGIGIEEKDIPKTLSAFGQIDSELSRKYEGTGLG
FT                   LPLTKKLVELMNGKFDLQSKINEGTTITITFTYDCSIEI"
FT   gene            316187..316924
FT                   /locus_tag="RC0312"
FT   CDS_pept        316187..316924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0312"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02850"
FT                   /db_xref="GOA:Q92IV8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV8"
FT                   /protein_id="AAL02850.1"
FT                   /translation="MKLIVLLFTFLFSMFSFGESETIKGKPLKYAANNDFENRLDEQEQ
FT                   EIRRLIGKVEVLQHKIDMLKQNSNISNQEENTEVLEAGDSKKQDVFDIALLKDMPDNAP
FT                   KKPIAVNKDIAPDKQAYDLALAAYKDNKLTEAKDKFKHFIQNYPNSLLISNAYFWYGEC
FT                   FFKQKDYNRAAVNYLKGYKELPKGAKSSDGLLKLALSLGELKKTQEACNMLAKFDKEFP
FT                   TNRTAASKKMAEDAKIKFGCKNK"
FT   gene            316937..317599
FT                   /locus_tag="RC0313"
FT   CDS_pept        316937..317599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0313"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02851"
FT                   /db_xref="GOA:Q92IV7"
FT                   /db_xref="InterPro:IPR022588"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV7"
FT                   /protein_id="AAL02851.1"
FT                   /translation="MTDILDEVLSDQNEEKRLIFFKKLLPIIIIISIIAITIMVVINNN
FT                   KDKRIKNNQKNGDILVKTVGLETTKDNEELAFNTLEHLVTTSNTKIKEIAALEQVAIKI
FT                   SKKKYSEAKDLLNKIIENKEYSEISTSYARISWCSLVIDDHNLDIQDKEKLTKYLNYFD
FT                   DEKKPFWATATIIKAMWDIKNNMKPQAEKNLKNLLISNNVSDLIKDQAKALLVNLNK"
FT   gene            317622..318866
FT                   /locus_tag="RC0314"
FT   CDS_pept        317622..318866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0314"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02852"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IV6"
FT                   /protein_id="AAL02852.1"
FT                   /translation="MTKKIALLLLPFILISCNGLGPKRVKNIVELTPKLAIQTHEPIYL
FT                   DSNANIYAFNANMLKNKQYSFARSKTITEPVFIGDMIYALDIRSNISAFSIEKNKIIWS
FT                   YNLSRHKKDNYIGGGILHHNGKLYVTYGSRLLVVLDAKSGYEIIRKELPDIIRIKPIVL
FT                   NDNTVLVQTISNQTIALNAETLKTVWEHESLAEVLSASYFMTPIVQYDNVIVTYNSGQI
FT                   LALNITNGEVKWNFEFTNLNDRTAIPNFDESSILCTPVHDNMNLYIATGLGKLIKLNVA
FT                   TGSVIWQVNAEDIQSMSLIGNSLFVTNNARQIAAFNPETGKVKFVADLNDGQDPKKLKS
FT                   AAFLVPFVGVNNNNKRSLNVISVNGVLYSFDVDNNGLNMIPHVVKIIKNIRYYGLSANN
FT                   NLYFSTDSKIIFGSK"
FT   gene            318959..319426
FT                   /gene="rplM"
FT                   /locus_tag="RC0315"
FT   CDS_pept        318959..319426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="RC0315"
FT                   /product="50S ribosomal protein L13"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02853"
FT                   /db_xref="GOA:Q92IV5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IV5"
FT                   /protein_id="AAL02853.1"
FT                   /translation="MKTYSAKPSEIEKKWWVIDAKNIVLGRLASRVANMLRGKHKPSFT
FT                   PHLDCGDNIIIINAEHVKLTGKKANPKDGKIYYRYTGFPGGIKDTTAGKILSGKHPERV
FT                   IKMAVKRMITRNALGAKQMSNLYVYANGDHPHMAQQPTVYDFASQNPKNKK"
FT   gene            319433..319912
FT                   /gene="rpsI"
FT                   /locus_tag="RC0316"
FT   CDS_pept        319433..319912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="RC0316"
FT                   /product="30S ribosomal protein S9"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02854"
FT                   /db_xref="GOA:Q92IV4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IV4"
FT                   /protein_id="AAL02854.1"
FT                   /translation="MPELKIKTEKVEKQLTKEPLVLKTPKEQIDNLGKFYATGKRKNAI
FT                   ARVWLKVGKGKIVVNNKTIAQYFPSETYVKTILQPFVLTKTIDQYDIICTVRGGGISGQ
FT                   KGAILHGISKALDKSAPDFHAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR"
FT   repeat_region   319964..320066
FT                   /note="REP03, repeated element"
FT   gene            320146..320219
FT                   /locus_tag="RCRNA09"
FT   tRNA            320146..320219
FT                   /locus_tag="RCRNA09"
FT                   /product="tRNA-Met"
FT   repeat_region   320406..320547
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   repeat_region   320557..320591
FT                   /note="REP06, A and T rich repeated element"
FT   gene            320651..320851
FT                   /locus_tag="RC0317"
FT   CDS_pept        320651..320851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0317"
FT                   /product="D-alanyl-D-alanine dipeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02855"
FT                   /db_xref="GOA:Q92IV3"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV3"
FT                   /protein_id="AAL02855.1"
FT                   /translation="MKLILTSLIFIFMSFLPIYAKSLLKGFMYLKDIDPTIIQNMHYYS
FT                   DENFVGKKVDGYKAPEAILTI"
FT   gene            321190..321351
FT                   /locus_tag="RC0318"
FT   CDS_pept        321190..321351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0318"
FT                   /product="D-alanyl-D-alanine dipeptidase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02856"
FT                   /db_xref="GOA:Q92IV2"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV2"
FT                   /protein_id="AAL02856.1"
FT                   /translation="MYTSFDLFDEALPHDSKLIDKKYLAKRNYLCSKMQNHNFKACKIE
FT                   WWHYTTCR"
FT   gene            321460..321753
FT                   /locus_tag="RC0319"
FT   CDS_pept        321460..321753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0319"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02857"
FT                   /db_xref="GOA:Q92IV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IV1"
FT                   /protein_id="AAL02857.1"
FT                   /translation="MPNYHIKFLPNRVKLIGYFCRLILLPNLISADSSENSYDQSLDRN
FT                   KVYSVHLKPFSNTSTYFLDEHPDHTFVHIADKKYILYGLVRELKFAFEDINS"
FT   gene            complement(322147..322632)
FT                   /gene="invA"
FT                   /locus_tag="RC0320"
FT   CDS_pept        complement(322147..322632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="invA"
FT                   /locus_tag="RC0320"
FT                   /product="invasion protein A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02858"
FT                   /db_xref="GOA:Q92IV0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IV0"
FT                   /protein_id="AAL02858.1"
FT                   /translation="MSNSSKKHLDLPYRPGVGMMILNANNHIFVGKRIDTKISAWQMPQ
FT                   GGIVPGETPSIAAMREMLEEIGSDKGYIIAESKFWYSYDVPSFLIPKLWNGNFRGQKQR
FT                   WFLIRFTGNNEDININTSNPEFDQWRWASLDELLSIIIPFKRKLYQAVVKEFESLIQ"
FT   gene            complement(322657..324009)
FT                   /locus_tag="RC0321"
FT   CDS_pept        complement(322657..324009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0321"
FT                   /product="regulatory components of sensory transduction
FT                   system"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02859"
FT                   /db_xref="GOA:Q92IU9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU9"
FT                   /protein_id="AAL02859.1"
FT                   /translation="MTTILVVDDIEPNIKLLTAKLLKEYYTVLTANSGKEALAILKKEK
FT                   IDIILLDVMMPEMDGCEVCKTIKTDPETTHIPVVMVTALSDIDDRVKGLEAGADEFLTK
FT                   PINDTALFVRLKSLSRMKSLIDELKLRNSTNALLGVINIEMHDTFADKKILLINDDVVQ
FT                   AKNIKQMLLKLTQNVKVISNSDELDIINEYTPDLVIISSTLENDDPLRISVILRGKAEI
FT                   SGVVIILQIDEDGMPLVVKGIELGINDYFVYPIEESELLARIRTQLRRKQYQDNLRNDL
FT                   EQSVNLAVKDGLTGLFNRRYFDIHLKQIIEKTNKESIKLYLLMCDIDNFKHVNDTYGHQ
FT                   AGDKVLTIVSRILKNTLRVTDLIARFGGEEFTILLTDIDISKAIATAERIRVKIEYMNF
FT                   HIEDQIEPLKTTISIGVTKYKKEESIESFIERADKAMYEAKTTGKNKVVKL"
FT   gene            324085..324651
FT                   /gene="efp"
FT                   /locus_tag="RC0322"
FT   CDS_pept        324085..324651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="RC0322"
FT                   /product="elongation factor EF-P"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02860"
FT                   /db_xref="GOA:Q92IU8"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IU8"
FT                   /protein_id="AAL02860.1"
FT                   /translation="MKISANSIRTGNILVYNNDLWVVSKTPEHTQPGKGGAYVQVEMKN
FT                   LKTGTKRNERFSSANYLEKAELEQKDYQFLYFEGDDLVLMDTKHFDQINISKEMLEEKL
FT                   SFLTENMIVKVEFYNDKPLNIELPPTVILEISETDPVIKGATATASYKSAILENGIKVK
FT                   VPQYLEIGEKIVVKTDDMTYVERAK"
FT   repeat_region   324682..324717
FT                   /note="REP01, repeated element"
FT   repeat_region   324731..324772
FT                   /note="REP01, repeated element"
FT   gene            324873..325619
FT                   /gene="suhB"
FT                   /locus_tag="RC0323"
FT   CDS_pept        324873..325619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="RC0323"
FT                   /product="extragenic suppressor protein suhB"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02861"
FT                   /db_xref="GOA:Q92IU7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU7"
FT                   /protein_id="AAL02861.1"
FT                   /translation="MQPITNLLINALRKAVKFLHRDFLELEMLQKHSVRNEEFCKRSYL
FT                   KLKTLLCEELQKYTQYLFFPEDKFDLNNNYESVFLINPIDSPNNFARSIPFFAISVTYL
FT                   KRNQEVLIPTSTVIYFPALNEIYYAEKGKGAWIEKNNLNSNYQGLRLRVSDNADLRNCL
FT                   AIIEGVNHNDLEEIEVDNIRSFGSLCYGATLVASGKADLICLSLLNFTLYYAFELFIKE
FT                   AGGIIIDSSDKFLYSNRYIAKKLKKY"
FT   gene            325691..326014
FT                   /locus_tag="RC0324"
FT   CDS_pept        325691..326014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0324"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02862"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IU6"
FT                   /protein_id="AAL02862.1"
FT                   /translation="MAHYKEFEFDCDFSGQRAKFKFYIGTPQEGHHPLQFQAKWLSDER
FT                   GGTIPDDVMKAISQLNDLAKKNGVPLPDLCVYALGSAQEVQATPQDEDENESENQEDKA
FT                   EQA"
FT   gene            326048..326743
FT                   /gene="psd"
FT                   /locus_tag="RC0325"
FT   CDS_pept        326048..326743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="RC0325"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02863"
FT                   /db_xref="GOA:Q92IU5"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IU5"
FT                   /protein_id="AAL02863.1"
FT                   /translation="MKQYNDLFKIIHREGYIFIASFALVSFLLASFNEKLGCIGCIATA
FT                   WCIYFFRNPDRFVPISDDLVISPADGIIQEIKEALPPPELGLGDVEMIRVSIFLNIFNV
FT                   HVNRIPANGKILALHYNPGKFFNASLDKASIYNERQSVLMETAQGQKIVFVQIAGLIAR
FT                   RIVCDLEEGNEVKTGERYGIIRFGSRVDVYLPLKTALLVSKGQTAIGGETIIADFGRKK
FT                   TTEFKFERK"
FT   repeat_region   complement(326795..326879)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(326901..326932)
FT                   /note="REP02, RS3-like repeat"
FT   gene            327005..327769
FT                   /gene="pssA"
FT                   /locus_tag="RC0326"
FT   CDS_pept        327005..327769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="RC0326"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02864"
FT                   /db_xref="GOA:Q92IU4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU4"
FT                   /protein_id="AAL02864.1"
FT                   /translation="MLKIRKSIITKPVPLIKLIPNFITLLGLVTGMSSIKFALDSRWEL
FT                   AVYCIIVAAIIDGIDGRIARMLNAVSPFGAELDSLCDFANFGIAPAYLIYLWSFQQYEY
FT                   KVFSSAVMLLFIVCMALRLARFNVGIYQPKQDKTDYFFTGVPAPCGALLALMPVMIDFE
FT                   IGTLLNINTRTHTITINIYLAIIAFLLASRLPTISTKNLSIKPEYLSLAMILVAIVIIN
FT                   LIIYPWYSLPLIAVIYILSIPICYFFKHRGYW"
FT   gene            327763..328830
FT                   /gene="emrA"
FT                   /locus_tag="RC0327"
FT   CDS_pept        327763..328830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="RC0327"
FT                   /product="multidrug resistance protein A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02865"
FT                   /db_xref="GOA:Q92IU3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU3"
FT                   /protein_id="AAL02865.1"
FT                   /translation="MVKLIMPSVLQQAIDKYKHHPFTKYVIIIALIIFIYLGYRIYVWA
FT                   NTQSTDNAYIDADISNVSAEVSGVLTKLFVTDNTKVNKGDLIGEIDDRDYKAKLAALEA
FT                   SIEACIKNIEIIEQKISIGQISLEQAAEKLKLNKISFDIVATDFMRVQELNKAKFASSK
FT                   TLDDSKNAYQKAKTDYKQAQLDLDISKQHLQLLELEKAAEQEKLKELTENKKVILRSLQ
FT                   NTKLIAMVPGIFGNSSLEVGNYIVPGRALFSIVQDNTMYIQANFKETQIQKFKSGMKVK
FT                   IEFDALPKKVIYGKIRNIAPATGSKFSLIPPDHATGNFTKSVQRVPVLIDFESPNANLV
FT                   PGMSAIVSIRTDQST"
FT   gene            complement(329642..329845)
FT                   /locus_tag="RC0328"
FT   CDS_pept        complement(329642..329845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0328"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02866"
FT                   /db_xref="GOA:Q92IU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU2"
FT                   /protein_id="AAL02866.1"
FT                   /translation="MKTNNILKVAVGASSVAQKALNSITDKSCGIIEDKILKGNYVTRE
FT                   EFEKLQTLVIKLKKELAELKSK"
FT   gene            complement(329842..330084)
FT                   /gene="bolA"
FT                   /locus_tag="RC0329"
FT   CDS_pept        complement(329842..330084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="RC0329"
FT                   /product="bolA protein homolog"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02867"
FT                   /db_xref="GOA:Q92IU1"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU1"
FT                   /protein_id="AAL02867.1"
FT                   /translation="MNRIEMIQEKLSVLKPHFQEIIDESYKHASHYNGIHSHIKIRISA
FT                   ETLQGKSLIANHRTINNLLADEFNSGLHALSIEVL"
FT   gene            330139..331365
FT                   /locus_tag="RC0330"
FT   CDS_pept        330139..331365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0330"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02868"
FT                   /db_xref="GOA:Q92IU0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IU0"
FT                   /protein_id="AAL02868.1"
FT                   /translation="MIHMAMSELRTNYKDLQDAIDKLEKGVCFACRLVNYDEIEFIEQG
FT                   KHFIIEDLDQIIEDVSKELNIFSKFKKIKKDRILFILNTTDSDLIKNFARKLYLFLQLY
FT                   INEQKPAIYMNCYIASIKFPKKVSNNAKEIEKTLNMLLSQNNNYYYREYSSTEHDLENI
FT                   RKSNLQLNLLRQALAKKTMRFAYQPIIDRNTMKIHYYECLLRIPDENGVYISVGPIIPI
FT                   AENKGLIFIIDQIVLEMTVNELARNPNLMLAVNISNIGTGDEALWEIAENLLKAHNVRD
FT                   RLIIEITETSFNQNYDKITLFINKLRKYGCKFALDDFGAGFTSFKQLQSLPIDIIKIDG
FT                   KYVRSITSDVQSRYFVERLIKISEDLGIETVAEFVENGEIAKFLIDLKVGGLQGNFYSE
FT                   AKFDRVDEV"
FT   repeat_region   complement(331418..331518)
FT                   /note="REP03, repeated element"
FT   gene            331586..333043
FT                   /gene="murC"
FT                   /locus_tag="RC0331"
FT   CDS_pept        331586..333043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="RC0331"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02869"
FT                   /db_xref="GOA:Q92IT9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT9"
FT                   /protein_id="AAL02869.1"
FT                   /translation="MLLLELKKTNQTLETIHFIGIGGVGMSGIAEILYNLGYKVQGSDL
FT                   VENYNTKRLESYGIKIFLGHAEQNITNVSYVVISSAINPKNPEIKEALERKIPIIRRAD
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLVACLFEAAGLCPTVINGGIINNKSTNAYLGSSN
FT                   YLIAEADESDATFIHIPSTIAIITNIDPEHLDYYRDFETLIGAFRSFITNLPFYGFAVC
FT                   CIDHKIVRKLVDDITERKIVTYGIDSEDAHIIAFNINTDIASSTFDVKISLPNVLGTTI
FT                   IEKITIPTPGRHNILNSLAAIAVGIELDFGIKAIKNGFNNFKGVKRRFTKVAEYNNASI
FT                   IDDYAHHPEEIKATLATAKNIANKQNGKVIAIFQPHRYSRMQYLFDDFMLCFADADILY
FT                   ITDIYAAGENPIEGITGRSLVDKITKRKHHDKANFLAELDDAVGVIIDNAASGDMIIMM
FT                   GAGNISSFANELEGRLSSRGFSCHTVV"
FT   gene            333015..334151
FT                   /gene="murB"
FT                   /locus_tag="RC0332"
FT   CDS_pept        333015..334151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="RC0332"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02870"
FT                   /db_xref="GOA:Q92IT8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT8"
FT                   /protein_id="AAL02870.1"
FT                   /translation="MALAVIPWFDWYCCIALMSFPRKRESSFLNKLYKNVVYNFLCFYH
FT                   FFLDSRFRGNDICSYNIGSSELRDKRVKITVKRIAGLNMLILPIVKGEYKKDYNLKHLT
FT                   WFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNIIIRDGGIEGVVIKLGQN
FT                   FSNIEFVDNHLIVGSSCLNYNLAKFCQANAISGFEFLVGIPGTIGGGVAMNAGAYGSEF
FT                   KDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVFKINKGDSENILLRMN
FT                   EIKNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYRIGGASMSEFHCNFMINN
FT                   GDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIGRHP"
FT   repeat_region   complement(333066..333095)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(333151..333184)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(334181..334316)
FT                   /note="REP02, RS3-like repeat"
FT   gene            334395..335360
FT                   /gene="ddlB"
FT                   /locus_tag="RC0333"
FT   CDS_pept        334395..335360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="RC0333"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02871"
FT                   /db_xref="GOA:Q92IT7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT7"
FT                   /protein_id="AAL02871.1"
FT                   /translation="MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEG
FT                   VSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDGCLPGLLNIMRIPYT
FT                   HSGVLSSALAFDKIHSRIWFLTNNINMAEGIVVNKSDNIKNDPMKRPYVIKPLTQGSSI
FT                   GVEVIFAEDDFNFADYDFPYGDQVIIEQYIKGRELQVAVLNGKALGALEIKLLKNRFYD
FT                   YETKYTEGFADHLCPAPLPANLYEKLLIESEKIYKTMNCKGPARAEFILEEQTNKLYAL
FT                   EINTHPGMMPLSIVPEIAAYAGINFTNLIEEIIKTASFES"
FT   gene            335357..336160
FT                   /gene="ftsQ"
FT                   /locus_tag="RC0334"
FT   CDS_pept        335357..336160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="RC0334"
FT                   /product="cell division protein ftsQ"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02872"
FT                   /db_xref="GOA:Q92IT6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT6"
FT                   /protein_id="AAL02872.1"
FT                   /translation="MRKKTSSNKKKQTKKTNNISLRRKLGLMYKKAILGLKIALIIFVC
FT                   LFVFTKYFAGIKTYLTTNIYQTTTKLGFKLENVIIEGQQNVDEPTILKVLNANKGSPIF
FT                   ALKLDEIRNNLKKNKWIKEVYVSRRLPNTVYIKLFEREPIAIWQINNQLFLVDEEGYEI
FT                   SKNIQPFPHLLHVVGEGANIYAGTLVLELQKYPALMNKTSAAVRLGDRRWDLNLKGNIS
FT                   IKLPEKEFEEALKYVDALNKANKLFNQNYKVLDLRDKNKYYIEKY"
FT   gene            336288..337523
FT                   /gene="ftsA"
FT                   /locus_tag="RC0335"
FT   CDS_pept        336288..337523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="RC0335"
FT                   /product="cell division protein ftsA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02873"
FT                   /db_xref="GOA:Q92IT5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IT5"
FT                   /protein_id="AAL02873.1"
FT                   /translation="MKEKISNFVTLDCGSSKIAVIAAYISKKGEIKVASQNLHHSKGIK
FT                   SGVISDLKNAETSIVSAIYALEKDCGKNIKKVILSLSGADTKSYYINYTIKVNGQTVTQ
FT                   QDIKKLLQKALLEFKVKNQEIIHYFPLEFTLDNNSVENPIGMYGRELSCELHIIAASSN
FT                   ILSNIVQCFAKCHVEVTNITLAIYASAISCLTNDEKNLGSLIIDMGDKTTSFGIFFAGK
FT                   LIYTGYVNIGSFHISSDIAKVFGIDLVTAEKLKILYGNAMIPLFEKDSIVNMEDFQVDT
FT                   HHTLNTSVTIYKLAEVIRARAEEILSMVKAEYDKATKGQVEVFRVVITGGGSQLRGLKE
FT                   LSNKIFEKQSRIGKPEIIAGFIEDYNPAMYSATIGMLKIHALKQQKEFAHIRLDANSSF
FT                   FKKAFDWFKENI"
FT   repeat_region   complement(337564..337588)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(337666..338142)
FT                   /locus_tag="RC0336"
FT   CDS_pept        complement(337666..338142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0336"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02874"
FT                   /db_xref="GOA:Q92IT4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IT4"
FT                   /protein_id="AAL02874.1"
FT                   /translation="MFMINNYLTEIWLIIGIICIVVEFFTVPSIGFLFFGLGALSNTLV
FT                   VYNYPLVNLTNQITFFGILSLIWFCILYYPLKKYVYNKTDKTKNYSDMIGKTVQVYSAT
FT                   VSSDTIGQVRWSGAIMNAYLVPNEIDAKTGDRLFIIEVKGNVLICSREKPNNNS"
FT   gene            complement(338126..338653)
FT                   /gene="cycM"
FT                   /locus_tag="RC0337"
FT   CDS_pept        complement(338126..338653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="RC0337"
FT                   /product="cytochrome c"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02875"
FT                   /db_xref="GOA:Q92IT3"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT3"
FT                   /protein_id="AAL02875.1"
FT                   /translation="MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVA
FT                   VQESSENQNTTALEQAPVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWD
FT                   VTGRPKASIADYKYSPALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIAD
FT                   VILFLKTYVHDK"
FT   gene            338767..339837
FT                   /locus_tag="RC0338"
FT   CDS_pept        338767..339837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0338"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02876"
FT                   /db_xref="GOA:Q92IT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IT2"
FT                   /protein_id="AAL02876.1"
FT                   /translation="MSKKSRVRKIFNKLKSYWTSFRQSKIGKILFSNSLSYAVSIASIA
FT                   IAVSGLFTPISPIIIAVAVVSGVSVGIQAVNETLKVHDLRKFHKENNLLVHNRNAKSQQ
FT                   DYILSLEPSLKDILKNELYTPQTAGKDATQDKYELNVNKLKSTGRIFGNNLGGAANLAA
FT                   SIIKGASGNVLDILRATGYGVVTTASLIIDGLTEKEKIEIKAIFKLNINEEYKKQDTPI
FT                   YKNLEQLENYTKNQVLQTLALKKLITDKNYWSMNKDQTIQKFREIIGSFNSEIKRNGLE
FT                   EFFRENKITMDNSKESYVKDIKNVMNPFYENPSKAEGYNPLTKAMDKDKVNNAEIKRTK
FT                   SENLKRMQKRKRNLTI"
FT   gene            complement(339846..340721)
FT                   /gene="lpxC"
FT                   /locus_tag="RC0339"
FT   CDS_pept        complement(339846..340721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="RC0339"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02877"
FT                   /db_xref="GOA:Q92IT1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IT1"
FT                   /protein_id="AAL02877.1"
FT                   /translation="MPKMQQSTLLKPVSCYGIGVHSGKRTQLTIEPTKENTGIIFIRTD
FT                   ISSENNYIEASYFNVSDTLLSTTISNDHKVQISTIEHLMAALWGCSIDNAIIKIDGPEV
FT                   PIMDGSSKPFVFMIECAGKKLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTID
FT                   FSSKAIGRQNLSFRDQESFTKNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQD
FT                   KILNPNGLRYEDEFVRHKLLDLFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTT
FT                   SYKFVTSSEL"
FT   gene            340752..340925
FT                   /locus_tag="RC0340"
FT   CDS_pept        340752..340925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0340"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02878"
FT                   /db_xref="GOA:Q92IT0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IT0"
FT                   /protein_id="AAL02878.1"
FT                   /translation="MPNYTSYIMLQNITHILDELQKLAVSSYKSCDTHVLSIRAAPHLV
FT                   DSLLFLKLVFLC"
FT   repeat_region   complement(340796..340916)
FT                   /note="REP04, repeated element"
FT   repeat_region   340930..341065
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(341068..342216)
FT                   /locus_tag="RC0341"
FT   CDS_pept        complement(341068..342216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0341"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02879"
FT                   /db_xref="GOA:Q92IS9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS9"
FT                   /protein_id="AAL02879.1"
FT                   /translation="MTLKNDYKTIFFSLLGIFIFSCINTINFYNFKIFLLLNKNLGGEQ
FT                   INHINQTKFIGSIIAGFALTQLINKLSNQKIILISLSLLIICTINLILLNNYTLIKINF
FT                   IVINFGTFSYFTSITLDIIESSKEKKYFFLACIMLLWAGGNLMVDLLNPFITPTNNTIV
FT                   ICALLYCINILTEFLHYNPTSHKLNLNSKFSSLIKNVELQLLTGFVVAYVTLDILWYYE
FT                   AFALKKELALINLRLILKYIFLAICFSIIPICYILSKVNKYLANLSLTIILLVCFILLP
FT                   LHGTNKNLNILYIILIGSCLGSIYICNILILIDKFRDYELRTALFSYFSMCSIGTYAGA
FT                   LSSHVPYGTINGSDFLFSVCAVVGSFVAYHFWYFIKYTLYRF"
FT   gene            342642..344714
FT                   /gene="rne"
FT                   /locus_tag="RC0342"
FT   CDS_pept        342642..344714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="RC0342"
FT                   /product="ribonuclease E"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02880"
FT                   /db_xref="GOA:Q92IS8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS8"
FT                   /protein_id="AAL02880.1"
FT                   /translation="MNKKIIIDANFPSETRVVLLGQSNNIEDIEFQTTVRQQNKGNIYL
FT                   AKVTRIEPSLQAVFIEYGMDKSGFLPFSEIHPNYYNLPTSERNFPVNAFPEIALSNITV
FT                   EDNKEKPAAIYDSLVDSEEIDLKTIEDLVESTFQSELNLEAADDIEMIQSGTPESNIPQ
FT                   YKQYKVQEVIRKNQILLVQVTKEERGNKCAAFTTYISLAGKYCVLMPNKGSQNGISRKI
FT                   SNGEERKRLKDILNKIVSGDKNAYSVIVRTAGRGSSTLDLKKDYNYLARLWNKIRKSTI
FT                   KFPAPCFIHEEDSIIRKTIRDMCDHNVKEVVIQGQEGYADASKFMQDLLPSELVKLKEH
FT                   KSKTPIFTKFQVEEQLVKLYQPVVTLPSGGYIVINPTEALIAIDVNSGKSTSEQNIEET
FT                   ALKTNLEAAKEVAKQVKLRDLSGLIVVDFIDMSEAKNRKIIERSFKEFLSRDRARIQTG
FT                   NISQFGLLEFSRQRLRSSFLETNSAICSHCNGKGVIRASDANAMLILRTIENEIFEERI
FT                   DVINVFTNIVSVLYLLNNKRTEIKFIEEKYNIKLNFYSDPNATSDSYSIEKVKLFKKNN
FT                   NNFNSVKPVIQNHNADYTEEELKKEQLRKNKHKWKTANNSNNVANEVKDKSLEAEESVE
FT                   QTVSVVEEVQVVESNAGLEEAQAAPKKTKRRYRNKTSNKKCPSNTVEDTEKNAES"
FT   repeat_region   complement(344733..344763)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(344814..344871)
FT                   /note="REP03, repeated element"
FT   gene            344965..345978
FT                   /gene="coxW"
FT                   /locus_tag="RC0343"
FT   CDS_pept        344965..345978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxW"
FT                   /locus_tag="RC0343"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02881"
FT                   /db_xref="GOA:Q92IS7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IS7"
FT                   /protein_id="AAL02881.1"
FT                   /translation="MQKSLITKWLCISCIMVIATLVIGGITRLTGSGLSIVEWRPVTGI
FT                   LPPFSFESWQSEFAKYKAFPEYNSVNYGITLSQFKFIYLLEFIHRLLGRITALIYIVPL
FT                   IYFYFKDVIKNRDMLPYIIALLLFCVQGFIGWYMVKSGLLNSPYVSHFRLAFHLIIAVI
FT                   IYHILFYQLIKNRCDILLIPSQTDFKLPLIFSGIAITVVYVQIFLGALVAGLDAGLIYN
FT                   SFPLMDDRFIPMEIKDNFFDLKNWYDPVFIQFIHRLVGYSVFLVVVVLISCLLKIEHPK
FT                   LNKIAYFLMIALFMQVSTGILTLLYSVPIIIASIHQLFAIILLSIIIWCYFLIKSS"
FT   gene            345991..346902
FT                   /gene="rluC"
FT                   /locus_tag="RC0344"
FT   CDS_pept        345991..346902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="RC0344"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02882"
FT                   /db_xref="GOA:Q92IS6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IS6"
FT                   /protein_id="AAL02882.1"
FT                   /translation="MIIDVNTPISSRLDKYLKRLYPLLTQGVIEKALRQKQITVNAQKA
FT                   EASLRVKGGDKIFINDKFNLPVKQPEKLVFTDAEIKLAKKITTDYLIYADDNLIAINKP
FT                   AGLATQGGTKINLSIDSALKYLNYKGADFKLVHRLDKKTSGLLLIAKNYLSSVKLHNAF
FT                   KEKLVVKTYFAVTYGKPIKNVGEVRSNIEKSKGSTPKITDIDSENGKLAITYYKVLKSL
FT                   DNNLFLIEFTPVTGRMHQLRLHAKLLGCPILGDDKYGNKEIMPYSKYMFLHANNICLSE
FT                   KIFGQESKLEAKLPFYFTRRLT"
FT   repeat_region   complement(346888..347028)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            347030..348238
FT                   /gene="pbpE"
FT                   /locus_tag="RC0345"
FT   CDS_pept        347030..348238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpE"
FT                   /locus_tag="RC0345"
FT                   /product="penicillin-binding protein 4*"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02883"
FT                   /db_xref="GOA:Q92IS5"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS5"
FT                   /protein_id="AAL02883.1"
FT                   /translation="MISLWSVAVMMRRYLLLLLFFITNCIDCFADIQQRINEAEKEYIS
FT                   NRFLNAVFMFADDYKPLLTGAKGIFALNGEQLKANEMMPIVSATKPFTAAGILKLQEQA
FT                   LLNINDKIYKYLDPEMWGGKVPDWAYKISIHNLLTHSSGIAEYFSFVKLDLNMPKKEIH
FT                   KKILQFVSSKPLEISIGKKFKYSNTNFVILGMIIEKVAKKDLANFFYDEFFKPLNMKST
FT                   SFASYSEAARIQKNVISSNYPVRYFLTPNNSNKPIFTPVTADFLAVPCADGGIISTPVD
FT                   LIRWYRALNEEKILSKKSYKLMTTKYFLAQDIEGRKSYMGYGIFLTDLDSKRLMIHYTG
FT                   KALGIQSEAGYVLPDNLYFAILSNTMIKIPEEEKDKIDMKNPLNQLGIIYFRDAIIGAA
FT                   IKN"
FT   repeat_region   348241..348383
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            348340..349200
FT                   /gene="xthA1"
FT                   /locus_tag="RC0346"
FT   CDS_pept        348340..349200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA1"
FT                   /locus_tag="RC0346"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02884"
FT                   /db_xref="GOA:Q92IS4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS4"
FT                   /protein_id="AAL02884.1"
FT                   /translation="MTYKLPVEGGYTTSLMKIVTWNINSLRLRIDLLRKLAYEHQPDII
FT                   LLQETKVADSLFPLEVIKNIGYEHVIYSGQKSYNGVAIISKFPLNNVFSLELYNSDKRH
FT                   IAAIVNDIEIHNFYVPAGGDIPDIEVNTKFKHKLEYVRLMQEWLTTNRTKNDKMIIVGD
FT                   LNIAPHEHDVWSSKQLRNVISHTDIERSLLVELQNALGFIDSSRHFVSLDEKFYTWWSY
FT                   RNIDWKKSNRGRRLDHIWVSDNLKGALFSMHLLSEARDWSSPSDHVPYFVTFNLQMSSR
FT                   GQATG"
FT   repeat_region   349179..349202
FT                   /note="REP03, repeated element"
FT   gene            349223..350203
FT                   /gene="pdhA"
FT                   /locus_tag="RC0347"
FT   CDS_pept        349223..350203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="RC0347"
FT                   /product="pyruvate dehydrogenase e1 component, alpha
FT                   subunit precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02885"
FT                   /db_xref="GOA:Q92IS3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IS3"
FT                   /protein_id="AAL02885.1"
FT                   /translation="MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFC
FT                   HLYIGQEAVISAIDMVKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKG
FT                   GSMHLFNVPNKFYGGHGIVGAQVPIGTGLAFVEKYNDTHNICFTFLGDGAVNQGQVYEA
FT                   FNMAALWGLPVVYIIENNEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFEEMYD
FT                   GSKQAAEYVRENSFPLILEVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTIL
FT                   DNKYVTEADLKAIEQSVKEIVKEAVEFSENSPLPDEGELYTQVYC"
FT   repeat_region   complement(350206..350231)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(350232..350305)
FT                   /note="REP01, repeated element"
FT   gene            350364..351344
FT                   /gene="pdhB"
FT                   /locus_tag="RC0348"
FT   CDS_pept        350364..351344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="RC0348"
FT                   /product="pyruvate dehydrogenase e1 component, beta subunit
FT                   precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02886"
FT                   /db_xref="GOA:Q92IS2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IS2"
FT                   /protein_id="AAL02886.1"
FT                   /translation="MQITVREALRDAMQEEMIRDDKVFVIGEEVAEYQGAYKVTQGLLE
FT                   QFGPKRVIDTPITEYGFAGLAVGAAFAGLRPIVEFMTFNFAMQAFDHIVNSAAKTHYMS
FT                   GGQVKCPIVFRGPNGAASRVAAQHSQNYTACYSHIPGLKVVAPYSAEDHKGLMLTAIRD
FT                   DNPVVFLENEILYGHSFDVPKTIEPIPFGQAKILREGSSVTIVTFSIQVKLALDAANFV
FT                   QNDNIDCEVIDLRTIKPLDTETIIESVKKTNRLVVVEEGWFFAGVGASIASIVMKEAFD
FT                   YLDAPIEIVSGKDLPLPYAVNLETLALPSESDVIEAVKKVCYYSI"
FT   repeat_region   351359..351401
FT                   /note="REP01, repeated element"
FT   repeat_region   351418..351459
FT                   /note="REP01, repeated element"
FT   gene            complement(351482..353311)
FT                   /gene="bipA"
FT                   /locus_tag="RC0349"
FT   CDS_pept        complement(351482..353311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /locus_tag="RC0349"
FT                   /product="GTP-binding protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02887"
FT                   /db_xref="GOA:Q92IS1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS1"
FT                   /protein_id="AAL02887.1"
FT                   /translation="MTSIRNIAIIAHVDHGKTTLVDNMLKQSGTFRANQAVAERAMDSN
FT                   DLERERGITILAKCTALMWNDIRINIVDTPGHADFGGEVERILSMVDGVVLLVDASEGP
FT                   MPQTKFVLSKALNLGLKPIVVINKIDRDDQRIKEVIDEVFELFVALEANNDQLDFPIVY
FT                   ASGRAGRASLTFDDKINPLDNLADDLAPLFDLIVQHVPKPLADDKAPFSMLVTTREYNS
FT                   FFGRVLTGRVQSGTVKINQNVKVLNRENKVLETGRITKILAFRGLERIAINDATAGDII
FT                   AVAGVENANVADTICSPEVTEAVPSLPIDPPTLSMTFSVNDSPLAGSEGTKVTSSLIGA
FT                   RLMRELESNVALKVTEAAEKNAFQVAGRGELQLGILIETMRREGFELSISRPEVLFQTD
FT                   EKGNKQEPMEEIQVDVDDDYVGVVVKSLALRKAEMTDMRPSGGGKSRVTFIGPSRGLIG
FT                   YHSQFLTETRGTGIMNRIFHGYADYKGNIEGRRNGVLISNGDGAAVAYALWNLEERGKM
FT                   FINPSDKVYRGMIIGEHNRDNDLEVNPLKAKQLSNVRATGKDEAIRLTPPMLLTLEQAI
FT                   SYIQDDERVEVTPKSIRLRKALLDPNDRKRAAK"
FT   gene            353460..353699
FT                   /locus_tag="RC0350"
FT   CDS_pept        353460..353699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0350"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02888"
FT                   /db_xref="GOA:Q92IS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IS0"
FT                   /protein_id="AAL02888.1"
FT                   /translation="MNDNTVLFIFDCDDTLVGHSHNYIGERLGGLIARNIQHRFFSSYE
FT                   EREQEKVRLEQKFSIELMEKFLDNENLGWKMKSK"
FT   gene            353678..354025
FT                   /locus_tag="RC0351"
FT   CDS_pept        353678..354025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0351"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02889"
FT                   /db_xref="GOA:Q92IR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IR9"
FT                   /protein_id="AAL02889.1"
FT                   /translation="MENEEQIARLFKNIILSGHKIAIASFNDYPHAVKYALARLLGKED
FT                   AAKIYIKSALPSNNFEERQNCTKKEYIREIINNTEITVNAAKDYGITVVLVKNKGTEHI
FT                   HEAFFYMNLMK"
FT   repeat_region   354281..354308
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   354319..354345
FT                   /note="REP03, repeated element"
FT   repeat_region   354370..354397
FT                   /note="REP03, repeated element"
FT   gene            354436..354990
FT                   /locus_tag="RC0352"
FT   CDS_pept        354436..354990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0352"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02890"
FT                   /db_xref="GOA:Q92IR8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IR8"
FT                   /protein_id="AAL02890.1"
FT                   /translation="MIYRILCLCIFIINFSTITEAQNVPIKEDNFKVRVAVADVQSILE
FT                   GSIAIKDLRNKIEKLNHKIQENIAAKEAEFKPLEEKLLNERSHLSETEFEHKVNEFNAK
FT                   VSHVRKEIQIKKTKLEQAHAEAMSRVHETTITIISELAEKYNLNLVIPSAQVLYAKNNL
FT                   NITSEVTFMLNERLKEVTINY"
FT   repeat_region   355012..355147
FT                   /note="REP02, RS3-like repeat"
FT   gene            355167..356618
FT                   /gene="icd"
FT                   /locus_tag="RC0353"
FT   CDS_pept        355167..356618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="RC0353"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02891"
FT                   /db_xref="GOA:Q92IR7"
FT                   /db_xref="InterPro:IPR014273"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IR7"
FT                   /protein_id="AAL02891.1"
FT                   /translation="MAEFTPITIAYGDGIGPEIMEAVLYILRKAEARIRLETIEVGEKL
FT                   YKKHYTSGISEESWESIQRTGIILKAPITTPQGGGYKSLNVTIRKTLQLFANIRPAVSL
FT                   HPFTRTLHPNLNLTIIRENEEDLYAGIEYRQTHNMYESMKLISHTGCEKIIRYAFEYAV
FT                   KNNRKKVMCLSKDNIMKFSDGVLHKVFNEIAKEYPQINNAHYIIDIGTARLATKPEIFD
FT                   VIVTSNLYGDIISDVAAEISGSVGLAGSANIGQHYAMFEAVHGSAPDIAGKDIANPSGL
FT                   LNAAIMMLVHIGQGDIATLIENAWKKTIEDGVHTADIYNEQSSSKKVGTKEFAEEVTKR
FT                   LGQLPTKLPKADYPLIAEKQESNIDYKIDTKEVKKLVGTDIFVNMNVSSAHDIADKINK
FT                   LDLGNFELKTISSKGLKLWPRDTRFETVSDHWCCRFMNKDGTEIKHLDITRLLEALSTA
FT                   NIDFIKVENLFEFDGVAGYSLAQGE"
FT   repeat_region   356672..356713
FT                   /note="REP01, repeated element"
FT   gene            356733..357053
FT                   /locus_tag="RC0354"
FT   CDS_pept        356733..357053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0354"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02892"
FT                   /db_xref="GOA:Q92IR6"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IR6"
FT                   /protein_id="AAL02892.1"
FT                   /translation="MTLYYIGILLVIIGLFAIFSGIIGFFRFPDFYTKLHAASVIESFG
FT                   VPICLIGFACIAADIVNSVKLILAALLIFILNPVATHALGKASLFMKIRADSTVIARKI
FT                   TK"
FT   repeat_region   complement(357027..357073)
FT                   /note="REP01, repeated element"
FT   gene            357117..358190
FT                   /locus_tag="RC0355"
FT   CDS_pept        357117..358190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0355"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02893"
FT                   /db_xref="GOA:Q92IR5"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IR5"
FT                   /protein_id="AAL02893.1"
FT                   /translation="MTLNFNNHMTVKTALNFDLGNYLLNLIAFLLILISIKIIFAKDLL
FT                   NAVIAASVFSLLIGVSYLIMDAPDVAMTEAALGACLSTCVYLNLLRKLPSDLKNIERTN
FT                   IIPASLICLLFVVTLAYMGLELPNYGDDNAPIHMHSSKYYIENTSRDIGVPSFVAAILA
FT                   SYRGYDTLGETSVILIAGIAVLLIFSRKSDDAIPRLDLGISGHSRRYKIPWSSHGMTNP
FT                   IIKYITSFIIPYIILYSIYIQLNGESSPGGGFQAGVIFASSLIAYDLVYGNRKLSRYFP
FT                   PNVLVCIAVLGVAIYAIVGTISLFFNDNYLNYYALTNFINDKLLAQHIAIVIVEIGIGL
FT                   TVAAIMYLIYNVFNNYE"
FT   repeat_region   357749..357776
FT                   /note="REP03, repeated element"
FT   gene            358183..358830
FT                   /gene="ccmB"
FT                   /locus_tag="RC0356"
FT   CDS_pept        358183..358830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="RC0356"
FT                   /product="heme exporter protein B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02894"
FT                   /db_xref="GOA:Q92IR4"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IR4"
FT                   /protein_id="AAL02894.1"
FT                   /translation="MNSLFVLIKRELIVQNRINNIIKYLVIFFLFCIISTVLINSERDI
FT                   NKFGLIFSVICLLISLIGFSSVIFKSDLEDGSLELLLSIVSHEKIILAKFFAIFISSTI
FT                   GLVFVLPIIYVLFDKTLLEIIFFFSSVWMILVLSSSLVVLSGSVQCYFKKNANFVGTFI
FT                   MPLLIPNIIMTGLILQDNNLQLIFIMIGINLVFLPISFFLSSCLIKNIYNIT"
FT   gene            358905..359363
FT                   /locus_tag="RC0357"
FT   CDS_pept        358905..359363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0357"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02895"
FT                   /db_xref="GOA:Q92IR3"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IR3"
FT                   /protein_id="AAL02895.1"
FT                   /translation="MWQALRRLMAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGLK
FT                   KIGFIDYFTETTVEILDTTKAVAQNCTTKLGPNWNHLVSFWNCLSDPGEYKHEEGTGAK
FT                   VLEDEINKLTPQQADSAADAERPIINPYEALENPNNLNHTPSGSNNNR"
FT   gene            359385..359918
FT                   /gene="petA"
FT                   /locus_tag="RC0358"
FT   CDS_pept        359385..359918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="RC0358"
FT                   /product="cytochrome b6-f complex iron-sulfur subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02896"
FT                   /db_xref="GOA:Q92IR2"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IR2"
FT                   /protein_id="AAL02896.1"
FT                   /translation="MSDTEDNKNKQTTRRDFMVLTASSVAAIGAVCTLWPLVDSLNPSA
FT                   DVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEADQA
FT                   RVKAGHDNWLVTIGICTHLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAV
FT                   PPYTFISDKKIRIG"
FT   gene            359925..361121
FT                   /gene="petB"
FT                   /locus_tag="RC0359"
FT   CDS_pept        359925..361121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="RC0359"
FT                   /product="cytochrome b"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02897"
FT                   /db_xref="GOA:Q92IR1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IR1"
FT                   /protein_id="AAL02897.1"
FT                   /translation="MNEDITPKKPNAIIEWIDYRLPIFAFLKHFSHYQTPKNLNYLWNL
FT                   GSIAGIALVIQIITGVILAMHYTPHVDHAFDSVERIMRNVNYGWLLRYTHAVGASMFFA
FT                   AVYLHIARGLYYGSYKAPRELLWHIGIIIFLTMMATAFMGYVLPWGQMSYWGATVITNL
FT                   FSAIPLIGEFIVTWLWGGFSVDNPTLNRFFSLHYLLPFIIVALVMLHLVALHQHGSNNP
FT                   KGIDVKSPKDTIPFHPYYTVKDFVGFGVYFIIFAYFIFYEPNYLGHPDNYIPANPLVTP
FT                   AHIVPEWYFLPFYAILRAMPSKLGGVLLMFGSIFVLFLLPWLDTSKVRSSNYRPIYRMA
FT                   FWIFMADCLLLGYLGGQPAEEPYITISRFAACYYFFHVLVALPLIGKYEKPLPLPEEL"
FT   repeat_region   complement(361145..361243)
FT                   /note="REP01, repeated element"
FT   repeat_region   361526..361570
FT                   /note="REP01, repeated element"
FT   gene            361612..362367
FT                   /gene="fbcH"
FT                   /locus_tag="RC0360"
FT   CDS_pept        361612..362367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbcH"
FT                   /locus_tag="RC0360"
FT                   /product="cytochrome c1, heme protein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02898"
FT                   /db_xref="GOA:Q92IR0"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IR0"
FT                   /protein_id="AAL02898.1"
FT                   /translation="MKTKLLISIIILLTSCLSLANEEVLHPKKMKWSFDGVFGTVNREA
FT                   AQRGFQVYKEVCSVCHGLNNLYYRNLKDIGFSDDEIKEIAKGYTIQDGPNDDGEMFDRP
FT                   ALLSDRFVPPYPNEQAARAANNGAHPPDLSLIIKARHDGANYIYSLLTGYTEPPADFKL
FT                   MQGTHYNPYFPGEQIAMPPPLTDGQVTYMDGTNASVEQMSQDIVVFLQWVAEPEMEHRK
FT                   SMGLKVMMFLAVFTIFFYIAKNRIWSNLK"
FT   repeat_region   362514..362547
FT                   /note="REP02, RS3-like repeat"
FT   gene            362630..362857
FT                   /locus_tag="RC0361"
FT   CDS_pept        362630..362857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0361"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02899"
FT                   /db_xref="GOA:Q92IQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ9"
FT                   /protein_id="AAL02899.1"
FT                   /translation="MAITGFMSSIIPEILKIYKDINDKKHEINILDRQIANNKNLISLK
FT                   LLQSLPYHKKWRSNILFTPLINQVLVGLML"
FT   gene            362875..363069
FT                   /locus_tag="RC0362"
FT   CDS_pept        362875..363069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0362"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02900"
FT                   /db_xref="GOA:Q92IQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ8"
FT                   /protein_id="AAL02900.1"
FT                   /translation="MLAYSFFAMYGGVKYVQYKSLKSSALLVEYLDILWSIEDQTIFAE
FT                   IISFYFGQRTFSKLWKYKT"
FT   gene            363130..363633
FT                   /gene="hsp22"
FT                   /locus_tag="RC0363"
FT   CDS_pept        363130..363633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp22"
FT                   /locus_tag="RC0363"
FT                   /product="heat shock protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02901"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IQ7"
FT                   /protein_id="AAL02901.1"
FT                   /translation="MLKSVRLYIPSIAVMILSSNIAIANKNYDAGNATPLRQVADLIDN
FT                   QITNIDNLFKNRLSLYESNSIKSNFITKDKQYIIVMEVPGFDKSQIKVKVNGNKLFITG
FT                   NIEEKNKADYSDNYMNKNFNYVISLYEDVDQANISSSLKNGILTIILPRIEIKEQEARE
FT                   IVID"
FT   gene            complement(363871..364074)
FT                   /locus_tag="RC0364"
FT   CDS_pept        complement(363871..364074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0364"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02902"
FT                   /db_xref="GOA:Q92IQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ6"
FT                   /protein_id="AAL02902.1"
FT                   /translation="MQKYGPMILFNGGAYDNKLLQEALDKNIITDYPKENFYIFTLPEY
FT                   QTNIGADNLTLYIKSMKTVILT"
FT   gene            complement(364570..364779)
FT                   /locus_tag="RC0365"
FT   CDS_pept        complement(364570..364779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0365"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02903"
FT                   /db_xref="GOA:Q92IQ5"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ5"
FT                   /protein_id="AAL02903.1"
FT                   /translation="MYVVIELKTGKFKPEYAGKLNFYLNLMERTIKDNSDNPTIGLILC
FT                   EEKQGITVEYAIEGIQKTNRSITI"
FT   gene            complement(364763..365137)
FT                   /locus_tag="RC0366"
FT   CDS_pept        complement(364763..365137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0366"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02904"
FT                   /db_xref="GOA:Q92IQ4"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ4"
FT                   /protein_id="AAL02904.1"
FT                   /translation="MHNKPSKMVGQEMYYLGKLKVIYMKGQRKKGINNFSNTLPELQSD
FT                   LARSIIKEPYNLDFLDIQGKIIERDLENQLIDNIKNFLLELGQGFAFVGNQYHIELEGE
FT                   DYYLDLVFYHIKLKCYVCCY"
FT   gene            complement(365037..365516)
FT                   /locus_tag="RC0367"
FT   CDS_pept        complement(365037..365516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0367"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02905"
FT                   /db_xref="GOA:Q92IQ3"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ3"
FT                   /protein_id="AAL02905.1"
FT                   /translation="MSNTLSNESYTNLIKNLKQEISKARIRAHLAANKELIVLYWHIGN
FT                   LILERQNKEKWGSKVIQNISDDLRKEFPKMKGLSYQNLSYMRQFFAEYNNDQILQQAVG
FT                   EIPWSHNIIILSKLNNINQRIWYAQQTIENGWSRNVLSWQIKSNLHERSAKKRYK"
FT   gene            complement(365526..366633)
FT                   /gene="prfB"
FT                   /locus_tag="RC0368"
FT   CDS_pept        complement(join(365526..366563,366565..366633))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="prfB"
FT                   /locus_tag="RC0368"
FT                   /product="peptide chain release factor RF-2"
FT                   /EC_number="2.3.1.129"
FT                   /note="Possible natural frameshift regulation"
FT                   /db_xref="EnsemblGenomes-Gn:RC0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02906"
FT                   /db_xref="GOA:Q92IQ2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IQ2"
FT                   /protein_id="AAL02906.1"
FT                   /translation="MRAEIENYVKKIEQSLELLWRSLDVEASTERLNALEELTADPSLW
FT                   NDQANAQKLLREKSNLEEKLNAFNKLKSNLKDALELEEMAEAENDLETLSQIEQDLKNL
FT                   SIIAAKFETECLFSGEADGNNCFLEINAGAGGTESHDWASIMMRMYLRFAERLGFKTEI
FT                   INMINGEEAGIKSCTIRIIGKRAYGWFKTETGVHRLVRISPFNAAGKRMTSFASSWVYP
FT                   EIDDNIAITIEDKDLRIDTFRASGAGGQHVNTTDSAVRITHIPTGTVTQCQSDRSQHKN
FT                   KAQAMKMLQAKLYELEMQKRTDSVNEQNAAKTDNSWGHQIRSYVLQPYHMVKDLRTDYE
FT                   TSDTKGVLDGDLEEFVSAHLAMNVGGKK"
FT   gene            366751..368553
FT                   /gene="lepA"
FT                   /locus_tag="RC0369"
FT   CDS_pept        366751..368553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RC0369"
FT                   /product="GTP-binding protein lepA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02907"
FT                   /db_xref="GOA:Q92IQ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IQ1"
FT                   /protein_id="AAL02907.1"
FT                   /translation="MNHQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKDGNNYYLNLMDTPGHVDFAYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVL
FT                   ISAKSGIGIDLVLEAIVNKLPPPKESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRK
FT                   NMRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEK
FT                   KPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKI
FT                   ESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKK
FT                   RMRQYGNIEIPQSAFIAALKIGDE"
FT   gene            368645..368716
FT                   /locus_tag="RCRNA10"
FT   tRNA            368645..368716
FT                   /locus_tag="RCRNA10"
FT                   /product="tRNA-Asn"
FT   gene            369716..370654
FT                   /locus_tag="RC0370"
FT   CDS_pept        369716..370654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0370"
FT                   /product="ATP-dependent protease subunit C (ClpC)-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02908"
FT                   /db_xref="GOA:Q92IQ0"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IQ0"
FT                   /protein_id="AAL02908.1"
FT                   /translation="MPFEDYCRKGLAHVPKSTSVSSPAEIENIFKAIDTEAKIREWFDK
FT                   NYQVQEEKIDNIAKSLNEENKFAILRRNLTNKSTSEIKNIVEKINRMQVDIGKVLLLGS
FT                   AGIGKTTLMHYLSYKWGKEKLWNNKFDYVFRIRLKELLSWTVRYGTNIDDEILSCFVHY
FT                   CLDSNDIKLEDIKSIQDKDRILLLLDGYDEVAFLSQSNRDDRDIMDSVFQYKNIVMSSR
FT                   PNAVIEEMSNRFEQKVDNTGWDSEGIEQYVHKNFEYDKELGTPLKIFLDTHGQIKEICA
FT                   VPINTALICLVWSDQAIRDKFQKKTVIKILI"
FT   gene            371062..371451
FT                   /locus_tag="RC0371"
FT   CDS_pept        371062..371451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0371"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02909"
FT                   /db_xref="GOA:Q92IP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP9"
FT                   /protein_id="AAL02909.1"
FT                   /translation="MTLKFLAGMVSNENNQELIEIFWKAVTCNVDRILELGIERKIILL
FT                   MHLLAQSNINGKFDSRIPNLKQIQNLIDEVVLKDITGWEQHIIDSGYLSEAIVKTVNEK
FT                   LQNKKTDPQEFKQVIGIITGLANKK"
FT   gene            372167..372715
FT                   /locus_tag="RC0372"
FT   CDS_pept        372167..372715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0372"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02910"
FT                   /db_xref="GOA:Q92IP8"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP8"
FT                   /protein_id="AAL02910.1"
FT                   /translation="MKEVLNDSGNEVKIVVIWSLTETVRINPSLAQETLKILNTLLNNP
FT                   SNYIEFTIAKILGWIIQINPNISHDASKILKNLFSNSDKSKSALSLVELGKVKPVEEAF
FT                   KVFKDILSDPYVDRYAKYAIAVSLINIINVRSFDKASYKQVNRLIKIIDLHRTQNFDKD
FT                   LYLEIDAKTTLQTITDYIT"
FT   gene            373629..374177
FT                   /locus_tag="RC0373"
FT   CDS_pept        373629..374177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0373"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02911"
FT                   /db_xref="GOA:Q92IP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP7"
FT                   /protein_id="AAL02911.1"
FT                   /translation="MEYKNIINACCIAETKIFKNNINEQEGIIKILVKGIDLITQSFLI
FT                   DILTDLACSIVAARHERKHGNKVISINDIIRNKIGMEDLDGNLKKIVIIKTQERRNEII
FT                   NLSKTPISNSDSTRFRVNIKELGNVVKEFRLSKAIERHDQDNIAVQLALKDSILFIESL
FT                   YANRDDILNEKSDIFFRRR"
FT   gene            374372..374905
FT                   /locus_tag="RC0374"
FT   CDS_pept        374372..374905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0374"
FT                   /product="(p)ppGpp 3-pyrophosphohydrolase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02912"
FT                   /db_xref="GOA:Q92IP6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP6"
FT                   /protein_id="AAL02912.1"
FT                   /translation="MTFMEDLSSWKEKFETCVYAQKLLDNIEYLNAKVKNPVDIEEVKK
FT                   GIYYARKYHDLQIRQLGDPYYSHPIEVAIMLAEFVAEDAPKLYNAIMLQAVLLHETIED
FT                   IALTEEVITIGPEVAKHVEGLTRIKPYGKISSEKGLNLLVRQKRYDTVLIKFFDRMYNL
FT                   QTLGAKSPEKMRRV"
FT   gene            complement(375305..375517)
FT                   /locus_tag="RC0375"
FT   CDS_pept        complement(375305..375517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0375"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02913"
FT                   /db_xref="GOA:Q92IP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP5"
FT                   /protein_id="AAL02913.1"
FT                   /translation="MFYYGKSSAYDEIGIVATWVMIAYRMAQVISSMGKVIGAYVYLTE
FT                   FIKPPVQYPTVATLDSFCILGGFGA"
FT   gene            complement(375967..377067)
FT                   /gene="rodA"
FT                   /locus_tag="RC0376"
FT   CDS_pept        complement(375967..377067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RC0376"
FT                   /product="rod shape-determining protein rodA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02914"
FT                   /db_xref="GOA:Q92IP4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP4"
FT                   /protein_id="AAL02914.1"
FT                   /translation="MHKNYLEQLQKLPITLILLISLICCIGFIVLYSAANSNLQPWAYK
FT                   QIINFCIFLPLAIIIALIDLRIIFRLSYIFYLCVLALLVAVELFGSTAMGGKRWIDIGI
FT                   VKLQPSEPIKIAVVLMLARYFHSLTIYDLTKFHKVIIPIIGVLIPAFLIIREPDLGTGM
FT                   IVLIVSAIIFFAAGLRIKYFIILGLAALISLPIAWNMMYDYQKKRVMVFLDPEHDPLGA
FT                   SYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFIGGMFLLIL
FT                   YFALITISLLIAANCREIFSKLMVIGITSILFIHVFINIAMVMGLLPVVGVPLPFISYG
FT                   GTMIASMLIGFGLVMNAQVHRHTALN"
FT   repeat_region   complement(377095..377125)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   377138..377195
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(377223..379412)
FT                   /gene="ptrB"
FT                   /locus_tag="RC0377"
FT   CDS_pept        complement(377223..379412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="RC0377"
FT                   /product="protease II"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02915"
FT                   /db_xref="GOA:Q92IP3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP3"
FT                   /protein_id="AAL02915.1"
FT                   /translation="MKPPITDKQNYNFEVHETTINDDYHWLRDPKWPNVEDSKILDYLK
FT                   AENQYTENFFADLQNDKEKIFEELKGRVKLDDESVYVKNKDYYYYHRVEENKNYPIYCR
FT                   KHNNMDSAEEVILDVNLLAPNSSFTDVATVAMSPDHNLMAYSVNFTGNEQYNIKIYNLK
FT                   EQKYLPDELGNVQLNLDRFRQDEFQDKPAERTNVREHRRMPQNSLVSSDRNLAVAPTII
FT                   WHEHLNGFFYITINENQRWDKVMFHRLGEEVTQDKLIFEVKNPLHFISCKKSASHEYIF
FT                   INSGDHNENEIYVISMQDDSFTPKLVRAAENKIFYEIEYNGDYFYIKTNYKAKNFHVIK
FT                   LPVNNFENTSWDDWDDIYIKEEQDKYLKSFNVTNNYLILNYRDQGLPLIKIKRFKDLQE
FT                   NTIYFPDESFQASSFSTNFEEDDIRIDYSSLARPNTTYSYDFNSDKLTILKSHEIPSGF
FT                   NPEEYKVERIFADNEDVKVPITLFYKKSLFKKDGSNPLYLMGYGAYGIAMPVNFRNTAV
FT                   TLADRGFIYAVAHIRGGDDLGHDWYEAAKFLTKKRTFEDFIACSRALINEQYTSNNNIV
FT                   IMGGSAGGMLIGYILNEKPEIYRAAIAHVPFVDVLSTMLDESLPLTLLEYNEWGNPKEK
FT                   EYFEYIKSYSPYDNVKAQNYPALFVTCGISDPRVGYWEPAKWVAKLRALKMDNNPLLLK
FT                   TNMDTGHKGSAGRFDYLKEIADELVFIFKVFDVEV"
FT   repeat_region   complement(378772..378887)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   repeat_region   379448..379495
FT                   /note="REP01, repeated element"
FT   repeat_region   379508..379565
FT                   /note="REP01, repeated element"
FT   gene            complement(379591..381108)
FT                   /gene="nuoL3"
FT                   /locus_tag="RC0378"
FT   CDS_pept        complement(379591..381108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL3"
FT                   /locus_tag="RC0378"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02916"
FT                   /db_xref="GOA:Q92IP2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP2"
FT                   /protein_id="AAL02916.1"
FT                   /translation="MFIQNTKCTFPLTNFELMFDFHPQNQLIALAFLIVTAILNLYTIS
FT                   QNRKLECLIGSLYCLSSIICVFAADFISMIISLEFMTIFACIIIFCDQLKIKPARQYFL
FT                   THLFSSGLILIGMTLLIQTTSNTTFTSLTESVNNFELPAIFILAGCLINASAIFVNGWV
FT                   VHCYPIASSSGIVYLISFTTKVILIIILKLFSGLEILKFFGISMIIYGLVLSLIEKKLK
FT                   RLICYLTVSQLGFILTAISIKSPNIAYLITSFIFIHILYNGLFALYFAYIEDEYDIKNY
FT                   QDLQNTQINFILLSGFVISILIYTSILPIRSSYIKDEIANILNENSVMLFSKIATCTVL
FT                   FGLLMESSTSFLRKQESSKNLKNKSFIIFLDSRFRRNDIRTITYLSFCIITLCICLFYP
FT                   IQISHTANFKLVILAISLLLALIFRKIPRISTENINLDLYQYIEKFIYFSIDKYKETAD
FT                   NNEDAAEYLNFKVIWDNILSKISAWHNQQTAILIVLFLLISLILTLQ"
FT   repeat_region   379973..380004
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   380031..380062
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(381110..381514)
FT                   /locus_tag="RC0379"
FT   CDS_pept        complement(381110..381514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0379"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02917"
FT                   /db_xref="GOA:Q92IP1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP1"
FT                   /protein_id="AAL02917.1"
FT                   /translation="MGLIIDTAIIIALEREKVSTKQWSHYGQTYISPIVLTELLIGVYR
FT                   VKNENKRIKCLAFIEYVKSLFTILPFGIEEVYTYARITHDLYTQRITIGTHDMLIAATA
FT                   ITKGFLILTLNVKDFKRIQGLEVLTVSSKD"
FT   gene            complement(381505..381804)
FT                   /locus_tag="RC0380"
FT   CDS_pept        complement(381505..381804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0380"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02918"
FT                   /db_xref="GOA:Q92IP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IP0"
FT                   /protein_id="AAL02918.1"
FT                   /translation="MRINMAQIIRATEFVRSFSDIMNRVYYKGESFDVQKGNHIVARIT
FT                   PAEIKPSVAVRDLEEAFKNGPHLDPEDADQFMKNREEIRYNTKQDIKKLVERWD"
FT   repeat_region   complement(381905..381944)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(381979..383442)
FT                   /gene="nuoL2"
FT                   /locus_tag="RC0381"
FT   CDS_pept        complement(381979..383442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL2"
FT                   /locus_tag="RC0381"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02919"
FT                   /db_xref="GOA:Q92IN9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN9"
FT                   /protein_id="AAL02919.1"
FT                   /translation="MITQFTTPNLLILSTLLVGALNLTSPYATQKDSFIRNFLLITIAI
FT                   FFFGNILIIDWLFLKGIRAGFEFNIFGNYSIGFHLEPLGLIFLSLIGFLWICALLYTSK
FT                   YLAINNIDYSSRFLFFFNFTILIGVLIALSSNLFTMFICYELLTISTAFLIGHTKNNIV
FT                   LSGLYKYLKILMISATILFLPAVIIIYTKTGNGDFASGSLVENYFSKNQSIILLLMFIC
FT                   GIAKTAIFPVHSWLPAAMVAHYPISSLLHAVIVVKTGLFCIYKILLYIFGLSYLQMIFA
FT                   EFNWLIFIPIVSIFYSSIKALDTDNIKKILAYSTMNQLSLALLSAFMLTPKALGAAILH
FT                   LVSHSFTKICLFYSMGSIYSLKKTNQVQNLHGTSKEFPLISFIISISSLSLIGIPIFSG
FT                   FISKFSILLAASEQNQIIVMIVVIASSIFSSLYLLKILSSIYKPSLVESSVTKPLPYSM
FT                   QISIIMCCCAVTLFYFIQILIREFLAYIT"
FT   repeat_region   complement(383500..383585)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(383589..384890)
FT                   /gene="nuoN2"
FT                   /locus_tag="RC0382"
FT   CDS_pept        complement(383589..384890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN2"
FT                   /locus_tag="RC0382"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02920"
FT                   /db_xref="GOA:Q92IN8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN8"
FT                   /protein_id="AAL02920.1"
FT                   /translation="MILANHVPIIQILFPLFGALLSIISFRFITFARIITTICILSSLL
FT                   VSVYGYSIIQNTELSYTMGGWTSKIGIEYRLNALNQAIIIYLNLVLLFFLVFCHKITNQ
FT                   TILKYINNNRKSLFYGILLFAHTGYLGMMATHDFFNLYIFIEISALSSYVLIASGNNPK
FT                   SLIGAFDYLIIGSIGATLILISIGFLLSITGSLNMAEIAAYLQEHTNSRIITIAIGFFL
FT                   IGAILKTAFFPMHFWMMRAYNNTASVILVYLAGISTIIGIYIIYKFTYIIIGYETIKTA
FT                   ITNFIKPIALATLIIAPYFAYQTKDFKNIIIYSCCTQIGYVFLLYVTENGIIVLPSLLL
FT                   ADSINKIALFLIDAYNGSYKREPNKVLIIIAIMCSCGLPISPLFFIKVNILELLLTHNL
FT                   LLDFIIILLSSVGSLFYHYKMVLLSFPRKRESSN"
FT   repeat_region   383593..383623
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(384887..385222)
FT                   /locus_tag="RC0383"
FT   CDS_pept        complement(384887..385222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0383"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02921"
FT                   /db_xref="GOA:Q92IN7"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN7"
FT                   /protein_id="AAL02921.1"
FT                   /translation="MHNLIYFFALILLTSGLFIMLTSRNYIHKIIGLGIFQSSVLVFYL
FT                   SIGKIKTGGVPIFQEGITTYTSPLPHVLMLTAIVVGFATLSVALSLIYQIYKHFGTISE
FT                   NEINFDK"
FT   gene            complement(385301..386053)
FT                   /gene="trbG"
FT                   /locus_tag="RC0384"
FT   CDS_pept        complement(385301..386053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="RC0384"
FT                   /product="probable conjugal transfer protein trbG
FT                   precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02922"
FT                   /db_xref="GOA:Q92IN6"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN6"
FT                   /protein_id="AAL02922.1"
FT                   /translation="MKQLIIFCTFIILTLDVFALTISRPLGRDPRLRVMTYNPDDVFKF
FT                   TGYYGYQASIELARDEEIVSISMGDTTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRT
FT                   YFFELYAAETLDMRDPEMVFNVKFLYPDDENDNMSGHMQTFSAALASPDLTHPEKYNFN
FT                   YYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLVNYRLAQDNPNMV
FT                   ILEQVFPKLAIRKGKKVTCVFNQSFKAY"
FT   gene            complement(386055..386753)
FT                   /gene="virB8"
FT                   /locus_tag="RC0385"
FT   CDS_pept        complement(386055..386753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="RC0385"
FT                   /product="virB8 protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02923"
FT                   /db_xref="GOA:Q92IN5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN5"
FT                   /protein_id="AAL02923.1"
FT                   /translation="MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTI
FT                   FTLLLTLICININILLPINKKVKYLIKDDAEKQAAVTNTKHSTLVKPYISIANIMLQNY
FT                   VNQREEYNYDILKEQFTFIKNASTSIVYMQFANFMNIDNPLSPVIRYQKLYRRSINILS
FT                   INNINNNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSPDMPFNFTVTSYK
FT                   LKLLRNKNQK"
FT   repeat_region   complement(387005..387040)
FT                   /note="REP04, repeated element"
FT   gene            387220..387399
FT                   /locus_tag="RC0386"
FT   CDS_pept        387220..387399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0386"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02924"
FT                   /db_xref="GOA:Q92IN4"
FT                   /db_xref="InterPro:IPR024444"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN4"
FT                   /protein_id="AAL02924.1"
FT                   /translation="MLKSLKLLLVLIMLAQLLSCTPSAPYEIKSPCVSADIDDGSSVSV
FT                   NPCIRRPVNSVNIV"
FT   gene            387449..388180
FT                   /locus_tag="RC0387"
FT   CDS_pept        387449..388180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0387"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02925"
FT                   /db_xref="GOA:Q92IN3"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN3"
FT                   /protein_id="AAL02925.1"
FT                   /translation="MNNIFGFFKSSNNSQSGAGDTQTQESIKSANPLKITQNWYEERSD
FT                   KLLVQRNLLIILIILLTIFMVIATLVIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSP
FT                   VLTADESLTRYFIKKYITARETYNPVDFATIARTTIRLFSTSSVYYNYLGYIRNKDFDP
FT                   TLKYKEENTTFLVVKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVVSYAYVPMQLTDS
FT                   ELDVNPVGFQVNGYRVDDDNS"
FT   gene            388167..388640
FT                   /gene="virB9"
FT                   /locus_tag="RC0388"
FT   CDS_pept        388167..388640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="RC0388"
FT                   /product="virB9 protein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02926"
FT                   /db_xref="GOA:Q92IN2"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN2"
FT                   /protein_id="AAL02926.1"
FT                   /translation="MTIVRFYFLVFILLSGFTVQRECPLVDDPCNSSNNYVDDLSITKD
FT                   NRIKTYIYNPNEVYLLVLHFGFQSHIEFAKNEEVQNIILGDAYAWKITPLANRLFIKPL
FT                   EKDIRTNMTIITNKRIYEFDIASTELMMGNERDLVYVIKFYYPKKNSNYMARF"
FT   repeat_region   388665..388728
FT                   /note="REP01, repeated element"
FT   gene            388825..390273
FT                   /gene="virB10"
FT                   /locus_tag="RC0389"
FT   CDS_pept        388825..390273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="RC0389"
FT                   /product="virB10 protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02927"
FT                   /db_xref="GOA:Q92IN1"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN1"
FT                   /protein_id="AAL02927.1"
FT                   /translation="MAEEQNNNHNTGSLSGADSPEVQRELSKVSVSFNKSIAIVVVICG
FT                   IFIYIFYTLFFGTEKEEIPETQIPSNIVKPVTEVDDNIPEIPKLPDPPKLETPTAPPPP
FT                   PPPVVKVPPVLPPTTPVEENKDKTLPLPPVSLPSTSGTLVESDAEKQRREAKRKSAIVL
FT                   IGGVEPKKTPEQITAETTFKDRGDMSLVLGRGKLIDAVLETAINSDLGGEIRAIISRDV
FT                   FSEKDKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRIDLTSGYTIEFDSPAVDNLGR
FT                   PGLQGRVDNKYKEQFANAVLQSGFNIGLAKVLDKLVPPPIASQAAATNSATAKQLLNIA
FT                   QTIASNTAMDANTRIVTICTNILAAITDKTSTAYTTMTQACTTAQTASSANTAEQRLQT
FT                   LVQAVNTAASSLLTTTSIASTPTQAQQASTQAFTDVTNVVKNMITQQQFKPTTTVNQGT
FT                   PVRIYVNKDYKFPKAVLLKSKVMK"
FT   gene            390270..391274
FT                   /gene="virB11"
FT                   /locus_tag="RC0390"
FT   CDS_pept        390270..391274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="RC0390"
FT                   /product="virB11 protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02928"
FT                   /db_xref="GOA:Q92IN0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IN0"
FT                   /protein_id="AAL02928.1"
FT                   /translation="MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYS
FT                   KQIPELDSEHLLALGSLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYA
FT                   IRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKKNI
FT                   IISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSCHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILAVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV"
FT   repeat_region   complement(391279..391315)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(391316..391370)
FT                   /note="REP01, repeated element"
FT   gene            391429..393204
FT                   /gene="virD4"
FT                   /locus_tag="RC0391"
FT   CDS_pept        391429..393204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="RC0391"
FT                   /product="virD4 protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02929"
FT                   /db_xref="GOA:Q92IM9"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM9"
FT                   /protein_id="AAL02929.1"
FT                   /translation="MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGAL
FT                   GVNINAINIAYKWAYWLINVWGQLKIADYNYLKLKLLASLLSPAIIVIIFYIKNFERIK
FT                   SLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLIGVDAGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWEPSNPDGVTHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPYGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NATYRITFAANNYETANLISQLVGNKTVEQRSFSKPLFFDLNIATRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPTFVPTQVPFDPRANNNG
FT                   ASEETETITVPENNE"
FT   gene            393197..394618
FT                   /gene="gppA"
FT                   /locus_tag="RC0392"
FT   CDS_pept        393197..394618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="RC0392"
FT                   /product="guanosine pentaphosphate phosphohydrolase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02930"
FT                   /db_xref="GOA:Q92IM8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM8"
FT                   /protein_id="AAL02930.1"
FT                   /translation="MSKMRSAIIDIGSNALRAVVYESDELGAPEIFNYKFRNYLTNLLN
FT                   LDNLDVKHQTYLSLQYLIHIFTKLSVTNIRCVATAILRGHPKADEFKAIIKKRFNIDIE
FT                   IISGEREAYLTAAGLISGISDAFGIVADLGGGSLELAQIGNKKVGKLKSLPLGTKIIVS
FT                   SNFGDVGLITKMLEEEFGVAHYPNLYLIGGALRLMSRIYMESINYPLKNLHNFEINRVE
FT                   FELYLEKLSQIDKLKLSYYEQKVINYNAVLVIKAMIKVFSPEKIIISNYGLKEGVRFDS
FT                   LPSHETEKDIIYERVKRLVKFDRNICKIEKYIEAVQYLLINADATTLIVIELAIMLAQY
FT                   NKNIDKTLRANFVSEFILSSDIPFSHRQRLMLGIALTVTYTAKTDMQINKIAKKMISKS
FT                   DYYNSHIIGYYIKIAREIDGPEFQEPSFSIKLKDDKFLQINASNILPKQVFEKVCERLK
FT                   DISSARKNIRYNFSD"
FT   gene            complement(394832..395143)
FT                   /locus_tag="RC0393"
FT   CDS_pept        complement(394832..395143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0393"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02931"
FT                   /db_xref="GOA:Q92IM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM7"
FT                   /protein_id="AAL02931.1"
FT                   /translation="MQCILTKILPQIIKDKDLTSEQVYYLERIGNLIHRESDDSAAEFI
FT                   VRYLEINIDNLLHSIEDSLIINAMQPLADFWEEHIVPKMESTIIGCTKEYNCDTFDGA"
FT   gene            complement(395298..395561)
FT                   /locus_tag="RC0394"
FT   CDS_pept        complement(395298..395561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0394"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02932"
FT                   /db_xref="GOA:Q92IM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM6"
FT                   /protein_id="AAL02932.1"
FT                   /translation="MKTDFVKNVPYQNDDKIFLPKNFESLKRLINSSYEYSRAAKPILD
FT                   LTANLILTPEEKNEISSKYNDNKELIKYLKNETILPIFYFNH"
FT   gene            complement(396020..396316)
FT                   /locus_tag="RC0395"
FT   CDS_pept        complement(396020..396316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0395"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02933"
FT                   /db_xref="GOA:Q92IM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM5"
FT                   /protein_id="AAL02933.1"
FT                   /translation="MLGLHHAITSFDLEAYTLIISYANPSHFTSAEYDRYIHNIDDTSM
FT                   LDVAAFINFDTIQYRDTKSSMLQELIKFKKRTIEEHNNNAISEFKIEGFELKN"
FT   gene            396624..396908
FT                   /locus_tag="RC0396"
FT   CDS_pept        396624..396908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0396"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IM4"
FT                   /protein_id="AAL02934.1"
FT                   /translation="MIKNYRKKFWKNSTTKSQNFIELNDIAYGNLIRVDIEAYRENVIV
FT                   YRCINLIAQSAGHVPWKVLKSKTGEVIFRLSGALFTNKTESQKSRSGFC"
FT   gene            396853..397071
FT                   /locus_tag="RC0397"
FT   CDS_pept        396853..397071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0397"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IM3"
FT                   /protein_id="AAL02935.1"
FT                   /translation="MHYLLTKPNPKKAGADFVSELIASKLLFGNSYILSALDSYPKEIY
FT                   LLPALVTELVIEHNNLVSYFDLKLFVR"
FT   repeat_region   complement(397363..397430)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(397448..397475)
FT                   /note="REP02, RS3-like repeat"
FT   gene            397542..398429
FT                   /locus_tag="RC0398"
FT   CDS_pept        397542..398429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0398"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02936"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IM2"
FT                   /protein_id="AAL02936.1"
FT                   /translation="MFKKYIFILILFIASIARAEIIEVDSLNKIKQDFKENYNKNYVPQ
FT                   DLLVVTVLDEFLFKSLVPIVTQLDKDIYLTTLTPLLRNINKNSKTIYIKQLILTNDSYK
FT                   KELQESDFPNFVNEISNSKIPIIAVNDGFTGNFNNIPKFEIWFADYLKKNFDIDFSNSF
FT                   PNNNYIIFNNLDSFANTYPVFYKGILTSNNISEAEMMLNFLIQMNFIPKCFIMISSSIE
FT                   LLSSMELQLSSYSSNILFIGYHYNNKNTPKNKDVAYYTKLINDLISQINKLKRNNPPLK
FT                   NNNAKGKNPYDTNK"
FT   gene            398392..399237
FT                   /locus_tag="RC0399"
FT   CDS_pept        398392..399237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0399"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02937"
FT                   /db_xref="GOA:Q92IM1"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM1"
FT                   /protein_id="AAL02937.1"
FT                   /translation="MQKVKILMTRINKVLLSLLCLVISYAGYGQIIPTYSVDSVTMKNL
FT                   LPKIDADTLVLINIDNTIITPKSKLFRYQDNSYINFTKYLYSLAADNASVNKTIAKLIV
FT                   QRQMMLVESKWVDLINKMKQQGATVLGLQEITAPCNLIENYEGWLYTLLYGLNINFTNK
FT                   VNDKDVFRFNPSDAEAPIFYLGIIFTGNINRVKALIEFLKIIPKQPKKIVIFANNKKDL
FT                   ENMDSYLSMVDIGYYGIEYLGWQMLPGSPDHQIAELQQSTFLNTGQWLEDDTAAKMLNK
FT                   "
FT   gene            399240..400016
FT                   /gene="cysQ"
FT                   /locus_tag="RC0400"
FT   CDS_pept        399240..400016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="RC0400"
FT                   /product="cysQ protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02938"
FT                   /db_xref="GOA:Q92IM0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IM0"
FT                   /protein_id="AAL02938.1"
FT                   /translation="MNDNLINALKDLIINTGKIALDIKKAGMLTDIKSDGSVVTNADKE
FT                   ISKIIYQTLQTLTSQIAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLI
FT                   ENGFPTIGLIYHPETAKLYYTDVNGRLKIEQNSKEIFVNHEPKHEELNAVIGFYNSNKA
FT                   TKEFLSKYSFGQINAIGSSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNIL
FT                   DTHGQEITYGKESFANPNFFACSKYWLEREARLHRY"
FT   repeat_region   400020..400092
FT                   /note="REP01, repeated element"
FT   repeat_region   400096..400117
FT                   /note="REP01, repeated element"
FT   gene            complement(400156..402828)
FT                   /gene="mutS"
FT                   /locus_tag="RC0401"
FT   CDS_pept        complement(400156..402828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RC0401"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02939"
FT                   /db_xref="GOA:Q92IL9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL9"
FT                   /protein_id="AAL02939.1"
FT                   /translation="MLLNMNLQELKQKYNYDVATKMMQQYLDIKFAHLDCLLLFRMGDF
FT                   YEMFYEDAILASNVLGIALTKRGKNGEEEIAMCGVPYHALENYLTKLIEANYKVAICDQ
FT                   LETPEEAKNRGGYKAVVTRDVTRIITPGTIIEENLIASAEPNYLASLVIPKNKETASLC
FT                   YVDLSTSEIVVVNVPETEILNELARLKPREILLSENLRSSNLADSIFKQLNFRITYQVD
FT                   SFFAINKCEKIILDFYKMKDIKGIGEISSSQICAIGSVLEYLSLTQKQNIPHLPIPRII
FT                   KFHSYMTIDFSTRRNLEIVTNSQGGSQGSLLSTLNHTVTKQGGRLLYNFLSSPLTNIAK
FT                   INHRLNITEFFYSNLEIVKKIRELLKKTSDIERCLTRITMNRSSGRDLLSIKYTLETAT
FT                   IIKGVFFDAYGFNLPDFIEKIIKPLSGDAELYNLIDETIREDAPNNLNDGGIIKHEYHP
FT                   KVAQLHDLINNGKLYIEKLKDQYRKETGIDSLKISHNNVIGLFIDITAKNVNKILDPKF
FT                   IHRQTTVNHVRYTTAELQKLESELVNAKTLVISLEKELYADICSQVIEKASYLRMLASS
FT                   LSGLDVFCNFAYIADEYDYVKPEFTDDLSFDIVKGRHPVVEKALQRESKSFVYNDCHLS
FT                   ELERIWLITGPNMAGKSTFLRQNAIIAIIAQIGSFVPAKSAKIGVVDKIFSRIGAADDL
FT                   IKGQSTFMAEMLETSAILAQSTKNSLIILDEVGRGTSTYDGVSIAWSVLEYIHDKLKCR
FT                   CLFATHYHELTVMSNFLPALQNYTIAIEESGKDILFLHNIISGAADRSYGLHVAALAGL
FT                   PASVINRAEQILLKFEKTSTGKGKNILSTESNNLSLFYLEPNKTTISSKLDKKFSTIDP
FT                   DKLSPKEALELIYELKKLV"
FT   repeat_region   402858..402905
FT                   /note="REP01, repeated element"
FT   gene            complement(403001..403435)
FT                   /gene="lacA"
FT                   /locus_tag="RC0402"
FT   CDS_pept        complement(403001..403435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="RC0402"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02940"
FT                   /db_xref="GOA:Q92IL8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL8"
FT                   /protein_id="AAL02940.1"
FT                   /translation="MKTYNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVDY
FT                   PDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDA
FT                   NILILGAKTIDQKIVFDIIDKFLTTQFEGGRHSTRLSKIK"
FT   gene            403487..404161
FT                   /gene="nlpD"
FT                   /locus_tag="RC0403"
FT   CDS_pept        403487..404161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="RC0403"
FT                   /product="outer membrane antigenic lipoprotein B precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02941"
FT                   /db_xref="GOA:Q92IL7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IL7"
FT                   /protein_id="AAL02941.1"
FT                   /translation="MFSNVNNSFVKYMKYPVVLSIVICFCLVACVDQPPAPIEYKVGDV
FT                   TANNNSTALDYDEGMIVQRTMEDNPVSEKVSGRLEEPKAKIIEDDNDDIEISMSRNEDE
FT                   DEESIEQLNFVKPLNGVIITEFKAGKSKGIDIVAKEYSEVKSIAAGTVIYSGYNKQFGN
FT                   LVIVKLDKDDLEVAYASLDDLLLKKGDKIARNSVIGHVEHKLYFAMRKNKIAVDPNKYI
FT                   EF"
FT   gene            404162..404854
FT                   /locus_tag="RC0404"
FT   CDS_pept        404162..404854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0404"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02942"
FT                   /db_xref="GOA:Q92IL6"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IL6"
FT                   /protein_id="AAL02942.1"
FT                   /translation="MEDVITLTKYGEPQDVIVRRSSKAKNIAIRITSKGAELVLPLKVK
FT                   AEKGHNFLLSQEYWVRQKLRRNVTAIPKDEDKISILGKSYEIIHIDSSKNQIKLNDSTL
FT                   EVYCCSQVLKKLSIEVFLKKKLLAEIKIIVENISKKHNLTYSNIRIMENVSRWGSCCSK
FT                   GNLVFNWRVVLAPFEVLKYLVAHEMAHLKEMNHSKNFWELVEDIYPEYQPAKLWLKRNG
FT                   KNLYSYFP"
FT   repeat_region   404859..404883
FT                   /note="REP02, RS3-like repeat"
FT   gene            404963..405847
FT                   /gene="thyA"
FT                   /locus_tag="RC0405"
FT   CDS_pept        404963..405847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="RC0405"
FT                   /product="thy1 protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02943"
FT                   /db_xref="GOA:Q92IL5"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL5"
FT                   /protein_id="AAL02943.1"
FT                   /translation="MHNTTKRVTVPALEEILYEPIKVLDYGFIRVIDYMGDDSAIVQAA
FT                   RVSYGKGTKQLNQDKGLINYLLRHYHTTPFEMCDIKFHIKLPIFIARQWIRHRTASVNE
FT                   YSARYSILGNEFYLPEPANIASQSAVNKQCREGDSLPKEVAEKVLAILEEDARQCYGHY
FT                   KELMNADEEGNIIDENATGIARELARMNLTLNYYTEWYWKINLHNLLHFLRLRADPHAQ
FT                   YEIRVYAEKMLEIVKAWVPFVYEAFEEYRLQGANISRKGLDVIKRMINGEKVTHETSDM
FT                   TKREWEELMKIFG"
FT   repeat_region   405851..405875
FT                   /note="REP02, RS3-like repeat"
FT   gene            405922..407256
FT                   /gene="tolB"
FT                   /locus_tag="RC0406"
FT   CDS_pept        405922..407256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RC0406"
FT                   /product="tolB protein precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02944"
FT                   /db_xref="GOA:Q92IL4"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL4"
FT                   /protein_id="AAL02944.1"
FT                   /translation="MRNIIYFILSLLFSVTSYALETINIEHGRADPTPIAVNKFDADNS
FT                   AADVLGHDMVKVISNDLKLSGLFRPISAASFIEEKTGIEYKPLFAAWRQINASLLVNGE
FT                   VKKLESGKFKVSFILWDTLLEKQLAGEMLEVPKNLWRRAAHKIADKIYEKITGDAGYFD
FT                   TKIVYVSESSSLPKIKRIALMDYDGANNKYLTNGKSLVLTPRFARSADKIFYVSYATKR
FT                   RVLVYEKDLKTGKESVVGDFPGISFAPRFSPDGRKAVMSIAKNGSTHIYEIDLATKQLH
FT                   KLTDGFGINTSPSYSPDGKKIVYNSDRNGVPQLYIMNSDGSDVQRISFGGGSYAAPSWS
FT                   PRGDYIAFTKITKGDGGKTFNIGIMKACPQDDENSERIITSGYLVESPCWSPNGRVIMF
FT                   AKGWPSSAKAPGKNKIFAIDLTGHNEREIMTPADASDPEWSGVLN"
FT   repeat_region   407300..407335
FT                   /note="REP03, repeated element"
FT   repeat_region   407349..407382
FT                   /note="REP03, repeated element"
FT   gene            complement(407395..408276)
FT                   /gene="rpoH"
FT                   /locus_tag="RC0407"
FT   CDS_pept        complement(407395..408276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="RC0407"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02945"
FT                   /db_xref="GOA:Q92IL3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IL3"
FT                   /protein_id="AAL02945.1"
FT                   /translation="MTNNINALAISSESGFYSYLQKINKIPSLTQEEELLLAKSYLEGN
FT                   DLQAAHKLVTSHLKLVAKIASGYRTYGLPITELVSEGNIGLMQAVKKFNPELGFRLSTY
FT                   AMWWIKAAIQEYILKSWSLVKMGTTAAQKKLFFSLNKVKHKITNLYSRAITTDDFVQIA
FT                   DELGVSVNEVSEMNTRISGPDLSLNNSINSDDAESGELIELLPETRPTPEAMAINKQNS
FT                   TSKRQLLSNAMKILNDRELRILTERKLTDTPKTLDILSNEYNISKERIRQIENTAFEKI
FT                   KKFILNHSREAA"
FT   gene            408365..408931
FT                   /gene="cox11"
FT                   /locus_tag="RC0408"
FT   CDS_pept        408365..408931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox11"
FT                   /locus_tag="RC0408"
FT                   /product="cytochrome c oxidase assembly protein cox11"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02946"
FT                   /db_xref="GOA:Q92IL2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL2"
FT                   /protein_id="AAL02946.1"
FT                   /translation="MSKKSNKNLAFSLLGLIISMVLLSFASVPIYNLFCKVTGYGGTTA
FT                   KETVSVYSKVKGTKPIIIEFDANVDKDLPWRFIPRQQRVQIVPGQNTLVFYETENLSDN
FT                   DIIGTSVYNVTPNKAGKYFVKIHCFCFEEQLLKAGERVLMPVTFYIDKDFELDPEMQDI
FT                   KVLTLSYSFFKVREMSSLRGNYVSN"
FT   repeat_region   complement(408901..408977)
FT                   /note="REP01, repeated element"
FT   gene            complement(409029..410009)
FT                   /locus_tag="RC0409"
FT   CDS_pept        complement(409029..410009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0409"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02947"
FT                   /db_xref="GOA:Q92IL1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IL1"
FT                   /protein_id="AAL02947.1"
FT                   /translation="MLFKILYKTVITLALIYFILIILEYARQGFLNDLSLQKVDLSIQN
FT                   SIKEPIYLVSYADGLEYVYRNQNATTHYAINKGIDFIFNYKKKHINQAFIEKNQEIFNE
FT                   PAGAGLWLWKPYIILETMKNAPKGAIIVYLDSAFVIKKHISNLTNLLGDNDILLVHDRN
FT                   RKNGSFVKGETFALMDCLTDECRNDDHIWSAVIIVRNTKLSRSFIEKWLKSCEDIRILS
FT                   GKNYNIHPNYDEYKWHHSDQSVLSLIYHKNPQSVKVIEYEKTTPSLSWFHRKYSNSSPL
FT                   KPWYSIYGIDPIINFNTNGKVLPATSLINTPMIVRLRKWVIEYIQ"
FT   repeat_region   complement(410064..410160)
FT                   /note="REP01, repeated element"
FT   gene            410256..411368
FT                   /gene="trmU"
FT                   /locus_tag="RC0410"
FT   CDS_pept        410256..411368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="RC0410"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02948"
FT                   /db_xref="GOA:Q92IL0"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IL0"
FT                   /protein_id="AAL02948.1"
FT                   /translation="MFKVGMINLGDKQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITL
FT                   QLYDHGMAVGKKNACCAGQDIYDAKMVANKLGIPHYVLDYENKFKESVIDNFVDSYLQG
FT                   ETPLPCVQCNKSVKFRDLIKTARELGADKLATGHYVRKINGDNGAELHTGLDPAKDQSY
FT                   FLFTTTKEQLEYLRFPLGGLTKDETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINK
FT                   IRPNSSESGKIIHVNGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVG
FT                   PESALNVQEFIIRDVNWLADEIKDNEKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLC
FT                   EEKAVAPGQACVIYAGERVLGGGWITREIR"
FT   repeat_region   411373..411407
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(411415..411453)
FT                   /note="REP01, repeated element"
FT   gene            411499..412896
FT                   /gene="atrC1"
FT                   /locus_tag="RC0411"
FT   CDS_pept        411499..412896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atrC1"
FT                   /locus_tag="RC0411"
FT                   /product="cationic amino acid transporter-1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02949"
FT                   /db_xref="GOA:Q92IK9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK9"
FT                   /protein_id="AAL02949.1"
FT                   /translation="MSFLRKKSFESVKEIGSSSGLSKTLGAFDLILLGLGAMIGTGVFV
FT                   VTGIIAAKYSGPAVMLSYAIAGITCIFVALVYTELAAMLPTSGSIYTYSYVAFGEVFAW
FT                   MIGSVIILELGVAAGIVAAGWSGYVQGILAAGGINLPKELTTVPTNGGIINLPAFLISG
FT                   FIGFILYLGTKDSKRLNAILVFIKMTAIFVFILAAAPHFDATNWSNFMPFGFSNVLVGA
FT                   SILFLAFTGFGTIATAAEECKNPKRDIMIGIIGSLVLTTIVYVTMAGLVTGIAPFDQLN
FT                   NDQPLAYALTINNSKIGSAIVATGAVCGMMTVLMMNIYGTSRIFYAIARDGLLPKSFAK
FT                   LHPKYDSPYITIIIFASLAAILGGFCSTELLTQLTSMGALIDYITVTIIVVLFRVTLPD
FT                   AQRPFRCPLVFIIVPFILIACAYLLFIQIYDGEFNLLTAGRALIYWFITIFVLYIIRSF
FT                   FMQKEQN"
FT   gene            412971..414290
FT                   /gene="hisS"
FT                   /locus_tag="RC0412"
FT   CDS_pept        412971..414290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="RC0412"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02950"
FT                   /db_xref="GOA:Q92IK8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IK8"
FT                   /protein_id="AAL02950.1"
FT                   /translation="MPSQGFASPRNDELVVSTQQNKINQMTEKLQPLRGMKDLLPDDYK
FT                   VHDYIINKARDVGVLYGYKQMSTPIVEYTKVFNRSMGESSDVISKEIYSFLDKSNDFVA
FT                   LRPEFTACIIRSLISNRLQHKLPLKFFSTGPVFRYDRPQAGRQRQFHQLNYEYIGAKGA
FT                   ITDADTLKLAVDILKALEIEQDTTLELNSLGCNESRSVYQQKLVEYLNDFKDQLSEESK
FT                   IRLSKNPMRILDSKSETDQKIIANAPVLSEYYTDESKEYFEELIQYLDILGVKYSINPR
FT                   LVRGLDYYCHTAFEFTTKKLGSQSTILAGGRYDGLAKIMGNNDDVPAIGFAAGIERIAL
FT                   MREYNISEVKPVFVLPIGKNNICYALEIVDKLRTENIAIIIESLGKIAKRMQRIFNENA
FT                   QFIIFIGDEEQANNNLKIKDLKKAEEYIVDFAKALELLKK"
FT   repeat_region   complement(414443..414471)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(414472..414497)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(414533..414560)
FT                   /note="REP01, repeated element"
FT   gene            414723..414920
FT                   /locus_tag="RC0413"
FT   CDS_pept        414723..414920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0413"
FT                   /product="ABC transporter ATP-binding protein-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02951"
FT                   /db_xref="GOA:Q92IK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK7"
FT                   /protein_id="AAL02951.1"
FT                   /translation="MVQEILFTDVNLHIKNNKRYGVVGANGAGQTTFFKVLTKEEEPAF
FT                   GEINIPKNSKIGCLKQDQFL"
FT   gene            414992..415201
FT                   /locus_tag="RC0414"
FT   CDS_pept        414992..415201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0414"
FT                   /product="ABC transporter ATP-binding protein-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02952"
FT                   /db_xref="GOA:Q92IK6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK6"
FT                   /protein_id="AAL02952.1"
FT                   /translation="MSRFLRCQKVINFRILLVQSLLNNPDILLLDESTNHLDIESREAL
FT                   KKSLIDFDGTVILVTYDRNYCSFP"
FT   repeat_region   415380..415415
FT                   /note="REP01, repeated element"
FT   repeat_region   415424..415469
FT                   /note="REP01, repeated element"
FT   gene            complement(415639..415857)
FT                   /locus_tag="RC0415"
FT   CDS_pept        complement(415639..415857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0415"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02953"
FT                   /db_xref="GOA:Q92IK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK5"
FT                   /protein_id="AAL02953.1"
FT                   /translation="MANIEDLIVTVQCLKKSITPLIKVTLLLSKVLSKVTSFVSALKKG
FT                   IIYHKHGVTGVKLIKENAFKAKWDCDD"
FT   gene            complement(415757..416110)
FT                   /locus_tag="RC0416"
FT   CDS_pept        complement(415757..416110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0416"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02954"
FT                   /db_xref="GOA:Q92IK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK4"
FT                   /protein_id="AAL02954.1"
FT                   /translation="MKSKKQEGIIASYSPDNKPIENLEQLTLQYYTKKIHQYYQLKKKH
FT                   AFYLATHKITNFNNNSWHIPKEGQIKIDNQELTKGTDKFLGKYRGFDCYGTMSKKIYNT
FT                   FDKGNFTFIKGVK"
FT   gene            complement(416061..416399)
FT                   /locus_tag="RC0417"
FT   CDS_pept        complement(416061..416399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0417"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02955"
FT                   /db_xref="GOA:Q92IK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK3"
FT                   /protein_id="AAL02955.1"
FT                   /translation="MYEKAIIKLRSYVDPNYTLPQNNTLTSNEKTEVLNAVNTGLIADN
FT                   ENKLTSEKSKKIFQNVENALQNDSCNENTLEIGVVNALLNNNLKKYKNMQVNEVKKTRR
FT                   DYCKLFPR"
FT   gene            complement(416627..417367)
FT                   /locus_tag="RC0418"
FT   CDS_pept        complement(416627..417367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0418"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02956"
FT                   /db_xref="GOA:Q92IK2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK2"
FT                   /protein_id="AAL02956.1"
FT                   /translation="MLKNYEIIPGFFEYQLDGELIKWMPDKIISIPPDTLTKIQIMSLA
FT                   FQCSILNRHNEAAKEIFKCIIAAINLYFNSFAKEVEQYSKCAEYLLPVLKLIEPESKLK
FT                   ITQALVPYIKSSLDLSGQFSDLLMENKNFEGVKALLEESIFSLNIHTENQVLAQWYYRT
FT                   GRVYEETGNYDMSTKCYEHAFVLLPTHPTAYHLWSNYRIQGKCDKANDLIQYVPVEYIQ
FT                   YILEMLTNPYEISYKTLDIIKQIP"
FT   gene            complement(417386..417550)
FT                   /locus_tag="RC0419"
FT   CDS_pept        complement(417386..417550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0419"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02957"
FT                   /db_xref="GOA:Q92IK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK1"
FT                   /protein_id="AAL02957.1"
FT                   /translation="MDKNFSSIPTVGAAIEVMHYIFGHLNSEKSTVSSKKVTEIKHSLI
FT                   HKLMPNYPY"
FT   gene            complement(417870..418154)
FT                   /locus_tag="RC0420"
FT   CDS_pept        complement(417870..418154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0420"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02958"
FT                   /db_xref="GOA:Q92IK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IK0"
FT                   /protein_id="AAL02958.1"
FT                   /translation="MIIYKNYILIKQSFINKINMLKSENIQKSDKALKVISKDTFFRPY
FT                   GLPSYSIYYMDDGTTIYRESESPYYYDKVKMIGHDTGYFHKYFTGFGFE"
FT   gene            complement(418141..418569)
FT                   /locus_tag="RC0421"
FT   CDS_pept        complement(418141..418569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0421"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02959"
FT                   /db_xref="GOA:Q92IJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ9"
FT                   /protein_id="AAL02959.1"
FT                   /translation="MREQREEIKQSEVAVIFSSDYRANLYSIFTWLTNFQLEQYARFIL
FT                   NLPKNYKDYEDYFLQEKQQDRYSKIKAFNNVQDKKFLARKYFNLSKQEQSNNYPLFQKN
FT                   TLKLQKYLEYPYEYNTAIDKSEFLGSVDNYYNYSCDNI"
FT   repeat_region   418869..418944
FT                   /note="REP03, repeated element"
FT   gene            419065..419790
FT                   /gene="tolQ"
FT                   /locus_tag="RC0422"
FT   CDS_pept        419065..419790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="RC0422"
FT                   /product="tolQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02960"
FT                   /db_xref="GOA:Q92IJ8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ8"
FT                   /protein_id="AAL02960.1"
FT                   /translation="MSADTNISDGLEVITQDHLSIFSLISSSDIIGKSVMLMLLIASIW
FT                   SWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNPLALIFVSAMDECK
FT                   SLSTKGLSEGLKNNHKERITGAMYLAQNREVEKLEKNLSFLATVGSSAPFVGLFGTVWG
FT                   IMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLISRITLINNKIE
FT                   DFISELNSILSKAIDQEKM"
FT   gene            419790..420221
FT                   /gene="tolR"
FT                   /locus_tag="RC0423"
FT   CDS_pept        419790..420221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="RC0423"
FT                   /product="tolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:RC0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02961"
FT                   /db_xref="GOA:Q92IJ7"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ7"
FT                   /protein_id="AAL02961.1"
FT                   /translation="MAIKLAGSNRKSKRAVVSEINVTPLVDVMLVLLIIFMITSPMLVS
FT                   GVNVDLPETNSSPISGQDEPLVVTINNKGKIFLLEIPIERMHLTDKLANITKEKKDARI
FT                   FVRGDRNVSYGQVVEIVAEIHAAGFSRVALISNIKNNEK"
FT   gene            complement(420855..421307)
FT                   /locus_tag="RC0424"
FT   CDS_pept        complement(420855..421307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0424"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02962"
FT                   /db_xref="GOA:Q92IJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ6"
FT                   /protein_id="AAL02962.1"
FT                   /translation="MRGNYEIIDEAISGVCYYFMRLPYSLRLLVMTGWYPRRQCPTYNL
FT                   LGSKLKLISFQWLKRAESRCSIGLACHTALIALSTKASQTLAGILGQIFLLTFACSTLP
FT                   ALSSVILIMTFTLLLPLTPAGTLLQCLSICLFIKDVSLSERGSPSV"
FT   repeat_region   421213..421310
FT                   /note="REP01, repeated element"
FT   gene            complement(421663..422037)
FT                   /locus_tag="RC0425"
FT   CDS_pept        complement(421663..422037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0425"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02963"
FT                   /db_xref="GOA:Q92IJ5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ5"
FT                   /protein_id="AAL02963.1"
FT                   /translation="MLKNNYILKIVFYKGLYVILNYHLHFSHYNNISFSSVWLRKYSFE
FT                   GFLKRTLQNLLPEQQILAVIIASLIFGITYFQGRIIALRTICGFFYGYAYYKTGKIFML
FT                   CDSSFRSKFMPCIIIYLSCS"
FT   gene            422179..422886
FT                   /locus_tag="RC0426"
FT   CDS_pept        422179..422886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0426"
FT                   /product="(p)ppGpp 3-pyrophosphohydrolase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02964"
FT                   /db_xref="GOA:Q92IJ4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ4"
FT                   /protein_id="AAL02964.1"
FT                   /translation="MKDIEYWEKNFESCKYSDQLIERLLFLNTQVKQPIDIREVQKGIY
FT                   YARKYHGAQMRQSGDPYYSHPIAVTIMVAEFVAKEVPKLFTFRMLQAALLHDTIEDTEL
FT                   TEEIISNIFDEEVARHVAGLTRIKPWGKISSEKSLMLLIKQKRYDTALIKLFDRIHNLQ
FT                   TLEAKSPEKAHKIIKETLKSFLVLSEILEIPSVSELIYAECYKNNLKFNINSTFNKIIN
FT                   FDSFPFSQNKLLP"
FT   gene            complement(422837..424153)
FT                   /gene="proP2"
FT                   /locus_tag="RC0427"
FT   CDS_pept        complement(422837..424153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP2"
FT                   /locus_tag="RC0427"
FT                   /product="proline/betaine transporter"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02965"
FT                   /db_xref="GOA:Q92IJ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ3"
FT                   /protein_id="AAL02965.1"
FT                   /translation="MLGYEKEQRSLNTEQKQAVGLLSIGTFLEYFDLMLYVHMAVLLNN
FT                   LFFPEYDPFTFSLLTAFSFCSTYLLRPIGALIFGYIGDHFGRKIVVVLTTLLMAITCVI
FT                   IGSMPTYAQIGITASWVLTICRIIQGMSATAEARGAELYLTENSSPPIQYPLVTIITVF
FT                   SAVGTTVALGIASIFTNQNIYHHESSWRIAFFVGATIAFVGTIARTSLKEAEAFSNKRN
FT                   QLKLRLQENNIMLEEIDKDILDQKVPNTTSIWYFFIQCARPPCFYFVYIYCGDILKREC
FT                   GFTPNQIINQNFWVSIIDLLGIIGLAFISYKIHPLKILKVKLYLFFTSLIFFPIMLNYN
FT                   PTPLYIFIFQCLAALFVFDHVPAAPIFYKYFPVFKRFTYTSMLSAIAKLFTYIITSFGL
FT                   VYITNYLGYWGLFLIFIPVGITFFMGVTYFEKMETNRNL"
FT   gene            complement(424292..425827)
FT                   /gene="aprE"
FT                   /locus_tag="RC0428"
FT   CDS_pept        complement(424292..425827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprE"
FT                   /locus_tag="RC0428"
FT                   /product="alkaline protease secretion protein AprE"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02966"
FT                   /db_xref="GOA:Q92IJ2"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ2"
FT                   /protein_id="AAL02966.1"
FT                   /translation="MQDLKHNKPQITPEQLKQLLSLREDALNLKGQSSKRKALINTTLK
FT                   KTSHAIEFLLVKLDRFVNFITKKTDKDRNNVAQAARSPILFGIYVMIFLVLIGGLWSAL
FT                   APLDSGAVAVGIVMPSTNKKTIQHHEGGIINAIYVKQGDKVKEGDKLIELEETRIKSEH
FT                   ENILGQYRNFLATENRLIAERDNLEQIEFSDFLMQDINLPEVAKIIHTQENLFRSRKEV
FT                   YNSEKDALHQNIAQLEKKIEGLEAKKVAASKTAEVYQDRLKALRTLKEKGFVQKAALLD
FT                   QEAKVAASKSDVATTEAEIAGIRHAITETQIKIINQQNKYTERTLTELREAQVQTASLK
FT                   EKYNALTDSLNRVIIRAPVDGIVNSLKYHTIGGVISHGQPIMEISPTNDPLIIEAKVSQ
FT                   KNIDSVHEGLVAKIRFSAFKSRTTPTFTGKVVSISPDIVQDERQYPGQQQDNYYVARVE
FT                   IDMDEFNKVAKVKNLELHPGMQAEVQIVTGTRTLLRYLLDPVTDTAFKAFREK"
FT   repeat_region   complement(425874..425915)
FT                   /note="REP01, repeated element"
FT   gene            complement(426010..427764)
FT                   /gene="aprD"
FT                   /locus_tag="RC0429"
FT   CDS_pept        complement(426010..427764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprD"
FT                   /locus_tag="RC0429"
FT                   /product="alkaline protease secretion ATP-binding protein
FT                   AprD"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02967"
FT                   /db_xref="GOA:Q92IJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IJ1"
FT                   /protein_id="AAL02967.1"
FT                   /translation="MDNKNNNLNKKNPLIIALGECRTAFWIVFWFAFVINLLMLITPLY
FT                   SLQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFA
FT                   SSISAAATRANMGSSQLLRDFQAVKTFLTSTGINTLFDAPWSLIYIAVIFSIHPYIGLI
FT                   TVFGAIIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAEAIEAMGMMKNVTKN
FT                   WHKFNILALDKQSVASYRNGVISNFSRFIRNIMQMAVTGVGAYIVVKSHSADMTPGNMI
FT                   MSSIIVGRALAPFDNAIDLWKSMSGAIKSYKNINNLFNTYSSRDETMPIPNVDGHLTVE
FT                   NIYYAHPIPQYLPQPPVPKYILKGVSFAVQPGEVLAIIGPSATGKSTLAKIIVGVWKES
FT                   SGSVRLDSAEIYRWNREDFGRHVGYLPQGIELFSGSIKQNIARMEEDADPQKVIEAAKI
FT                   AGAHEMILRFPDGYDSDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAG
FT                   EVALASALKQAKLKGIAVLVISHRPSVLSVVDKILILQDGAVAVYGTEEEIQKHFKTLK
FT                   SGTIHINN"
FT   gene            complement(427775..428791)
FT                   /gene="asd"
FT                   /locus_tag="RC0430"
FT   CDS_pept        complement(427775..428791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="RC0430"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02968"
FT                   /db_xref="GOA:Q92IJ0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IJ0"
FT                   /protein_id="AAL02968.1"
FT                   /translation="MTKKYNIAVIGATGNVGRETLNILAERNFPINKVYAIASDSSLGR
FT                   EVSFGEKILQINSLKSLHFDDIDIAFFCAGSEVSKEFIPKATASNCVVIDKSSLFRVDN
FT                   QVPLIVPEVNLSTLKEFNTKNIIANPNCIVIPLAVALKPLDNEIKIKRVVISTYQSVSG
FT                   AGKAGMDELYDQTKSKYVFGENDPKKFPKQIAFNIFPHIGDLNKDGYTSEEAKIASELN
FT                   KIIGNHFKASVTSVRVPVFIGHSISVNIEFNDKIDAKEVEEILQDADGIVTISNNNYLA
FT                   YISPVEVVGEDAVYVSRIRNDVSRDNTINLWITCDNLRKGAALNSVQIAEELINNYL"
FT   gene            complement(428784..429146)
FT                   /gene="pkcI"
FT                   /locus_tag="RC0431"
FT   CDS_pept        complement(428784..429146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="RC0431"
FT                   /product="protein kinase C inhibitor 1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02969"
FT                   /db_xref="GOA:Q92II9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II9"
FT                   /protein_id="AAL02969.1"
FT                   /translation="MMYNKENVFAKIIDKNLPAEIIYEDEQILAFKDIAPVAPVHIIVI
FT                   PKNEYIDYADFISKASIDEIKHFFAKLSDIANEAGLDKDGYRLITNKGEKSGQTIFHFH
FT                   FHIIGGEKLIGLINND"
FT   repeat_region   complement(429187..429244)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(429271..429303)
FT                   /note="REP01, repeated element"
FT   gene            complement(429334..429687)
FT                   /locus_tag="RC0432"
FT   CDS_pept        complement(429334..429687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0432"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02970"
FT                   /db_xref="GOA:Q92II8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II8"
FT                   /protein_id="AAL02970.1"
FT                   /translation="MNIYAIYINSTQKNNNFIVIAEGFSWIAALLSIFWALYHKMWLIV
FT                   AIAVIANIIVTAINIAELKFIFKIVLILGFGFFASDIRENYLKRNNYRLEDIIIANSRI
FT                   EAELKFLKRSMLV"
FT   repeat_region   complement(429769..429894)
FT                   /note="REP04, repeated element"
FT   gene            429961..430509
FT                   /gene="hslV"
FT                   /locus_tag="RC0433"
FT   CDS_pept        429961..430509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RC0433"
FT                   /product="heat shock protein HslV"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02971"
FT                   /db_xref="GOA:Q92II7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92II7"
FT                   /protein_id="AAL02971.1"
FT                   /translation="MSDNLSLHGTTILCLKKNEEIIIAADGQVSHGNTVLKSTARKLRT
FT                   IANNKIIAGFAGSTADGLALFEKLAVKIEQHKHNLLRSAVELAKDWRSDKYLRRLEAMM
FT                   IVADRSHILILTGNGDVVEPENNVAAIGSGGLFALSAARALMSYENNLTAEEIALKSMN
FT                   IAADLCVFSNHNIIMEKVV"
FT   gene            430506..431858
FT                   /gene="hslU"
FT                   /locus_tag="RC0434"
FT   CDS_pept        430506..431858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RC0434"
FT                   /product="heat shock protein hslU"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02972"
FT                   /db_xref="GOA:Q92II6"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92II6"
FT                   /protein_id="AAL02972.1"
FT                   /translation="MKATKTTYKKDPMGLTPSQIVNELNRFIVGQEKAKKAVAIALRNR
FT                   CRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVG
FT                   RDVESIIRDLVEIAVNTEKTLAKTKVDIHAREKAIERILDSLVGKTSSSETREKFKEKI
FT                   LNGELDDKEIEISVADTTPVGGGSFEIPGMPGASMGVLNLGDMIGRALGSSKTKTKKML
FT                   VKDAMAIIIPEESEKLIDQEKIIQQAINLAENDGIVFIDEIDKIASTGSSGAKNAEISR
FT                   EGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELN
FT                   SLTKDDMIKILLEPETSLIKQYSALIGTEDVHLEFAASAIEKIADYAITVNLEVEDIGA
FT                   RRLHTILENLLEDISFEASEMKGKKITIDDKFVENQLSKIITNLDLAKFVL"
FT   repeat_region   complement(431902..432000)
FT                   /note="REP01, repeated element"
FT   gene            432102..432590
FT                   /locus_tag="RC0435"
FT   CDS_pept        432102..432590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0435"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02973"
FT                   /db_xref="GOA:Q92II5"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II5"
FT                   /protein_id="AAL02973.1"
FT                   /translation="MLSSIGLALHTKKILINLVLADLVKEGSHFDLAIACAILTAMNIL
FT                   YELEIAEYLIIGELSLDGSSLPLSGALPAAIGASIRGKSLICSSKNSSEVAWSGNDNIL
FT                   VAGNLIELVNHFKGSQVLTPPEAKLQDEPINYPDFKDIKGQKIAKQALEIAASGGITF"
FT   gene            432655..432858
FT                   /locus_tag="RC0436"
FT   CDS_pept        432655..432858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0436"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02974"
FT                   /db_xref="GOA:Q92II4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II4"
FT                   /protein_id="AAL02974.1"
FT                   /translation="MSTKEILECSTITSIAGKFLDGKLTKARPCRTPHYSCSLAAMVGG
FT                   GVGKKVKPGEITLAHNGSIILR"
FT   gene            433031..433537
FT                   /locus_tag="RC0437"
FT   CDS_pept        433031..433537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0437"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02975"
FT                   /db_xref="GOA:Q92II3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II3"
FT                   /protein_id="AAL02975.1"
FT                   /translation="MKAPKCASDYQMKVSGPIMDRFDLHIEVSSINVYNYDLIVDNSEE
FT                   ESEYIAARVEKVRLIQEKRYEGYNIKTNNRLDGQLLIDCAIPADEGKDLLNEAANKFCL
FT                   SMRAYNRILRVARTIADLKNVDKVLKVHIAEALSYRKIEFDNMYTKINFKKSKESTRRG
FT                   TQRIT"
FT   repeat_region   433472..433585
FT                   /note="REP04, repeated element"
FT   gene            433844..434029
FT                   /locus_tag="RC0438"
FT   CDS_pept        433844..434029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0438"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02976"
FT                   /db_xref="GOA:Q92II2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II2"
FT                   /protein_id="AAL02976.1"
FT                   /translation="MEDEEGHKYIVEIDKSYTNLFMHKACFNFSRLIVDSISKSEDYST
FT                   IKKYFILIYCIFLLII"
FT   gene            434005..434583
FT                   /locus_tag="RC0439"
FT   CDS_pept        434005..434583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0439"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02977"
FT                   /db_xref="GOA:Q92II1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92II1"
FT                   /protein_id="AAL02977.1"
FT                   /translation="MYFPFDNMKAPLYHGKTIFREVDKKHPMQFSLGDMRGKIFDLYNV
FT                   LPEYVVISVPLFNDVIRDELDEWLYVVKHSEVKKDFKSPYMKKVAKRLDILKITPKEQI
FT                   IYHAYMNKSYKERDYIVSAEEKGREQGMAKGIEEGRKKGKQEGEVTKSIKIATKMLMKK
FT                   NSIEKIHEITEVSIKEIERLQTEIENLKK"
FT   gene            434593..435933
FT                   /gene="lpxB"
FT                   /locus_tag="RC0440"
FT   CDS_pept        434593..435933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="RC0440"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02978"
FT                   /db_xref="GOA:Q92II0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92II0"
FT                   /protein_id="AAL02978.1"
FT                   /translation="MIKIYFIAGEVSGDFVGGRIMQHLKNNTGVQLNSPVSSFVNDAVQ
FT                   FVGVGGKYMEEAGSFKSLFPITSINLMGFVEILPHIFKLKKLIDKTVEDIINSKADLLI
FT                   TIDSPGFTYRVAKRVRKLLPKLKMIHIVAPSVWAYKEGRAVKYAKIYDCLFALLPFEPP
FT                   YFTKVGLDCRYIGHPIMEQEFYSDKIALREEFKIDENERVLCVTLGSRKGEILRHLSVF
FT                   VSSIEEIFKSCNNLKVIFTLANPAHEAIIKPFLEDVKFNYLFSSERLKIYAVADVALAK
FT                   SGTNTLEIAASGTPMIVAYKVNLISFFIIRLLIKIKYVTLINIIADKEIIPEFIQFNCR
FT                   ANLISNKLQELLFNSKKAYEQVIESQKILQQLGFKSNRLQLNSESFRHDEFKGKLARCT
FT                   KVREHRLSLENSLVSSDRDDAVPSYIAAAIIKQEFLEPKIKLLKEKD"
FT   repeat_region   435730..435845
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   gene            complement(435930..436202)
FT                   /locus_tag="RC0441"
FT   CDS_pept        complement(435930..436202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0441"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02979"
FT                   /db_xref="GOA:Q92IH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH9"
FT                   /protein_id="AAL02979.1"
FT                   /translation="MIQDHNTDLKHEEQTERLKALQNKLGNLSGFLTTMRSDNNEEYKK
FT                   ISNDLKILMKQINTIRKNMEIYFVIILILMFIIIQKMLWTTGFKY"
FT   gene            436550..437569
FT                   /locus_tag="RC0442"
FT   CDS_pept        436550..437569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0442"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02980"
FT                   /db_xref="GOA:Q92IH8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH8"
FT                   /protein_id="AAL02980.1"
FT                   /translation="MLNNLLKTKLFLVIVSLTIFITLLNFSIFYIFVPGDLTQNKTIII
FT                   EPKLSVNQIVTKLYSNEVIKYPRIFKVIAKIYSIKRPLKSGEYVFTRNISPLQTLRILA
FT                   SGKSIIHKIIVPEGTVVSEVIKKINEESRLLGEIKGIIPEGFLMPSTYFFSYGDQKEQI
FT                   IDHMRNLMSANLDKVMQNLAPDSPLKTRLEVLTLASIIEKEAGSNAEKPIIAAVFINRL
FT                   KKNMKLQADSTTIYALTEGKFKLARALTKKDLLQELPYNTYYIKGLPPGPISCPSLKSL
FT                   EAVVKSAKTDALFFVVDGKGGHNFSNNLNDHNRFVETYRKSLIKVPEPAIDPEKPSTR"
FT   repeat_region   complement(437575..437682)
FT                   /note="REP04, repeated element"
FT   gene            437709..438020
FT                   /gene="cyaY"
FT                   /locus_tag="RC0443"
FT   CDS_pept        437709..438020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RC0443"
FT                   /product="cyaY protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02981"
FT                   /db_xref="GOA:Q92IH7"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IH7"
FT                   /protein_id="AAL02981.1"
FT                   /translation="MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDK
FT                   GVYVINKQSAAKEIWLSSPVSGPYHFFYEQGEWTNRAGLELMAILTEELNIKFDTRPT"
FT   repeat_region   complement(438015..438127)
FT                   /note="REP04, repeated element"
FT   gene            438377..438727
FT                   /locus_tag="RC0444"
FT   CDS_pept        438377..438727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0444"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02982"
FT                   /db_xref="GOA:Q92IH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH6"
FT                   /protein_id="AAL02982.1"
FT                   /translation="MQRKVILIDEEWVEVINKLKEKFLVYGLTQMNTGAFGNIPSMQDW
FT                   RYKELKELGIELSDNEKLAIYNSGQKDDAIFYKGIFITGNHSKSGTLSKFSEELNASLL
FT                   YLLMIVRSILKM"
FT   gene            439793..440308
FT                   /locus_tag="RC0445"
FT   CDS_pept        439793..440308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0445"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02983"
FT                   /db_xref="GOA:Q92IH5"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH5"
FT                   /protein_id="AAL02983.1"
FT                   /translation="MDKQDYITLLAHEHLHNCTGKKIRNNLERLNYWWSEGLTDYYSRV
FT                   LALRSSVITLEEFVEEFNKFFENYYLSPVINEPNNLIETDYWQDYAVQRLPYYCGFVLA
FT                   LYLDNFIKENNKSKSLDNVMLDLFKTSKEQEFSSDYFKTIVKNYVPKGIDKEINEYIEQ
FT                   GKTIDLNY"
FT   gene            440343..440633
FT                   /locus_tag="RC0446"
FT   CDS_pept        440343..440633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0446"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02984"
FT                   /db_xref="GOA:Q92IH4"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH4"
FT                   /protein_id="AAL02984.1"
FT                   /translation="MWAYDRGFDRDALINNYTIKDIDENSNAYKSGLRNRDIVIKYDVP
FT                   KWGSPDQIVTSNTIKGEFQFRPESANKKDIYGFKPTLSKEDKLKIKKFFNS"
FT   gene            440931..441125
FT                   /locus_tag="RC0447"
FT   CDS_pept        440931..441125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0447"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02985"
FT                   /db_xref="GOA:Q92IH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH3"
FT                   /protein_id="AAL02985.1"
FT                   /translation="MIENGAKTVCSVQGCVSDVNNSNYSVVSTFAQATVASLATFAYYN
FT                   PPVFIGAFTLGAILISSSD"
FT   repeat_region   complement(441139..441231)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   441239..441272
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(441279..442622)
FT                   /gene="gltX1"
FT                   /locus_tag="RC0448"
FT   CDS_pept        complement(441279..442622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="RC0448"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02986"
FT                   /db_xref="GOA:Q92IH2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IH2"
FT                   /protein_id="AAL02986.1"
FT                   /translation="MTKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDT
FT                   DLERSKQEYKDAIEEDLKFLNIHWDQTFNQLSRLSRYDAIKNLLLDKKRLYACYETPEE
FT                   LELKRKFQLSKGLPPIYDRASLNLTEEQAKKYIEQRRKPHYRFLVNHEPISWHDMIKGE
FT                   VKYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQMQMFEALN
FT                   TTPPTFGHLSLIINKDEKISKRVGGFEIATLRKEIGIEAMAIASFFSLLGSSAQILPYK
FT                   SMEKLANQFEISSFSKSPTIYQPEDLERLNHKLLISLDFDTVKERLKEIDAEYIDENFW
FT                   LSVSPNLQTLRDVKDWWEICHQTPNVETLNLDKEYLKQAAELLPKGEITKDSWSIWTKE
FT                   ITNITGRKGKELFLPLRLALTARESGPEIASVLPLIDREEIIKRLTSA"
FT   repeat_region   complement(442643..442670)
FT                   /note="REP03, repeated element"
FT   gene            complement(442731..445061)
FT                   /gene="topA"
FT                   /locus_tag="RC0449"
FT   CDS_pept        complement(442731..445061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="RC0449"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02987"
FT                   /db_xref="GOA:Q92IH1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IH1"
FT                   /protein_id="AAL02987.1"
FT                   /translation="MKLVIVESPAKAKTINKYLGDEFKVIASFGHIRDLPSKKGSVLPD
FT                   ENFAMKYDISDKAGKYVDAIVKDAKKADAVYLATDPDREGESISWHVAEVIKEKNQVKS
FT                   DDFFKRVAFNEITKKAIIHAVENPRKLDTNLVNAQQARRALDYLVGFTLSPLLWRKLPG
FT                   CKSAGRVQSVALRLICEREDEIERFKSEEYWDISLKMQNSNNELFTAKLTHVNDQKLEK
FT                   FSIINEKNAKDLTKKLKSHKFHVDKIEKKQQKRQPQPPFITSSLQQEAARKLGFSAKKT
FT                   MQIAQKLYEGVDIGKETIGLITYMRTDGVTLSNDAIADIRKLIDKSYGDKYLPTSPRIY
FT                   KSKVKNAQEAHEAIRPTNITYTPDSLKEKLDKDYYKLYELIWKRTIACQMENVIMDLVV
FT                   ANLASENKEYLAKANGSTIAFDGFYKVYRESMDDEAEEENKMLPPLKEQEPLKTKAVIP
FT                   NQHFTEPPPRYSEASLVKKLEELGIGRPSTYASILSVLQDRKYVALEKKRFIPEELGRL
FT                   VTVFLVGFFKKYVEYDFTAGLENELDAIAAGKLEWKAALNNFWSGFNHNIESVNEQKIT
FT                   EIISYVQKALDYHLFGENKESKICPSCNTGELSLKLGKFGAFLACSNYPECTFRKSIVS
FT                   GNDNNENEGEPAAMPNENKVLGTDKDGVEIYLKKGPYGPYIQLGKQEGKVKPKRSPVPA
FT                   SLNQNDITLDIALKLLSLPLKIGIHKDSDEEIMIGYGKFGPYIKYMGQFISVQKKYDFL
FT                   NLSLDDAMKLIEENKAKLEKKQA"
FT   gene            complement(445193..445528)
FT                   /locus_tag="RC0450"
FT   CDS_pept        complement(445193..445528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0450"
FT                   /product="DNA processing protein Smf-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02988"
FT                   /db_xref="GOA:Q92IH0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IH0"
FT                   /protein_id="AAL02988.1"
FT                   /translation="MVVEASLKSGSLITAKFALEQNRAIFAVPGFPLDPKCQGTNKLIR
FT                   EGAYLVESVDDIVANLPQYEEFMKKDDGLFKDFVELGTVNTRYVKEPSQKERTACYIGI
FT                   IIGSTHK"
FT   repeat_region   complement(446254..446385)
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(446464..447072)
FT                   /gene="tdpX1"
FT                   /locus_tag="RC0451"
FT   CDS_pept        complement(446464..447072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdpX1"
FT                   /locus_tag="RC0451"
FT                   /product="thioredoxin peroxidase 1"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02989"
FT                   /db_xref="GOA:Q92IG9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG9"
FT                   /protein_id="AAL02989.1"
FT                   /translation="MNMSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFY
FT                   PLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFP
FT                   MVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDAL
FT                   THHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL"
FT   gene            complement(447148..448086)
FT                   /locus_tag="RC0452"
FT   CDS_pept        complement(447148..448086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0452"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02990"
FT                   /db_xref="GOA:Q92IG8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG8"
FT                   /protein_id="AAL02990.1"
FT                   /translation="MEYALLIFSIIAILVIIQMVKVVPQQQAWVVEKLGKFDKVLQPGL
FT                   NLLIPVIQRVAYKHTLKEEAIDVTAQTAISNDNVTLSIDGVLYVKIIDPMAASYGVNNP
FT                   YYAITQLAQTTMRSEIGKLPLDRTFEERETLNVAIVAAINQAAINWGIQCMRYEIKDIQ
FT                   PPQTILKAMELQVAAERQKRAQILESEGNRQAKINHAEGEKAQIVLNSEASYTDQVNRA
FT                   KGEAEAIGLVATATANSIEIVATAVQKTGGSDAVALKIAEQYISAFGNLAKDTNTVILP
FT                   ANLSEPSSFITEALTIFNQLKASSSGTKIDK"
FT   gene            complement(448164..448391)
FT                   /locus_tag="RC0453"
FT   CDS_pept        complement(448164..448391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0453"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02991"
FT                   /db_xref="GOA:Q92IG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG7"
FT                   /protein_id="AAL02991.1"
FT                   /translation="MSDIPKLDDYYYRFLQSILLKTLEQNKAAETYLLQKDFNSALNEI
FT                   QNVNEQLEEYSSILSLLKVIKTHFNDKKNI"
FT   gene            complement(448458..450026)
FT                   /locus_tag="RC0454"
FT   CDS_pept        complement(448458..450026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0454"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02992"
FT                   /db_xref="GOA:Q92IG6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG6"
FT                   /protein_id="AAL02992.1"
FT                   /translation="MLKTIQKHLDTKLIKLSAILAFIYCLLFNTAILIYKFDYYKATIF
FT                   RGILELSKDFCYIYIFSFIAFFGLSVHRLVLKIGVGFLFITSAIASYYIYFFKINPTKQ
FT                   VIGSFFSTDLNEVYELTSIKLIIWIIFCLFTCFYTLKSFAAENSKSFVTKLLSTACLLI
FT                   FVYNIITPSFKILKNYFPIQYLHNSYLNFAGNFGEKNYACIDISKQYNFIDKSDKDIIG
FT                   VLVIGESARFDHFGINGYERDTTPYLKTTQNLISFKAKSSSNLTYLSVPSLLSRYPASQ
FT                   IENSRQENSFLSILTNLGFNTTWIGTQTLMRSFANFDLSNIYNDVNFTIVPGGSALFSL
FT                   NDHDEKILPFIKEILTNSEKQFLVVHTSGSHWNYNARYPKEFEYFTPTCPIKVKGDASD
FT                   CDKLALVNSYDNSILYTDFFLYNLIDLLKDKNAFLLYVSDHGESLGENGYYGHGGPLLA
FT                   EQITVPLIVWVSDDFQAKYPKSVSSIKNYANTEISHDYVFHSILNCLNIESDIIDKDLS
FT                   ICKSS"
FT   gene            450062..450526
FT                   /locus_tag="RC0455"
FT   CDS_pept        450062..450526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0455"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02993"
FT                   /db_xref="GOA:Q92IG5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IG5"
FT                   /protein_id="AAL02993.1"
FT                   /translation="MIIKNLQEFYRLLIPNVPLIAIDYGNKKLGIALSNQERSIAMPLN
FT                   TITEINKKIVITSLLNIIEKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAEELAKSINLP
FT                   IYLQDERLTTKAANNLLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI"
FT   repeat_region   450574..450710
FT                   /note="REP02, RS3-like repeat"
FT   gene            451127..451981
FT                   /locus_tag="RC0456"
FT   CDS_pept        451127..451981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0456"
FT                   /product="putative dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02994"
FT                   /db_xref="GOA:Q92IG4"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG4"
FT                   /protein_id="AAL02994.1"
FT                   /translation="MKILILGVTGMLGNSIFRFLNSDKKFDIFATARNNSARSYFSKDL
FT                   SDKLITNVDVENHDALVEVFNQTKPDIVINCIGLVKQLADANDPLKALPINSLLPHRLA
FT                   NLCKLANSRLIHISTDCVFSGKKGHYKESDFSDCYDLYGRSKLLGEVDYPHAITLRTSI
FT                   IGHELAGNRSLINWFLSAEGSVKGFEKAIYSGFPTVELARIIRDFVLPNKELHGLYHVA
FT                   SKPINKLELLKLVAEIYNKDIDIISSDELVVDRSLDSTRFNEVTGYTPPEWRELVKRMC
FT                   EFK"
FT   repeat_region   complement(451996..452131)
FT                   /note="REP02, RS3-like repeat"
FT   gene            452164..453189
FT                   /gene="capD"
FT                   /locus_tag="RC0457"
FT   CDS_pept        452164..453189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capD"
FT                   /locus_tag="RC0457"
FT                   /product="capD protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02995"
FT                   /db_xref="GOA:Q92IG3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IG3"
FT                   /protein_id="AAL02995.1"
FT                   /translation="MFVDKTLMITGGTGSFGNAVLSRFLKSGIINDIKEIRIFSRDEKK
FT                   QEDMRIALNNPKLKFYIGDVRNYKSIDEAMHGVDYVFHAAALKQVPTCEFYPMEAINTN
FT                   VLGAENVLSAAINNKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETVL
FT                   CVTRYGNVMASRGSVIPLFINQIKQGKVLTITEPSMTRFLMSLVDSVDLVLYAFEHGHQ
FT                   GDIFVQKSPASTIEVLAKALQDIFDSKNEIRFIGTRHGEKHYESLVSSEEMAKADDLRD
FT                   YYRIPMDGRDLNYAKYFVEGEKKVALLEDYTSHNTKRLNLEEVKELLLTLDYVQEELKN
FT                   A"
FT   gene            453182..454315
FT                   /gene="rffE"
FT                   /locus_tag="RC0458"
FT   CDS_pept        453182..454315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="RC0458"
FT                   /product="putative UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02996"
FT                   /db_xref="GOA:Q92IG2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG2"
FT                   /protein_id="AAL02996.1"
FT                   /translation="MLKVMTIVGTRPELIKLCCVISEFDKYTHHILVHTGQNYAYELHQ
FT                   VFFDDMGIRKPDYFLEVAADNTAKSIGLIIEKVDAVLEKEKPDAVLFYGDTNSCLSAIA
FT                   AKRRKIPIFHMEAGNRCFDQRVPEEINRKIIDHISDVNITLTEHARRYLIFEGLPPELI
FT                   FKSGSHMPEVLDRFMSKILKSDILDKLSLTTKQYFLISSHREENVDVKNNLKELLSSLQ
FT                   TLIKEYNFPVIFSTHPRTKKRLEDLEEFKELGDKIRFLPAFGFTDYVKLQMNAFCILSD
FT                   SGTITEEASILNLPALNIREAHERPEGMDAGTLIMSGFKAERVLQSVKAITEEHENNKR
FT                   LQEIVPDYAEAGLVSKKILRIVLSYVDYVNHTVWFKK"
FT   gene            454275..455621
FT                   /locus_tag="RC0459"
FT   CDS_pept        454275..455621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0459"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02997"
FT                   /db_xref="GOA:Q92IG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG1"
FT                   /protein_id="AAL02997.1"
FT                   /translation="MWIMLTIQYGLKSNPIHYYHIKNMKFFKLIKLNTLFLSVFLLITL
FT                   ISSFGYSKENSYKKIVFLVSTETFGGKGVYAMYNEMKKIGHDVKIVIVPHPHPNIQGGI
FT                   DTGFISKFDAQDVIYPCGKYASYSNVNTKCEISELKNYQPDFIFTQNPYENFQGYISEP
FT                   FTAANLYKSFRGTKTKIMYIVYGPHIFHQKNIDDDKLSSCIETVFVDSESTKDIFISNY
FT                   KFPKDRVIVSGYQPYYEVRNYNIKEKPNSETILWLPRWELSFKNRDLYEGGSTFLNYHY
FT                   FFYNYALQHPNIHFIIRPHVTLFTYAVGKNYLSQSDMDNILSRFNSLKNVTVSAHAFRS
FT                   LLDDIMVSDIVISDGTSSLAEVVVADKPIIYLSNGWNNEFNSNALSKELKKYMYFAYEP
FT                   QDIINYIEFIKQNHYLPYYENSSGRNQFKKMLDPVENPAAFIAEYLLKL"
FT   gene            455637..455933
FT                   /locus_tag="RC0460"
FT   CDS_pept        455637..455933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0460"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02998"
FT                   /db_xref="GOA:Q92IG0"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IG0"
FT                   /protein_id="AAL02998.1"
FT                   /translation="MLEEIYNDGERLILGATYDVLKVMRHKSSYKIFKKIIEADILNSP
FT                   LMLNQKIKILDIGCGTGHGTFMLSDILGVEITAIDISKESIIYAEQNCGASNI"
FT   gene            456307..458121
FT                   /locus_tag="RC0461"
FT   CDS_pept        456307..458121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0461"
FT                   /product="putative two-domain glycosyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAL02999"
FT                   /db_xref="GOA:Q92IF9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IF9"
FT                   /protein_id="AAL02999.1"
FT                   /translation="MTTRKDKPLNIYHTLVSIIIPVYNGANYMKEAINSALAQTYKNIE
FT                   IIVVNDGSKDNGETERVALSYGDKIRYFYKENGGCGSALNYGIKNMQGEYFSWLSHDDI
FT                   YYPNKIEHQVDILNKLDNKDTIIYGGYELIDEKGNSLRYIKPDSVLPINKLNISLLPLL
FT                   RGLIHGCSLLMPAKYFHEVGIFNEALPTTQDYDLWFKIFRVAPIHFDESILIKSRFHSE
FT                   QGSKKISNHNEECNVLWSSFLHELTEEEMIKMEGSPYLFLTRTATFLSNNTPYKKACDL
FT                   ANTMAKQVLNDTKISVIIPVYNRINWAIEAIKSVLIQTHKNFEILIIDDGSTDDISELT
FT                   AICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLKFMEEN
FT                   NFIFSHTSYHKINEKGKYIESVHSGLFSGNVFPQVIQTCPIAMPTVMGTLTLFQENLFP
FT                   ENIRSGEDCCLWISIASKNSIGGIDKELSKVRISGGTNTFMDPNKYSVGLINITSYVLN
FT                   DAYLSKFSPFTINLLLAAVTQLRLLENKNEDYKKSNISFFKNNYVIQKIRTYCFVTKIL
FT                   ILLTITSIRQEGIRATISRIQRWLKKHI"
FT   gene            complement(458126..459124)
FT                   /locus_tag="RC0462"
FT   CDS_pept        complement(458126..459124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0462"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03000"
FT                   /db_xref="GOA:Q92IF8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF8"
FT                   /protein_id="AAL03000.1"
FT                   /translation="MMSAKLIVLFTLLISFSTMASKKEEEKITAVKATKVQIAELYDIF
FT                   NIVGQCQNDNSRDYYANATGVVEQVSAHQGEIVKKGDILLVIDKNIAETTKSRAAALLN
FT                   TKQEDYNSKEALFAKKFVSNEEYKRSKSELEDAKFNYAKALKTYNDMIITAPYSGKIGV
FT                   IKSMVGDEVKIGDYLFSITGTENSQGIFIELPESLSGKVGVDTEVLIAGKIKSTIGAVS
FT                   HYLSDNGTLTAKIILPMGTKILHNSFVDVTLIINPHKNLTVPESCIQRNNQGTFIYKIE
FT                   GYTIKQLYVKIGTRTEDLIEIISDDIKAGDLVVTEGMTKIGDGSKVKILEE"
FT   gene            complement(459216..460010)
FT                   /locus_tag="RC0463"
FT   CDS_pept        complement(459216..460010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0463"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03001"
FT                   /db_xref="GOA:Q92IF7"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF7"
FT                   /protein_id="AAL03001.1"
FT                   /translation="MYSNINKVHDFKEVIEAVKQADNTSLVLFDVDEVIVMDSDESRLT
FT                   HDYRKELMKNIEKRLTRKECELLLSIVLKDRKARFVNPDILTIFALLTEKNVPAMGLTK
FT                   LPTGKFGVIEDMIEWRIRELTELKVNFQEFSPLEDEIIIEDFNAGYGKPTLKDGIIYTA
FT                   EYDKGSMLEYVLRKTSYYPQSIIFIDDIEENLLSLQEICKKLKINYQGFEFTGSAIVPE
FT                   PVLDAQLEKIRFEILEKEYKWLTDEELKKHTLSSSSLSTVSS"
FT   gene            complement(460020..460787)
FT                   /locus_tag="RC0464"
FT   CDS_pept        complement(460020..460787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0464"
FT                   /product="hydrolase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03002"
FT                   /db_xref="GOA:Q92IF6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF6"
FT                   /protein_id="AAL03002.1"
FT                   /translation="MHKLYNKTQDKFIVYDNYRIINTNIPSVIFLHGLMSSMQSTKAIY
FT                   LIDYCKKNNYNFIVFDNFGHGNASGQFKDQTISDWLEGVSLILDKLINTEAILVGSSIG
FT                   GWLAFLAALRFPDKIKGLVCVAPAPDCTENIWQNISLNDQNKMQKEGILEVSGKNCEHK
FT                   YPISYKLIEDAKKHLLLTKKQIDINIPVHLIHGMLDEDVPYNVSVKLLEKITSKQIVMK
FT                   LIKDGHHNLSREEDLKVMTNSLEEVIRLLSKIK"
FT   gene            460820..461992
FT                   /gene="capM1"
FT                   /locus_tag="RC0465"
FT   CDS_pept        460820..461992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capM1"
FT                   /locus_tag="RC0465"
FT                   /product="capM protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03003"
FT                   /db_xref="GOA:Q92IF5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF5"
FT                   /protein_id="AAL03003.1"
FT                   /translation="MPSLKSSKRYNKYTILQVVPALVSGGVERGTIEVAKYLKILGHTP
FT                   IIISAGGTLVKELDKEDILHIEMNSNSKNPFVILNNAKLIAEIIKKYNVDIVHTRSRAP
FT                   AWSSYLATKWTNAKFLTTFHGVYNIPNSFKKYYNSIMLKGKKVVAVSNFVKQHLLENYK
FT                   IDEDKIVVIERGVNCDYFDPANLTPEKLEKCCDKYDVPSNVPIILMPSRMTSWKGHLVL
FT                   VEALSKLKHRDFYCLMVGDISRHPNFTNRVKELIANLKLQNKIQIFGNDSDIINLYGIS
FT                   DIIISASIEPEAFGRTIIEGQAMKKLVIATNIGGAVETINNNITGFHVEPNNAEALAQQ
FT                   IDYCFSILGTDLAKKIQEAARHTVINNFSLDLMLRKNLEIYKEILKNSHN"
FT   gene            complement(462478..462681)
FT                   /locus_tag="RC0466"
FT   CDS_pept        complement(462478..462681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0466"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03004"
FT                   /db_xref="GOA:Q92IF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF4"
FT                   /protein_id="AAL03004.1"
FT                   /translation="MSFEKLVFKLGADDLLPASSGKGNTTFLKSLVNCIADPYHSVGEI
FT                   SIPTHYQNPKIIFIDQNSYIPV"
FT   gene            complement(462930..463103)
FT                   /locus_tag="RC0467"
FT   CDS_pept        complement(462930..463103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0467"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03005"
FT                   /db_xref="GOA:Q92IF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF3"
FT                   /protein_id="AAL03005.1"
FT                   /translation="MLTDSAQFVQNQYAKQLKAKKEISKKMLFLDSTKNTITTILDISD
FT                   KFIKSLYYIFIK"
FT   repeat_region   complement(464194..464230)
FT                   /note="REP03, repeated element"
FT   repeat_region   464311..464363
FT                   /note="REP01, repeated element"
FT   gene            complement(464512..465129)
FT                   /gene="rpsD"
FT                   /locus_tag="RC0468"
FT   CDS_pept        complement(464512..465129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="RC0468"
FT                   /product="30S ribosomal protein S4"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03006"
FT                   /db_xref="GOA:Q92IF2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IF2"
FT                   /protein_id="AAL03006.1"
FT                   /translation="MTKIVRSKYKASRRLGVSLWGDSKDAFNTRNYRPGQHGQNTMIKT
FT                   SDYGLHLKAKQRLKCHYGRVTEKQFRNIFALAQKMKGNTGENFIGLLESRLDTVVYRMN
FT                   IAPTIFAARQLVSHGHIKLNGKKADIASIRLKAGDVIEVKESVKQIPLIQESVSKQGQT
FT                   TPGYLSFDVPSLTGKYLRVPALSDVPYPFEAEVHLVIELYSR"
FT   gene            465254..466171
FT                   /gene="ctaB"
FT                   /locus_tag="RC0469"
FT   CDS_pept        465254..466171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="RC0469"
FT                   /product="cytochrome c oxidase assembly factor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03007"
FT                   /db_xref="GOA:Q92IF1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IF1"
FT                   /protein_id="AAL03007.1"
FT                   /translation="MSSLVRPINLGKINHSQSTVKDYILLMKPRVMSLVIFTGFVGMWL
FT                   APYSVHPFIAGIAVVCIALGAGSAGAINMWYDRDIDSLMKRTQKRPIVRGVIESDEALS
FT                   FGLITGFFAVFFMALCVNLLASFLLLFTIFYYICIYTIWLKRRSIQNIVIGGVSGALPP
FT                   VIGYAAVSNTISLESIILFLIIFIWTPPHSWALALFCNDDYKNCKVPMMPAVKGTLYTK
FT                   KQILIYSILLFIVSLMPFFIGMNNFIYLIISGILGVVFLYYAGSLFYDTPDNKQAKRFF
FT                   AYSIFYLFFIFLLLYSTNTISTIS"
FT   gene            complement(466453..467016)
FT                   /locus_tag="RC0470"
FT   CDS_pept        complement(466453..467016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0470"
FT                   /product="spore photoproduct lyase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03008"
FT                   /db_xref="GOA:Q92IF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IF0"
FT                   /protein_id="AAL03008.1"
FT                   /translation="MDKYIANLPTKISNQTDSKYWTYDIGCSTDVSLHWKHTNWLKIFK
FT                   FFKEDPRAKATFATKYVNPKLLNFNPENKIRIRFSLIPTRMREILEPKTSSIIERIKAV
FT                   NIFIEAGYEIHLNFAPIIAYEGWLTEYAKLFEDLAQYINNQYKPFIKAECIFLTHNDKQ
FT                   HERNIASNRLESEALIWQPNYTGK"
FT   gene            467681..467929
FT                   /locus_tag="RC0471"
FT   CDS_pept        467681..467929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0471"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03009"
FT                   /db_xref="GOA:Q92IE9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE9"
FT                   /protein_id="AAL03009.1"
FT                   /translation="MEKQQDNAIKSLKKAIELDPSKAYYHEEFFNKLHKINPEEALASI
FT                   KRAIGLNPNKKSLYEDLIILLKKANYDEEAAKITKVI"
FT   gene            complement(468181..470700)
FT                   /gene="asmA"
FT                   /locus_tag="RC0472"
FT   CDS_pept        complement(468181..470700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asmA"
FT                   /locus_tag="RC0472"
FT                   /product="outer membrane assembly protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03010"
FT                   /db_xref="GOA:Q92IE8"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE8"
FT                   /protein_id="AAL03010.1"
FT                   /translation="MYINRRLSSMPKTLKYSLIIFISIILLLIVIPFFIPLNNYKGIVI
FT                   DKVKEATNRDLTINGDIKLSLLPNPAISLSEIKLSSINGTKEPHLVSVEGAKASLRLFP
FT                   LFRGAIEVASIELQKPIINLEVLSNGQKNWQFSTPNNASKTNELSSVESTDTKTELALP
FT                   ILISHFKIIDGKVIYIEKNSEKIFNDINLETKIKSLKGPIDLTLALKALEQQINIDGNI
FT                   EEIGKIIPLSANINLAGEKIKIEGKFDSANNSFIGNANIKGNTKTLGMPADLQNDYELT
FT                   TAITADSKNIAIKDARLNYPNIELLANANYDIERNNLKSNIIINPGNIITEISSNLDKT
FT                   NIMLQADSLKPILDALKLKTDKLPPIINQKLILTSNVISNSQAIKLQNINLSAANSNLT
FT                   GDIELKNLAQDITISHNLKINNFESFMSLMGVSNLSQIGVLQLNGGVQKIKDTFHINNK
FT                   ISAFNTNISIKGDINLETQKPNFNLNLYSPLVNLDKILTSNSPTPAPNKTNSPATQNIP
FT                   TAKNNSPWSNNPINLGFLNEIEGQLSANIDKLTNDSLIINNLKAKLNITGGTLNITSVN
FT                   ASIYGGELSSTGYVSSAKDQNAAIKIDLKNAYLKSFTPQSDKIKITDGRLSFKADLTSR
FT                   GNSVYTYVNNLNGQFNVNSDNGEISGFDLNRIADAVNNAKNTEGVLRLINSSFSGGSTS
FT                   FKNLIARGNITQGKLNLNECSLDASPATTNASGQINLPQYMMDVSASVTIADLPPIAVK
FT                   LYGFINNPQHKLDVQAFQTYLVKNVFNSVIKDLKSGEKKPENIIKDALGLRKKKDTNTE
FT                   EQNSPPQENQQADPVNKLLQKGLKKLF"
FT   repeat_region   complement(470829..470852)
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(470868..470919)
FT                   /note="REP03, repeated element"
FT   gene            complement(470986..471483)
FT                   /gene="rimM"
FT                   /locus_tag="RC0473"
FT   CDS_pept        complement(470986..471483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="RC0473"
FT                   /product="16S rRNA processing protein RimM"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03011"
FT                   /db_xref="GOA:Q92IE7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IE7"
FT                   /protein_id="AAL03011.1"
FT                   /translation="MNSLENLILVGVIKSCHGIKGHVMLKSFTDPATKILERNLVNESG
FT                   ANIHIKLISQNAKGELICTFNDIATRNEAENLKGYKIFCLRASLPELEEDEFYIADLTH
FT                   LPVLNQDHKEIGKIKNILNFGAGDIIEIEFSNQTTELLPFNKEFFPIITKDYVILNYQR
FT                   EA"
FT   gene            471501..474176
FT                   /locus_tag="RC0474"
FT   CDS_pept        471501..474176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0474"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03012"
FT                   /db_xref="GOA:Q92IE6"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE6"
FT                   /protein_id="AAL03012.1"
FT                   /translation="MIVIYNNIFKNFFTDMIKKIAAGVIICFSLLLFIMFGALSFVNYN
FT                   SVTNNFTSHLGIAKENIGKIKMNKFPLSYLVIETIREEGKLDLEQIKIHFSLWSLIKFN
FT                   PKINKIDILDAKFYSHSNVLNIYNHEELIKNFFKYKLQNINLNVTNLSIINKQDYSILN
FT                   FNNCILKKENALSSNYIFKTTSNYIGKISGSINKRDDIVDFSLNIDNNDYGFKLSQIYK
FT                   DSKLTSGSGEYQIKNLASVMYNILPDLNHLFNKFNQHEAVNVKFNISNNEDAIELKDIV
FT                   IASSFIIGHGFVNIAKNDNITTNVKLDFPKIDLSSLISPNAEVTFNTSSSNSRFIFANK
FT                   LLKADVAINEIILSNNEELKKIVFSSNLLKGTLKINEFSGNIKSGGEFKLTGNVTQNAV
FT                   RSMFDGQLYLKHNDINSLLNILGFNDVTIKEAIPFSLSSDLKLTLIDLFFKNLLLKTDN
FT                   LNLSGNFSSKFIAQTPRLDATLNISSLDLSSRTYPIISPLIEFTKNLTKDMKALDYPSK
FT                   FIPIRTIGYLANLDILIDSVKYNDHVFDKMNLLAKIVPANIKISNLDFKTANSYLSTSW
FT                   NLDASSVLPSLTVEIKDGNLTTDLLSPAGMLNLRNKLINDYSLDKATLQVSGTLSTLLQ
FT                   NDLILKNVKFYVANNNNLLQFNNIEAELLGGKFQGNGNILLEPYAINFVYALNTIDLNK
FT                   VSALMPKIFTASGGKISISGSLGTNGNTLQSQLYNLTTKSQFAINNIDVNNFAIDAFIE
FT                   KIDTADYKVQNLDKDINSAITTGQENIRGISGDIELQKGIALLKKVKFATQYSSGAASV
FT                   AVNIYNFDMDASSILSFYVPARLVKLNTSNTSSDKDSLAHLNIKMQGSIFAPKKTFDSS
FT                   ELKKLLIPQTTEDTITTDNH"
FT   gene            474190..474432
FT                   /gene="xseB"
FT                   /locus_tag="RC0475"
FT   CDS_pept        474190..474432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="RC0475"
FT                   /product="exodeoxyribonuclease small subunit"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03013"
FT                   /db_xref="GOA:Q92IE5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IE5"
FT                   /protein_id="AAL03013.1"
FT                   /translation="MTNTKTLEANISFEEALKELEEIVKKIDNGQESLETAVNSFERGI
FT                   LLKNHCEKKLKEARLKIEKITKLADSTVVLEEMEV"
FT   gene            474470..474772
FT                   /locus_tag="RC0476"
FT   CDS_pept        474470..474772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0476"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03014"
FT                   /db_xref="GOA:Q92IE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE4"
FT                   /protein_id="AAL03014.1"
FT                   /translation="MTKKCNYSFSAEKNYKLISERKVSFEEIISVIESNCLLDIIEHPN
FT                   PNKYSEQKMYIVKFNEYAYLVPFISEVDRAVFLKTIIPRHKATQKYLKIGKSNEK"
FT   gene            474762..475046
FT                   /locus_tag="RC0477"
FT   CDS_pept        474762..475046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0477"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03015"
FT                   /db_xref="GOA:Q92IE3"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE3"
FT                   /protein_id="AAL03015.1"
FT                   /translation="MRNKENISNIILDAEENALLESFENDEWQRIKNFEQEKHISQVAA
FT                   ANYLKKDTRINIRISSSDLMRIKQKAAYEGLPYQTLISSILHKYSAGHG"
FT   gene            475125..475535
FT                   /locus_tag="RC0478"
FT   CDS_pept        475125..475535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0478"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03016"
FT                   /db_xref="GOA:Q92IE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE2"
FT                   /protein_id="AAL03016.1"
FT                   /translation="MMSFCAGYLYLTKYIIPNNFQKEELGSLGRFLSGVVGSMYAVSTG
FT                   LVLIYLLGNFNKAQEGVAAESIVLMRLADSVGWRPHEMRPTIYLDIKNYTKGVMRCEWQ
FT                   LMKDGKQIGHEAFSFLQDINKRLQAYKASEQM"
FT   gene            475539..475853
FT                   /locus_tag="RC0479"
FT   CDS_pept        475539..475853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0479"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03017"
FT                   /db_xref="GOA:Q92IE1"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IE1"
FT                   /protein_id="AAL03017.1"
FT                   /translation="MTKQEIIEEIKELYTVRYNRIKMSYFSLNIQYWIVVCIMTAINLI
FT                   FVCMFGTKLYLHKISVGLVCITSSSMLLLLFILDKPFRGPFAVNQYDLIKAVHYIERLN
FT                   "
FT   gene            complement(475819..476370)
FT                   /gene="mpg"
FT                   /locus_tag="RC0480"
FT   CDS_pept        complement(475819..476370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="RC0480"
FT                   /product="DNA-3-methyladenine glycosidase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03018"
FT                   /db_xref="GOA:Q92IE0"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IE0"
FT                   /protein_id="AAL03018.1"
FT                   /translation="MNKLIPVPREFFARDTNVVSTELIGKALYFQGKTAIITETESYIG
FT                   QNDPACHAARGRTKRTDIMFGPAGFSYVYLIYGMYYCLNFVTEAKGFPAATLIRGVHVI
FT                   LPENLYLNGPGKLCKYLGINISHNKCDLINNNEFFVGDIGLKLPYSTTARIGITKGTDK
FT                   LWRYVVTDITNLISQYNVQP"
FT   gene            complement(476884..477387)
FT                   /gene="nuoE"
FT                   /locus_tag="RC0481"
FT   CDS_pept        complement(476884..477387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="RC0481"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03019"
FT                   /db_xref="GOA:Q92ID9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID9"
FT                   /protein_id="AAL03019.1"
FT                   /translation="MNTKITNFTFDKKNLNLAEEIIKKYPPHGKRSAILPLLDLAQRQN
FT                   GGWLPVPAIEYVANMLAMPYIRAYEVATFYTMFNLKRVGKYHIQVCTTTPCWLRGSDDI
FT                   MKICEKKLGVKLKETTEDQKFTLSEIECLGACVNAPVVQINDDYYEDLTQDKMGKIIDK
FT                   LQND"
FT   repeat_region   477742..477773
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(477812..479080)
FT                   /gene="nuoD"
FT                   /locus_tag="RC0482"
FT   CDS_pept        complement(477812..479080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="RC0482"
FT                   /product="NADH dehydrogenase I chain D"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03020"
FT                   /db_xref="GOA:Q92ID8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID8"
FT                   /protein_id="AAL03020.1"
FT                   /translation="MSSCDLIAGSRKNTKDWTPWSSELGDSRKNTMTNNTKTITLNIGP
FT                   QHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPM
FT                   CQEHAFALAVESLLECEVPRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLF
FT                   EEREKIMEFYEHVSGSRMHSNYFRPGGVAADLPEGLLEDIDKFIEQFPPKLHDIESLLN
FT                   ENRLWKQRLVDIGVASQKEAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEMDFKVPIGK
FT                   NGDCYDRYFVRMLEMYESIKIIKQCIEKMPKGAIKTDDPKLTPPTRAKMKESMEAMIHH
FT                   FKLYTEGYDVPAGETYKAVEAPKGEFGVYLYSQGGNRPYRCRIKAPGFAHLQGLDFMSK
FT                   GHLMADVITIIATLDIVFGEIDR"
FT   repeat_region   complement(479049..479079)
FT                   /note="REP03, repeated element"
FT   gene            complement(479086..479814)
FT                   /gene="nuoC"
FT                   /locus_tag="RC0483"
FT   CDS_pept        complement(479086..479814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="RC0483"
FT                   /product="NADH dehydrogenase I chain C"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03021"
FT                   /db_xref="GOA:Q92ID7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID7"
FT                   /protein_id="AAL03021.1"
FT                   /translation="MTLDKLIEKLAAKSSILITPITVKDYLAYKIEPNFLLPFLKALKE
FT                   SEELRFTLLTDLFGADFPQNNVVNSVGLGHKEQGAKPITNRRTTSDNVGESKSIDYKRF
FT                   EVVYNLLSLKLNKRLIIKVYISEKETIPSAMNIFSAACWYEREVYDMYGVNFEGNDDKR
FT                   RILTDYEFEGHPLRKDFPLTGYTQVKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSY
FT                   VLPGDEKATDVIPAKAGIQK"
FT   repeat_region   479092..479120
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(479512..479616)
FT                   /note="REP09, Rickettsia palindromic element 2"
FT   gene            complement(479792..480316)
FT                   /gene="nuoB"
FT                   /locus_tag="RC0484"
FT   CDS_pept        complement(479792..480316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="RC0484"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03022"
FT                   /db_xref="GOA:Q92ID6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID6"
FT                   /protein_id="AAL03022.1"
FT                   /translation="MKNNFYQEDELLSNELSNRGFLLTKVDDVIGWARANSLWPMTFGL
FT                   ACCAVEMMQAAASRYDMDRFGMLFRPSPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPK
FT                   WVLSMGSCANGGGYYHFSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGLMQLQKKIKRT
FT                   TGFKYDARQTH"
FT   gene            complement(480321..480719)
FT                   /gene="nuoA"
FT                   /locus_tag="RC0485"
FT   CDS_pept        complement(480321..480719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="RC0485"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03023"
FT                   /db_xref="GOA:Q92ID5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID5"
FT                   /protein_id="AAL03023.1"
FT                   /translation="MTEQYNKKHMLQNSELLQEYLPIAIFFGIAVLVSGLIMILPNLLS
FT                   TKKYNKDKLEPYECGFEPFSDARSKFDICFYLVAILFIIFDLEIAFLVPWAISLNTIGK
FT                   IGFFSMMFFLFVLIIGFIYEWKKGALDW"
FT   repeat_region   complement(480716..480756)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(480763..480806)
FT                   /note="REP01, repeated element"
FT   gene            complement(480850..482085)
FT                   /locus_tag="RC0486"
FT   CDS_pept        complement(480850..482085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0486"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03024"
FT                   /db_xref="GOA:Q92ID4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92ID4"
FT                   /protein_id="AAL03024.1"
FT                   /translation="MQYLISSLIFLIPSLGMLAGLSAAATVTIFLLISFLRGINRHCER
FT                   LQGVWQSSNNVIPWLDHGIQKIQKDWIPLQAHGITMLFTAWCFISCLFAIHLINSLATF
FT                   TQVFILLFLGFAVSNSAPFQNRLQLKKALIFGILTAILLFFIEYSSNGFLTRIFKTSFA
FT                   LYMLDRGCALLSITAWVAIIILLSNGKKRHTLMLYILVLYLLSISDSLASFLGFGIGGV
FT                   IFILTRFMKPIFFKLIAISLITGSLLFPVIAKQIEPQDLSEKYLATQPSAAHRLFIWHF
FT                   VANKIIEKPILGYGLASSKYIKAGDSEMIDYNGEKWHPLPLHPHNNILQITLELGIIGL
FT                   ILFLCLVYKYLKQISNLENKNFKAISYACFINYYIIGMISYNIWQIWWISSGIWVLVLM
FT                   KLLVKPDIVIDN"
FT   repeat_region   481887..481922
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(481928..481966)
FT                   /note="REP01, repeated element"
FT   gene            complement(482086..482559)
FT                   /locus_tag="RC0487"
FT   CDS_pept        complement(482086..482559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0487"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03025"
FT                   /db_xref="GOA:Q92ID3"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ID3"
FT                   /protein_id="AAL03025.1"
FT                   /translation="MKLLKIIFIITICINFPIFAENLESVTTTEDIENDVFIPLDENHP
FT                   ILNPNDNINDSSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNL
FT                   DPYNEDNYLLMTITEYKIDEDPNVLFQGWMISSSISLSTFEHPIYEIFAKDCF"
FT   repeat_region   482636..482670
FT                   /note="REP01, repeated element"
FT   repeat_region   482686..482727
FT                   /note="REP01, repeated element"
FT   gene            482741..483292
FT                   /locus_tag="RC0488"
FT   CDS_pept        482741..483292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0488"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03026"
FT                   /db_xref="GOA:Q92ID2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ID2"
FT                   /protein_id="AAL03026.1"
FT                   /translation="MLHSKELLNSILRQDFHSFIIKVFNTINPGAEYYPSKHIRIITDY
FT                   LNAVQSGDINRLIINIPPRSLLQSICVSVAWPAYLLVVNPTKRIMVASYSQILSIKHSL
FT                   DCQFILNSDWYTELFPSTILSKPHNQKSKFLTTANGFRFATLVGGSATGEGGDILIIDD
FT                   PHNPTQIHSYKIRKKVYRLV"
FT   gene            483225..483530
FT                   /locus_tag="RC0489"
FT   CDS_pept        483225..483530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0489"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03027"
FT                   /db_xref="GOA:Q92ID1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ID1"
FT                   /protein_id="AAL03027.1"
FT                   /translation="MILITPRKFILIKYVRKFIDWFEQTFVSRLNNRNKGAIVLVMQRL
FT                   HTDDLSGYLLNNSNSWHHLKILAISIQDYSFKLMNKEYQYLSGQVIRQLLKNLLIV"
FT   gene            483530..484084
FT                   /locus_tag="RC0490"
FT   CDS_pept        483530..484084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0490"
FT                   /product="phage-related protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03028"
FT                   /db_xref="GOA:Q92ID0"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92ID0"
FT                   /protein_id="AAL03028.1"
FT                   /translation="MKLEQEIGSYNDNAQYLQEPIAQRSSLLNMEDIRFYENLSSRFDY
FT                   CVQSWDTAIKSSEDSDYSVCNIWGIQKYYLVSLVRKKINYPELKNLTEKLAREYQPKFV
FT                   LIEDKASGQQLIQDIGFLGGNIRVIGIKPSFDKVTRFASVVPLFQSASVLIPKQSSIIL
FT                   KELLNFPHIKNDDIVDSVSSS"
FT   repeat_region   complement(484178..484211)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   484229..484256
FT                   /note="REP02, RS3-like repeat"
FT   gene            484281..484352
FT                   /locus_tag="RCRNA11"
FT   tRNA            484281..484352
FT                   /locus_tag="RCRNA11"
FT                   /product="tRNA-Cys"
FT   gene            484377..485297
FT                   /gene="xerD"
FT                   /locus_tag="RC0491"
FT   CDS_pept        484377..485297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="RC0491"
FT                   /product="integrase/recombinase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03029"
FT                   /db_xref="GOA:Q92IC9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IC9"
FT                   /protein_id="AAL03029.1"
FT                   /translation="MGFIAQFLEMLLAERALSKNSILSYKRDLFDFQNYLAKHKLSELN
FT                   ITTENIRDWIEYLASNDLQARSINRKISTIKSYYEFLISENHTAFNPVLNVDLPKYQNK
FT                   LPEILSIAQIKSLLEHCSQDNSPEGIRLNAMIHLLYASGLRVSELVSLKLADILTNKTS
FT                   KGEVRKIFSVLGKGNKERVIVINEQAVISIAKYLTIRGVFVNKAKPRNLIYLFPSSALA
FT                   GYMTRQNFAILLKSAALYAGLNPEYISPHILRHSFASHLLEGGADLRVIQELLGHADIS
FT                   TTQIYTHLQTNHLKKALLRHPLNKN"
FT   gene            485381..486415
FT                   /locus_tag="RC0492"
FT   CDS_pept        485381..486415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0492"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03030"
FT                   /db_xref="GOA:Q92IC8"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC8"
FT                   /protein_id="AAL03030.1"
FT                   /translation="MKLKDIMSSCISKPREIEKEYPGLAQKQESGCNVYAGLGCKNQEV
FT                   QFRNYYELLKKIQQGEITLEVLENLRKLKIDDKKSFLADAAEVISNNMLHELNATIMKH
FT                   ALDLVDSKDAAFLLRRTKEDSIFRDLIYLEAKENRFTVEIDKKGTLKINFPSGILELYK
FT                   LLIDNFYLKKFEEEALQKKLYQELLPDCKIPFEELIEKKELQKKLYQELLPELLPDCKI
FT                   PFEELNFCEHFIECLKGFYIKNSLARSIMSLFVSRDVKEHAVCEELLELDTFKKLFEAK
FT                   MSLYGTSADSKLLVVDYVLNDVQGVYISNLASSNIFLDLVMHSQSHNETIESIEILGNS
FT                   SEPV"
FT   gene            486509..487690
FT                   /locus_tag="RC0493"
FT   CDS_pept        486509..487690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0493"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03031"
FT                   /db_xref="GOA:Q92IC7"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC7"
FT                   /protein_id="AAL03031.1"
FT                   /translation="MRLILNMATKNKKETVNTETKNLANLVIQEIGNKNFDFVVLQKMQ
FT                   QAFSIASKQKQREAFISLLDKKLNKEQLHKLNQAIMENANELMPDNDPNFVCRTPNNKV
FT                   FQEILLLEAKRSGMKAKFNDKGELQSLDVKDITQEILDHYRILQENFYSKRDSKDLIDS
FT                   RIAQSINFLLYAPLFRESDIYTKLGLKSAEIEREIQDPNGKYAKQLVDAKIGTNINFNT
FT                   KENLENKAHEGKETKISLIIEKAITKLKKDKKVNIEDKRQGEIKRHLSKSLEGASDYIL
FT                   TLKKNDLVDVIYQGLDKGQTWWSKIVNYIGIKSYSISKENLEKIGTIINREMKNSHTPL
FT                   KIELQEQLKQISKELNRFNNLALPLEAKKVQAKSKKPPVPPKPEHLKKRNHGL"
FT   repeat_region   487742..487823
FT                   /note="REP03, repeated element"
FT   gene            complement(487888..488670)
FT                   /gene="fabI"
FT                   /locus_tag="RC0494"
FT   CDS_pept        complement(487888..488670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="RC0494"
FT                   /product="putative enoyl-[acyl carrier protein] reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03032"
FT                   /db_xref="GOA:Q92IC6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IC6"
FT                   /protein_id="AAL03032.1"
FT                   /translation="MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGV
FT                   LEKRVKPLAKEIGCNFVSELDVTKPKSISNLFDDIKEKWGSFDFLLHGMAFADKNELKG
FT                   RYVDTSLENFHNSLHISCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVMGVA
FT                   KAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTT
FT                   QEDVGGAAVYLFSELSKGVTGEIHYVDCGYNIMGSTKL"
FT   gene            488746..490245
FT                   /gene="lnt"
FT                   /locus_tag="RC0495"
FT   CDS_pept        488746..490245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="RC0495"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03033"
FT                   /db_xref="GOA:Q92IC5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IC5"
FT                   /protein_id="AAL03033.1"
FT                   /translation="MYKPKIICLLLGILSGLVFAPTFFIPALLTLSYLCYIVQKSENWQ
FT                   EATKFGYLFGFGHFLSGIYWISIGVSVYIADFWWAIPFALFGLPIVLACFISASCTLSF
FT                   FAKNNKYYQFIFCLCWVLFEWVRSWIFTGLPWNLIGYAFSFSDILIQPLSIIGIYGLSF
FT                   IVIYISTSAYPLFSKQFTQLKILLASSVLVLTIIVIYGAVRLSNNHTNFTDIKVRLVQP
FT                   SIPQTEKWNEEEFWHNLMLHINLSENLEPTDLIIWSEAALVVPDDIPQVKSKLLKMLNS
FT                   TNAILITGGISDNKKQGDEFELYSAMYALDKNNHKLFEYHKSHLVPFGEYMPLKKILPF
FT                   KKLTHGLIDYKEGNGGLVYLEKYNLKIKPLICYESIFPDFVRTNNEIADVIINITNDAW
FT                   YGKSSGPYQHFHISRSRAVENGLPMIRVANNGISAIVDPFGRTIKKLNLNEINGTQGLI
FT                   PKKLISPTIFSQFGNFTILLLIVFILLINYLLALILDHQRV"
FT   gene            490365..490850
FT                   /locus_tag="RC0496"
FT   CDS_pept        490365..490850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0496"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03034"
FT                   /db_xref="GOA:Q92IC4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC4"
FT                   /protein_id="AAL03034.1"
FT                   /translation="MNYSIKHPDKLASERLKERRLAVGRYYPKRIRASFFDISALQVKK
FT                   YEEGLSNIPISRLYVFAKVLNTPLKYFFNSSEEEKLKADNENTPNNKIEYLFKEIESDF
FT                   LNNIAEAEGQYEHEVSFDYKELSRTMERALLSLTRAFTTNIRKIIIEHVRSVSIPCE"
FT   gene            490954..491757
FT                   /locus_tag="RC0497"
FT   CDS_pept        490954..491757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0497"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03035"
FT                   /db_xref="GOA:Q92IC3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IC3"
FT                   /protein_id="AAL03035.1"
FT                   /translation="MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDI
FT                   KAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLI
FT                   NDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPW
FT                   KELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQ
FT                   AVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA"
FT   repeat_region   491879..491974
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(492178..492345)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            492563..493480
FT                   /locus_tag="RC0498"
FT   CDS_pept        492563..493480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0498"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03036"
FT                   /db_xref="GOA:Q92IC2"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC2"
FT                   /protein_id="AAL03036.1"
FT                   /translation="MFISNIFQKFFSFLFVLFITAAVYADQKKVAVIVPLEHAAMTEII
FT                   SGIKESLKDIDAEIIVKNAHADSNILLAIIKQITDQDIDVIIPIGTTASQTVISHITNK
FT                   PIVCAAAMINSKNLPLVTGVNDEIKITDTISKLHFLQNITLIYSSSEKVIPEVEMLKLY
FT                   AGKNNISLHTVMIQNFNDMPVAVKNAPENTQSFIILKDHLIVSGINILKQEAFKRRIPI
FT                   IASDEGSVISGATIAVGVQEKQIGIEAGLMAKKILQGIEPKDIPFGDMKDLTLFINLKS
FT                   FVKQDILTKENLSVLPFARKELEE"
FT   gene            493407..494324
FT                   /locus_tag="RC0499"
FT   CDS_pept        493407..494324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0499"
FT                   /product="ABC transporter permease protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03037"
FT                   /db_xref="GOA:Q92IC1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC1"
FT                   /protein_id="AAL03037.1"
FT                   /translation="MLSKIFLLKKIYPYCLSRVKNLKSSNMNILVTALEQSLIMLPLIL
FT                   GMYISYRILKITDLTVDGTYVLGAVVFARSLSFGLFPALIFAVIAGGIIGSIVSVMQKN
FT                   NRINGLIAGILASFMLYSVNLQIMQRPNISVLGMPTLLSILDLENWLIPLVIINCLIIC
FT                   SVIILLKGKLGLFLRAFGFNKDLLINLGKPAELYRTIGFSISNCLAALTGTLSAQVNGF
FT                   ADINMGFGVALVGIGAIVIGRHILIHANNFNAFKEILSCLIGILFYFIALGFLLRIGID
FT                   PINLKLILGIVLFISLSSVKREAL"
FT   gene            494321..495043
FT                   /locus_tag="RC0500"
FT   CDS_pept        494321..495043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0500"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03038"
FT                   /db_xref="GOA:Q92IC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IC0"
FT                   /protein_id="AAL03038.1"
FT                   /translation="MKPYLYAENIQFKVKERTEPIIAETTLNIAKEEFVVILGHNGSGK
FT                   STLAKILAGYLKPTSGKVFLDQVRIDKIPKGQKASTLVTLTQKAEERLFTELTLEENII
FT                   LWESRFSSNERLASSELLELTGAPKRFLPLLSQPLGKFSGGEKQMILLALIIAHPPKIL
FT                   FLDEHTANLDPKASLEVMKKTAEIIEKHKITSVMITHNLEDAVNYGKRLIVLDSGKVVL
FT                   DYLKPPGFSLKELKEILN"
FT   gene            complement(495123..495539)
FT                   /locus_tag="RC0501"
FT   CDS_pept        complement(495123..495539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0501"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03039"
FT                   /db_xref="GOA:Q92IB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB9"
FT                   /protein_id="AAL03039.1"
FT                   /translation="MGAKSANNYKDMDVNDYNYDLPDEEGFAKNTHEKLLKDVMQRLKN
FT                   GEDKDGIINTLIEISINEDTRTELIEKVLNYNVNDNKPVAAPALVTPVATVVPAPSTST
FT                   EEKLSAEVKTRLTIGKIRMILLISCFFIRLLTRM"
FT   gene            complement(495771..495983)
FT                   /locus_tag="RC0502"
FT   CDS_pept        complement(495771..495983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0502"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03040"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IB8"
FT                   /protein_id="AAL03040.1"
FT                   /translation="MDVNTKDGKGRIPIHYATYSKQHEITQILILLQPGSEIDTVDNYG
FT                   GTPFFYLLLKHESGQNKTLLDFFLR"
FT   gene            complement(496351..496503)
FT                   /locus_tag="RC0503"
FT   CDS_pept        complement(496351..496503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0503"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03041"
FT                   /db_xref="GOA:Q92IB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB7"
FT                   /protein_id="AAL03041.1"
FT                   /translation="MKKNIKNEDDKNKIINGLIMNSEFYSDIDDVTREKLIEKLFNYNL
FT                   TIIIQ"
FT   gene            complement(496854..497447)
FT                   /locus_tag="RC0504"
FT   CDS_pept        complement(496854..497447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0504"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03042"
FT                   /db_xref="GOA:Q92IB6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB6"
FT                   /protein_id="AAL03042.1"
FT                   /translation="MAIPSNFPRLPRSLQSLAMTLRKKNMPFNTIINYIRKDSYKVLHL
FT                   GLITISIIALSTAYIAEYIFHYTPCPLCVYERFPYLTLIKICLTALIIRQLSKYTLIFI
FT                   LLTILSSCILSTYHSFIERGILQPSALCSSMLHIPKGLSIQHIKQMFYSQPITSCMKPA
FT                   IKIFGISMTEYNLLLNIGLLICLLLVWFYPKSNK"
FT   repeat_region   497390..497424
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(497438..497471)
FT                   /note="REP01, repeated element"
FT   gene            497535..499118
FT                   /gene="lysS"
FT                   /locus_tag="RC0505"
FT   CDS_pept        497535..499118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="RC0505"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03043"
FT                   /db_xref="GOA:Q92IB5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IB5"
FT                   /protein_id="AAL03043.1"
FT                   /translation="MQEKSMSEIWEDAIKSNAWPFVEAKKILDSLNGQIPEKGYVLFET
FT                   GYGPSGLPHIGTFGENARMVMVQKAFEQLSDIPTKLICFSDDMDGLRKVPSNIPNPEMV
FT                   AQYMDMPLTSIPDTFGECESYGHYMNAKLRSFLDKFGFEYEFYSSTNCYKAGMFDAMLI
FT                   MVLEKYDEIMELMLPTFREERKATYSPFMPICPKTGKVLQVPIEKWDAKAGTVTYKDKA
FT                   GNYIEVPVTGGHCKLQWKPDFGMRWAALKVDYEMYGKDHLANARLYSEICRILGGKPPV
FT                   QLCYELFLDENGKKISKSKGNSISIDDWLKYAPVESMALFMYQNPTRAKRLFFDVIPKN
FT                   VDEYITFNQKYHLEEDRAKRFANPVYHIHHGNVPKIETFGITYSLLLNLTSVCNPSDKS
FT                   VLWGFISKYEPKATPNTNPYLDHLAEFAIRYYNDFIKAHKLYLSPSEKHKVILQDILDM
FT                   LSDIADQTEAEAIQKAIYDIGMKAGYENLRDYFKDLYQILLGQNEGPRFGTFIKLYGVQ
FT                   EMKKLVEGQL"
FT   repeat_region   complement(499198..499229)
FT                   /note="REP01, repeated element"
FT   gene            499252..500184
FT                   /locus_tag="RC0506"
FT   CDS_pept        499252..500184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0506"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03044"
FT                   /db_xref="GOA:Q92IB4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB4"
FT                   /protein_id="AAL03044.1"
FT                   /translation="MNEIFCSTLPIFLITLLGSIIKNKWLTSEEFWRGIEKLSYFVLFP
FT                   AMLFSYVSTADLSIAPIIKLVVALIISTILVSIGLIIYQKKYNIDKVQFTSIFQGSIRY
FT                   NSYIFFGVSSPLLGSSGLSIVAIISSYMIIFTNILSVMIFAYYIPNKSVTNTISTSFVL
FT                   MMKLIVRNPLIIASLVGFVFNYSNLELHLGLKKTLDSLSNAALAIGMLNVGAGLNFTIR
FT                   QELLHNVMFTSFVKLVAFPLVSVVVLWLMSIDGLDRSVGILYSCLPCASTAYVLSRQLD
FT                   GDPDSMASIITFTTFFSVVTISIIMYIMG"
FT   repeat_region   500195..500233
FT                   /note="REP01, repeated element"
FT   gene            500323..502626
FT                   /gene="tme"
FT                   /locus_tag="RC0507"
FT   CDS_pept        500323..502626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RC0507"
FT                   /product="malate oxidoreductase and phosphate
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RC0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03045"
FT                   /db_xref="GOA:Q92IB3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB3"
FT                   /protein_id="AAL03045.1"
FT                   /translation="MDEMNKINYAEALEYHEKDKPGKIAISATKSLVTQQDLSLAYSPG
FT                   VAAPCLEIAKNLEDVYKYTARGNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEVNTEDPEEFINAVKYLSYSFGGINLEDIKAPECFIIEEKLKSLMDIPVFH
FT                   DDQHGTAIITAAGLINAAYLTNRKLEDLKIVVNGAGAAAIACIDLLIALGADKSKIIVC
FT                   DTKGVVYKGRLEGMNKWKELYASDTKFRTLAESLNNADVFIGLSVKGAVTKDMVSRMAS
FT                   NPIIFAMANPDPEITPEDIQLVRDDAIIATGRSDYNNQINNVMGFPYIFRGALDIRAKT
FT                   INTEMKIAAAKAIADLARRPVPEEVYKAYSGRKMVFGKEYIIPVPFDPRLITVVAAAVA
FT                   VAAIESGVARVKDFSIGKYKKELGSRLNPTANYMNFLAEKIHNAPLKRIVFAEGEEEEV
FT                   ISAALMMRDKKYGHPIIIGRVERIEVMLKKIGQDISLDGIQIMNAALSDSLEKYTDYLY
FT                   KRLQRKGYLYRDCAKLVKTDKNIFAACMLACGDGDALLTGVTQSYIDSLEDIMKVISPK
FT                   TNRSILGYSIMIAKDNNIIIADNCITEYPNSWELAQIATQTAEIAKNMGITPRVALLSF
FT                   STFGNSSKAKTARIREAVNILDNFSKDKEELSGMKVDFEYDGEMSVKVALDGDLRKLYK
FT                   FCRLSGSANVLIMPGLNSAAISTELLQEFSSNSFIGPITNGFEKPVQILQAAATANEIL
FT                   KIATFACVEAINEV"
FT   gene            502655..503200
FT                   /locus_tag="RC0508"
FT   CDS_pept        502655..503200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0508"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03046"
FT                   /db_xref="GOA:Q92IB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB2"
FT                   /protein_id="AAL03046.1"
FT                   /translation="MRGKVASITELYKNIQEITKDLRKHDPQIPDASKKPLASRENFDD
FT                   LIHSDLGQPVRNKPLSFDEELKKKVQSRQVQDFFEQQTKSTEEKIDNHAKRIEELKQKQ
FT                   KELEERKKWLEEKKANSNITIEERWQIAAELEAINTQLKAIEKEHNTINSASDREQKFD
FT                   NKNKHLTATKREPIAADL"
FT   gene            503290..503520
FT                   /gene="sec7"
FT                   /locus_tag="RC0509"
FT   CDS_pept        503290..503520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sec7"
FT                   /locus_tag="RC0509"
FT                   /product="protein transport protein sec7"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03047"
FT                   /db_xref="GOA:Q92IB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB1"
FT                   /protein_id="AAL03047.1"
FT                   /translation="MPRGTIPMPPLMPGSGIPIPPSPPPPPISIPKTIKKEAKDVGKQM
FT                   PQGGDQHKEELAKAMKARRAKIEKQNSGRGR"
FT   repeat_region   503584..503727
FT                   /note="REP06, A and T rich repeated element"
FT   gene            complement(503736..504149)
FT                   /locus_tag="RC0510"
FT   CDS_pept        complement(503736..504149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0510"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03048"
FT                   /db_xref="GOA:Q92IB0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IB0"
FT                   /protein_id="AAL03048.1"
FT                   /translation="MNQEERNLIMNKYILDSSALLALFNLETGSDKVEELLPLSIMSTV
FT                   NIAEVVAELDKKLNISFIQSKAMISASINKIVALDFDQAIEIGRLKKETEQFGLSLGDR
FT                   ACISLGLITGYPIYTADKIWAKLQLNCKIVLIR"
FT   gene            complement(504115..504363)
FT                   /locus_tag="RC0511"
FT   CDS_pept        complement(504115..504363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0511"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03049"
FT                   /db_xref="GOA:Q92IA9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA9"
FT                   /protein_id="AAL03049.1"
FT                   /translation="MHLEYKVTISENGRINIPAKIRDQLHLASGDQLMLILDKELTLIP
FT                   LKNKIKEFQALVKSRNKDNISLVDSLIESRRKEFNNE"
FT   repeat_region   complement(504470..504548)
FT                   /note="REP06, A and T rich repeated element"
FT   gene            504561..505817
FT                   /gene="proP3"
FT                   /locus_tag="RC0512"
FT   CDS_pept        504561..505817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP3"
FT                   /locus_tag="RC0512"
FT                   /product="proline/betaine transporter"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03050"
FT                   /db_xref="GOA:Q92IA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA8"
FT                   /protein_id="AAL03050.1"
FT                   /translation="MVSYAVATKRKYYMSNSAFLVAFFTTIIRYYDYALFGLSASILAQ
FT                   NFLPNIEQDKQLLGFFAILSAAVIVRPLGSLIFGFIGDKYGRTQSIKISMCMSSIATGL
FT                   IAITPSFEIIGIFATVILTLCRMVFLASLAGEVDGIKVYVAEKTGDNQKNLNIGIVSCC
FT                   GQIGALLAAIAYYYASNSDIQYLWRFNFFIGAIFGLFAILMRNFFKESSEFLRTSSKST
FT                   LRQIIWNNKLSVIIALLINGAIGGVYHFLVIFLGVFLTKIALINHPEIRFMNIALTTTY
FT                   GISAVFAGLFADKINPLRQITWALFVSIIVALGMQIMLYKQIFNILCPVILIGLAAFYA
FT                   VPLQIIVQSLFKTNVKMRLYSLSHSFGGIILSSTTPFFSMLLWQNFKSLSLTLSFFIFL
FT                   LIILMSTVLVLRRMSSSQQ"
FT   repeat_region   505850..505952
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(506001..506186)
FT                   /locus_tag="RC0513"
FT   CDS_pept        complement(506001..506186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0513"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03051"
FT                   /db_xref="GOA:Q92IA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA7"
FT                   /protein_id="AAL03051.1"
FT                   /translation="MNINEITHDLKLKGKTKNLKDKFENLAKEAKQIGTQAQQRSKSSS
FT                   SPSIKPTGCSKDGRNI"
FT   gene            complement(506322..506669)
FT                   /locus_tag="RC0514"
FT   CDS_pept        complement(506322..506669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0514"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03052"
FT                   /db_xref="GOA:Q92IA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA6"
FT                   /protein_id="AAL03052.1"
FT                   /translation="MTYELSKNTSPKHIKQSTQDQPKISTGAVTGIKERIAKIEADSDS
FT                   KIKQYWTEEKKQTVEKQHENTQSDYITPQKNFEFENRGKEIKENSTKNLINKFEKGFDS
FT                   KTTRYWTSPAG"
FT   gene            complement(506694..506909)
FT                   /locus_tag="RC0515"
FT   CDS_pept        complement(506694..506909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0515"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03053"
FT                   /db_xref="GOA:Q92IA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA5"
FT                   /protein_id="AAL03053.1"
FT                   /translation="MVSTFQQDERINDILDKLQKISTNCSKISNNDDKFNKEIKASFVE
FT                   INTTLKNIMEYKGPEIDYLNSNIETV"
FT   gene            complement(507066..507584)
FT                   /locus_tag="RC0516"
FT   CDS_pept        complement(507066..507584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0516"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03054"
FT                   /db_xref="GOA:Q92IA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA4"
FT                   /protein_id="AAL03054.1"
FT                   /translation="MKLFLVQAKILSNSNIAKDKLTVTKELQKSIQQKEVSNERLTQEE
FT                   IDNIYKTLGIFEEIKEYEKSDNSRVPRLLNKNYYKLTDPREERRSDNIALEQDDTGMLT
FT                   TDTDLEWDDTGILPPAQNSAVSDKLKEAVDDYISELQNEKLSKDTSPKQVEAITHPMQE
FT                   AIPTPLALS"
FT   gene            complement(507526..507714)
FT                   /locus_tag="RC0517"
FT   CDS_pept        complement(507526..507714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0517"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03055"
FT                   /db_xref="GOA:Q92IA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA3"
FT                   /protein_id="AAL03055.1"
FT                   /translation="MYKQANINPQSNTVSRSASIDSGIASSQEELSTTFGKSSSTNLIE
FT                   ALFSTSENFIKFKYSKR"
FT   gene            complement(507762..507977)
FT                   /locus_tag="RC0518"
FT   CDS_pept        complement(507762..507977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0518"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03056"
FT                   /db_xref="GOA:Q92IA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA2"
FT                   /protein_id="AAL03056.1"
FT                   /translation="MPEVITITKLIYYPNKFISNLIKQNESVLQKETGKYSPSLETIPE
FT                   DSISKFITGNSTFLNRTFCKTRKFIQ"
FT   gene            complement(508013..508933)
FT                   /locus_tag="RC0519"
FT   CDS_pept        complement(508013..508933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0519"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03057"
FT                   /db_xref="GOA:Q92IA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92IA1"
FT                   /protein_id="AAL03057.1"
FT                   /translation="MEGFKEDRKGQKTKAQLDILISPSDFSVLLRLSNSLPITNEQELE
FT                   IKGNINLLQLMEAVVQKVGEKSLNIKQDKKVLTSQKNEQAITHGQQKVELSLKEEIIKL
FT                   REAVQETIKNPTNNEEFNKTSKEILGLINNINAHQPSRLQATRNKILSSGESPNTKNTK
FT                   IEGFFLEQHEWDKFQELRERLQKIKEPREKLYEMKNFYDVINSLDKNIILGVMQEKQKV
FT                   QQASNQKAQEIIRSKFLYLDNAWDFSDGLQNVFEKLKNKEATGEKELIEASKNILSKSI
FT                   SVNKNYFRNTNNSSELDLQYKMLLR"
FT   gene            complement(509332..510276)
FT                   /gene="mdh"
FT                   /locus_tag="RC0520"
FT   CDS_pept        complement(509332..510276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="RC0520"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03058"
FT                   /db_xref="GOA:Q92IA0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92IA0"
FT                   /protein_id="AAL03058.1"
FT                   /translation="MKQNAKISLIGSGNIGGTLAHLISLRELGDIVLFDVTEGVPQGKA
FT                   LDLMQAGTIAGSDIKIKGTNDYKDIEGSDAIIITAGLPRKPGMSREDLISINTGIMKTV
FT                   AANVKKYAPDAFVIVITNPLDVMVYVMLKESGLPHNKVIGMAGVLDSSRFNLFLAEEFK
FT                   VSVNNVNSMVLGGHGDAMVPLARYSTISGVPIPDLIKMGLSSNENIEKIIDRTRNGGGE
FT                   IVALLKTGSAYYAPAASAIEMLESYLKDKRQILTCAAHLQGEYGVHDLYVGVPIMIGKE
FT                   GVLRVIELQLTAEEKALFDKSVEGVKKLIETIK"
FT   gene            510570..510908
FT                   /locus_tag="RC0521"
FT   CDS_pept        510570..510908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0521"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03059"
FT                   /db_xref="GOA:Q92I99"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I99"
FT                   /protein_id="AAL03059.1"
FT                   /translation="MDQFSRCHPARLDHGIQLKILELLVFFIVFMDPMVKPRDDTGDFT
FT                   GLHNNIELRMTSYAFSESCNNAYVAHENYRYQRKQVFAGMDILINVVSSYYNILIKLSR
FT                   HIAIIDIR"
FT   repeat_region   510598..510691
FT                   /note="REP03, repeated element"
FT   gene            complement(510835..512358)
FT                   /gene="tlc2"
FT                   /locus_tag="RC0522"
FT   CDS_pept        complement(510835..512358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlc2"
FT                   /locus_tag="RC0522"
FT                   /product="ADP,ATP carrier protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03060"
FT                   /db_xref="GOA:Q92I98"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I98"
FT                   /protein_id="AAL03060.1"
FT                   /translation="MDSVDSNFTIWNKARNSKFRHIVWPIRSYELTKFIPMALLMFFIL
FT                   LNQNLVRSIKDSFVVTLISSEVLSFIKLWGEMPMGILFVIFYSKLCNIMTTEQVFRIIT
FT                   GTFLFFFAIFGFILFPYREFFHPDPELIKHYITVLPHLKWFLIIWGQWSLVLFYIMGEL
FT                   WPVIVFTLLYWQLANKITKVEEAPRFYSFFTLFGQTNLLISGTVIIYFAKSEHFLLPLF
FT                   SHLNDTNEILLKSFITVILISGLICLALHKLIDKSVVEADKNIKFKNQRMDILKLSLVD
FT                   SAKVILTSRYLGFICLLVMSYSMSISLIEGLWMSKVKQLYPATKDFIAYHGKVFFWTGI
FT                   LTLVSAFLGSSLIRICGWFWGAIITPIMMFGAGVMFFSFTVFENHLGNIVNTLGYSAPL
FT                   VVIVFIGGLWHVLSKSVKYSLFDATKEMVYIPLDSEMKTKGKAAVDVMGAKIGKSIGAI
FT                   IQFISFSIFPNAIHNDIAGLLMFSFIIVCLLWLYGVKVLSKYYNKMIQR"
FT   gene            complement(512570..514183)
FT                   /gene="pyrG"
FT                   /locus_tag="RC0523"
FT   CDS_pept        complement(512570..514183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="RC0523"
FT                   /product="ctp synthase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03061"
FT                   /db_xref="GOA:Q92I97"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I97"
FT                   /protein_id="AAL03061.1"
FT                   /translation="MVHFIFVTGGVVSSLGKGLTAASLAMLLQAKGFRVSVRKLDPYLN
FT                   IDPGTMNPHEHGEVYVTDDGAETDLDLGHYERFTGVSACKFDSITTGAIYSKLLKDERL
FT                   GNYAGVTVQVIPHVTNIIKDFILSNTKGFDFIICEIGGTVGDIEGLPFFEAIRQIGNKL
FT                   KSENCLFIHLTLLPYVKTARELKIKPTQHSVKALRAIGISPNILVCRAERNISKGEIDK
FT                   ISLLCNIESEYVVPAIDQKNIYLVPIAYHNSGLDNKVLKFFNINIMPSKLDKWHDIINR
FT                   LKDSNSKVRIAIIAKYHKLKDAYKSVIEALDHAGIYYKYKIDLVWINAENLTEENINKK
FT                   LLDIDGILVPGGFGERATKGTIIAIKYARTNNIPFFGICFGMQLATIEIAQNLIGIKDA
FT                   VTEEFKVDGTKIIEKINKNCEDSKITIENVKKTMRLGSYPCSLVASTIAANAYKSLEIN
FT                   ERHRHRYKFNNEFQNIFEKHGIVFSGFSKDEEIVEIIELPLLRWFVGVQFHPEFKSKPF
FT                   EAHPLFIQFIKAAIEYNKCN"
FT   gene            complement(514186..514926)
FT                   /gene="kdsB"
FT                   /locus_tag="RC0524"
FT   CDS_pept        complement(514186..514926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RC0524"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03062"
FT                   /db_xref="GOA:Q92I96"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I96"
FT                   /protein_id="AAL03062.1"
FT                   /translation="MRHQDVAIIIPSRLSSTRLKQKPLQLIGSITLIERVFKQVNQAGL
FT                   EHTYVATDSEEIASVITKVGGKVIFTDSAIPTGTDRTYEAFKLIPNNQNINYIVNVQGD
FT                   MPFIEPSSILKIIEYLKNSKYDVVTPIVKVDRESVKASSNVTVAVDSAGTALYFSRSLI
FT                   PNGAEEFLYHVGMYGFRKNALEKFVSLKPTFLEKTERLEQLRVLENGMTIGTCLVENVP
FT                   ISVDTEEDLKKAVKFYENISKLGL"
FT   gene            515025..515097
FT                   /locus_tag="RCRNA12"
FT   tRNA            515025..515097
FT                   /locus_tag="RCRNA12"
FT                   /product="tRNA-Lys"
FT   gene            515115..515188
FT                   /locus_tag="RCRNA13"
FT   tRNA            515115..515188
FT                   /locus_tag="RCRNA13"
FT                   /product="tRNA-Ile"
FT   gene            complement(515682..515972)
FT                   /gene="mutT"
FT                   /locus_tag="RC0525"
FT   CDS_pept        complement(515682..515972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="RC0525"
FT                   /product="mutator protein MutT-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03063"
FT                   /db_xref="GOA:Q92I95"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I95"
FT                   /protein_id="AAL03063.1"
FT                   /translation="MNNRNEILLGKHISSHGESSYAPVGGHLEFGETFAECAIREVLEE
FT                   TNLIIENPQLIAVTNDIFETEQKYYILICLKAHCLNEHELQNLEAHKVESW"
FT   gene            516133..517656
FT                   /locus_tag="RC0526"
FT   CDS_pept        516133..517656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0526"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03064"
FT                   /db_xref="GOA:Q92I94"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I94"
FT                   /protein_id="AAL03064.1"
FT                   /translation="MNSTNQLQNNSLTNSWLKLGILSLGFAGLYSIILVVLRTPQLSSF
FT                   FPNPHIFKSALIIHVNLSVLIWLLSVTASVWGGETSLRGEAKPRRGNLMKQYKISEIVT
FT                   LSTFACNDVFRLYPKLAFLATLLIAISPIAGHNPVMNNYIPMLENIVFIGGLSLFGVTL
FT                   LLYAINILYFFDWTNLNSIVNFTVLSTIIMFILSFVCFGWSYNGLQNIIQIIPIEIEFY
FT                   YELLFWSGGHLLQFIYTQILIFIWVSLFRELIAREVKCQKFYLFLLYLNFIFGILTLFG
FT                   HIFYDIIDGAFKVFYTNHMKYLGGIAPVLCLIGMGVELVWVFVIPRDDTVTINDRVIKT
FT                   ILLCSITLFLLGGLIAMNITGINVAIPAHYHGSIVGISIACMGCSYLGIGRYQRHCERL
FT                   KRAWQSHEVIQKLPRLSRRHFVHPRNDNIINFTFYLLTFGQILHILGLAFAGGYGVMRK
FT                   DPNSVMPMSAKLLMGMMGGGGVIAIVGGLMFVYICVKVIFFKSIKLAHE"
FT   gene            517649..518218
FT                   /gene="folE"
FT                   /locus_tag="RC0527"
FT   CDS_pept        517649..518218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="RC0527"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03065"
FT                   /db_xref="GOA:Q92I93"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I93"
FT                   /protein_id="AAL03065.1"
FT                   /translation="MSKPTREEAKEAVRTLLKFIGEDPSREGLLQTPDRVINSYVEIFS
FT                   GYGKDVAEILNTKFYETCNFRDFILLNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGIS
FT                   KLARIVNIFARRLQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVM
FT                   NTMHYTGIFAEQQKYRHEFLNLTAKR"
FT   repeat_region   518264..518294
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(518311..518336)
FT                   /note="REP03, repeated element"
FT   gene            518383..519663
FT                   /gene="proS"
FT                   /locus_tag="RC0528"
FT   CDS_pept        518383..519663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="RC0528"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03066"
FT                   /db_xref="GOA:Q92I92"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I92"
FT                   /protein_id="AAL03066.1"
FT                   /translation="MLLSKYFLPVLKEEPSEAQVTSHKLMLRSGMIRQQAAGIYTWLPL
FT                   GLKVLKNIENIVRLNMNKAGALEVLMPCIQPAHLWMESGRFDNYGKEMLKFQDRHDNTL
FT                   LFGPTNEDMITDIFRHNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSF
FT                   DINEENAVKTYNQMYKAYINAFRDLGVFVIPVIADNGPIGGNLSHEFHIIAETGESTIY
FT                   YDKKFKTLKDNPDIDVEEIKSWYAAAEEKYEVNKLPISEQEITSSKGIEVGHIFYIGSK
FT                   YSVNMNALINDEYGKLTPIEMSSYGIGISRLVAAIIEANCDEKGIIWPSSVAPFKVSLI
FT                   NLNIHDSKCVELAEMAYKELSDKNIEVLYDDTEARPGSKFATHDLIGSPHQIIIGPKKA
FT                   ANNIVELKDRKSGVIEDIEVGSLMSVL"
FT   repeat_region   complement(519679..519777)
FT                   /note="REP01, repeated element"
FT   gene            519864..520832
FT                   /locus_tag="RC0529"
FT   CDS_pept        519864..520832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0529"
FT                   /product="cell filamentation proteins (fic)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03067"
FT                   /db_xref="GOA:Q92I91"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I91"
FT                   /protein_id="AAL03067.1"
FT                   /translation="MNSKPSFQITNKILELSQDISYELGILAGSKFYSQPIKLRKNNQI
FT                   KTIHSSLAIEGNSLSVEQITDIINDKRVLAPEKDIVEVKNAIKLYNNLTIFNPFKIESL
FT                   LKAHEILMQGLVEDNGKWRKGNASIFKGTEIIYFAPTARRVSLLMQDLFEFIAQDKQIS
FT                   GIVKACIFHYEFEFIHPFSDGNGRIGRLWQQLLLMQANKIFEYISVESLIRNNQSEYYS
FT                   VLSKCDKLGESTLFIEFMLDKIVAALRLYSNNITYEANTPLSRMEFAKVNLIDQWFSRK
FT                   DYITVHKNISTATASRDLLYGLERKLLISKGDKNQTYYKFV"
FT   gene            520894..521229
FT                   /locus_tag="RC0530"
FT   CDS_pept        520894..521229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0530"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03068"
FT                   /db_xref="GOA:Q92I90"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I90"
FT                   /protein_id="AAL03068.1"
FT                   /translation="MPFPRKPESSTLKLFKSSLYLALPLDFCFRRNNIISLIQKEINMK
FT                   NFIKYLFFTGLYIVVTIIVAYIVLAQTIPNDGQCHMMDRPFVIHYILAAIITALPTLIL
FT                   IYSKKKK"
FT   repeat_region   complement(520937..520994)
FT                   /note="REP02, RS3-like repeat"
FT   gene            521234..521845
FT                   /gene="ruvA"
FT                   /locus_tag="RC0531"
FT   CDS_pept        521234..521845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="RC0531"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03069"
FT                   /db_xref="GOA:Q92I89"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I89"
FT                   /protein_id="AAL03069.1"
FT                   /translation="MIGQLSGKVDSQGDDYVIIDVNGVGYLVYASGKTLGKLAEGEFYK
FT                   LFIETHVREEHIHLYGFLTLEEKIFFNLLQSVNGIGTRMALFILSSLTPSDIQIAVNNE
FT                   DKNIFKAISGVGAKLAERIVLELKGKVAKISSGSAIIKESLNIKNITPVASNEVIKALV
FT                   NLGFSRFEAQNAVQGIITQNPEISIDELIKTALKNRNSNF"
FT   gene            522472..522759
FT                   /locus_tag="RC0532"
FT   CDS_pept        522472..522759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0532"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03070"
FT                   /db_xref="GOA:Q92I88"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I88"
FT                   /protein_id="AAL03070.1"
FT                   /translation="MKSQDRQELDAQITEITDENNLTLKDVAEVLKNYYENLNIILSNE
FT                   IFGHYFKLYKGLNQNYLKEELQNLGVTDTEKFFETVDKLREGVTSFYEEG"
FT   gene            522799..523863
FT                   /gene="ruvB"
FT                   /locus_tag="RC0533"
FT   CDS_pept        522799..523863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="RC0533"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03071"
FT                   /db_xref="GOA:Q92I87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I87"
FT                   /protein_id="AAL03071.1"
FT                   /translation="MAIISHYIRFKIMTNILSPEKSENDQELPIRPSYLQEFVGQQQIK
FT                   ENLSVFIKAAKSRNEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTSGPAILKVADL
FT                   AAILTNLEKNDVLFIDEIHRLNTAVEEVLYPAMEDFELDIIIGEGSAARSVKITLPKFT
FT                   LIGATTRLGLLSNPLRDRFGIPMRLNFYNTGELKKVLNRASKLLDIDLTDSGSEEIAKR
FT                   SRGTPRIALRLLRRIRDFAAVDGKSRVDKEISDFGLNRLEVDRIGLDSNDYRYLKFIAD
FT                   NYNGGPVGIETIAAALSEQRDALEETIEPYLIQIGLLQRTPRGRVITIAAFEHLKMPVP
FT                   NQSHHQFNIFNENE"
FT   gene            523856..525619
FT                   /gene="msbA1"
FT                   /locus_tag="RC0534"
FT   CDS_pept        523856..525619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA1"
FT                   /locus_tag="RC0534"
FT                   /product="multidrug resistance protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03072"
FT                   /db_xref="GOA:Q92I86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I86"
FT                   /protein_id="AAL03072.1"
FT                   /translation="MNNNNLNDNYTAADVIKRLIKDHVKPYANKIYFSIFCMVVAALCT
FT                   AVIVHAARPIIDKVFLTHDKEMLIIMPIVLTVTFVIKGISEYYQNYLIKFVGQRVLNDL
FT                   QIKMYEHLLFADISFIQNQSSGRLISRFTNDISLMRGAVSNLLVGCAKHFLTVVCLIAT
FT                   MFHLEPLLSCVVFLVFPLAVYPVQRMGRKIRRIFAQSQEELGHYTSRLDETFQSIKIIK
FT                   SFVGEQIESNRASLIINNILEFYKKTSKLDAMVSPIMEGLSGLAVGGMVWYGGNLVLEG
FT                   KSTPGALFAFLASFAAAYRPFKSLVSLNINLQEGIAAAKRVFSILDTEPLIKDHEDAKD
FT                   VDLYNPQITFEKLALRFESKIAIKYIDLRLEPHKIIAFVGRSGSAKTSLSNLLVRFYDP
FT                   NEGRILINNHDIKDIKLTSLRGQISLVTQDTHLFDTSVAENIAYGQENATREEIIRAAK
FT                   YADAHEFIMHLPNGYDTQIGGQGTTLSGGQRQRLSIARAFLKDAPILIWDEATSSLDQA
FT                   SEQKILESLKKLRQGKTTLIITHRLSSITDLDNIIVMKNGEICEQGTHTQLLKNKDEYY
FT                   RLYNKELRENG"
FT   repeat_region   complement(525703..525723)
FT                   /note="REP01, repeated element"
FT   gene            525813..527057
FT                   /gene="ampG4"
FT                   /locus_tag="RC0535"
FT   CDS_pept        525813..527057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG4"
FT                   /locus_tag="RC0535"
FT                   /product="ampG protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03073"
FT                   /db_xref="GOA:Q92I85"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I85"
FT                   /protein_id="AAL03073.1"
FT                   /translation="MRITKIFKDYRLFEIFILGIVSGMPLVIIFSTLAVWLKESGIDIA
FT                   VITTFAVARLSYSLKVFWSPLVDNFKIPFLSRWGHRKSWLILCSSLMALVLIAMSKENP
FT                   EVSLTSFYFLTILLGFLSSTFDIAVDALRIDKFDQETQSIASATAVFGYRIGMLITGAG
FT                   ALYLAEITGNNWQLTFCVIAIIFVVATIFIITVNEKELVREKINIISITSWISTVINPF
FT                   KDFFKREFAVTILLAVIFFKLGDAMLGAVASPFYIELGYTKGEIAIIAKLYGLIATLVG
FT                   GFVGGIVMYRVGNFKGLIITGIAQSLTHFAFIWLNHQPPSFEALLIAITIENFAAAMGA
FT                   TALVGYIGNLCNKKYSATQYALLSSASSLCNNTVTIYAGKLVNMMGWDGFFLFTIILAL
FT                   PALFILMYLNTKVNV"
FT   repeat_region   527138..527158
FT                   /note="REP01, repeated element"
FT   gene            527234..528154
FT                   /gene="dacF"
FT                   /locus_tag="RC0536"
FT   CDS_pept        527234..528154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacF"
FT                   /locus_tag="RC0536"
FT                   /product="penicillin-binding protein dacF precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03074"
FT                   /db_xref="GOA:Q92I84"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I84"
FT                   /protein_id="AAL03074.1"
FT                   /translation="MFRKFLLPYIFVVTFFFAPISEAKKAVKNTPKPPVQTSLVIDAKS
FT                   GKVLQAHNSQIRIYPASLTKLMTLYLMFEAIEAGKLPLDKKLLVSAKASKMPPCKLGLK
FT                   AGETITVREAINGLIIKSANDVAVTVAEGMKGSEKAFAHLMNVKAKQLGMKNTYFKNAS
FT                   GWHNPLQQTTARDMAKLAMALKRDYPKFYPLFAKTSFVFRGNVVNGHNRVTKNYQGAEG
FT                   MKTGFHTPAGYNLVTTASRNGKSLIAVVTGGKSAASRDQKMMGLLDQHFNIKPIVPKPS
FT                   IKLASNNKSTTKAKSKIIKKKNIRS"
FT   repeat_region   528187..528234
FT                   /note="REP01, repeated element"
FT   gene            complement(528324..529286)
FT                   /gene="rlpA"
FT                   /locus_tag="RC0537"
FT   CDS_pept        complement(528324..529286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="RC0537"
FT                   /product="rare lipoprotein A precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03075"
FT                   /db_xref="GOA:Q92I83"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I83"
FT                   /protein_id="AAL03075.1"
FT                   /translation="MIIVKNHKFKLDLLQNEANKEKFEGNTACSTAAYTLVREDASTGL
FT                   TYTADISKVGNQISGEPAQRIKIREHRRIPKFDLPNLKVSKVYKLPLEASYAKGLLLLL
FT                   IFCFGLSGCNTSKRLPYSHKYSYKELSKDDPHNLTYKGHYKVGKNYKIKGKTYKPHNPK
FT                   SFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAHKTLPLPCLVKVTNKANNKAVI
FT                   LMVNDRGPFKKNRIIDVSQRAAEILAFKNQGITKVKIEYLPNETEKFLKNINLKKPQSK
FT                   TLAKNSKKSSSNKVTNNNKCSVNCHIKLINLKYKLAVTP"
FT   repeat_region   complement(528994..529025)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   repeat_region   complement(529065..529106)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   repeat_region   complement(529112..529254)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(529264..529881)
FT                   /locus_tag="RC0538"
FT   CDS_pept        complement(529264..529881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0538"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03076"
FT                   /db_xref="GOA:Q92I82"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I82"
FT                   /protein_id="AAL03076.1"
FT                   /translation="MILRVLIFITLSFSLSACLPAIFTAATTTGIVASKDQPVSETLND
FT                   SRISASIKADLVKNNFRDLGAKIKVEVSQGRVLLTGNIQKESDALKAVEIAWNQKSVKE
FT                   VINELKVNKNSNHFDLAQYTKDSMITTQIKAKNLVRKDIKFANYTILTIDNIVYLFGVA
FT                   RSEEELEKLASIASKIKGVEKVVCYAKIMNNFNTNNDNSEES"
FT   repeat_region   complement(529945..530038)
FT                   /note="REP03, repeated element"
FT   repeat_region   530069..530087
FT                   /note="REP10, short repeated element"
FT   gene            complement(530114..530656)
FT                   /locus_tag="RC0539"
FT   CDS_pept        complement(530114..530656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0539"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03077"
FT                   /db_xref="GOA:Q92I81"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I81"
FT                   /protein_id="AAL03077.1"
FT                   /translation="MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVI
FT                   DKKVSKLSIISTTVLLVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKY
FT                   ALESIVRLKEESWITLSYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFI
FT                   LLQLPLLLKNKLPDSKI"
FT   gene            complement(530686..531534)
FT                   /locus_tag="RC0540"
FT   CDS_pept        complement(530686..531534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0540"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03078"
FT                   /db_xref="GOA:Q92I80"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I80"
FT                   /protein_id="AAL03078.1"
FT                   /translation="MFKIALVVFRECLEISLLLGVILVVTKQIEKSRLYIIAGVMLGVV
FT                   FASIFAFFTRKLSLSFGGIGDELFDSGIMILITILISWTIIWMQGYGIKVKQHINDLSV
FT                   KIHEGNASYFMLFFLVATTILREGAEIIILVYSISSVETISSSIYLQGVIIGATSGFLL
FT                   GLVIYFGFIKIANQKYIFKISTILLMLIAGGFAASAAGILTSSGLIMFLSDQLWDSSWL
FT                   VADRSMIGKILHIVTGYIARPNGLQVLAYFTTILLINIFIQIKLRYSKNNLISVQKNES
FT                   N"
FT   gene            complement(531544..531924)
FT                   /locus_tag="RC0541"
FT   CDS_pept        complement(531544..531924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0541"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03079"
FT                   /db_xref="GOA:Q92I79"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I79"
FT                   /protein_id="AAL03079.1"
FT                   /translation="MEIIKKNKNIIILVGLIFLAVIIYISTSKSSENKTNDNILEVKIA
FT                   IQDHKFVPNIVEVPKSTKIRLIVHNEDDTVEEFESHDLHREKIVMPNESIHIILAPLKS
FT                   GKYEFFGDFHQDTAQGFIIVND"
FT   gene            complement(532111..533106)
FT                   /locus_tag="RC0542"
FT   CDS_pept        complement(532111..533106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0542"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03080"
FT                   /db_xref="GOA:Q92I78"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I78"
FT                   /protein_id="AAL03080.1"
FT                   /translation="MQKFLSLIIVILILYNIVKLKISPDNNNLTTVEQTASNNSSTDEN
FT                   QTSINNEPPISLNGNLFERTVSKIVINALKTEEGKAFFENILQPLNGPINPNDYTIEVR
FT                   KDLVKTLFKINTLGSGNIGPASCGHVVTVFYQISDMNNTLISEDTKTFTLGSAPVMLGL
FT                   DNVIIGMMVGEAREAIIPAKYAVNNSNNIIFDDAYNYKVNVILKSILPQNFVKSNEVKI
FT                   YDDEIAYRVPLLCGEKVSFNAKITRLSNGKILYDSKAKGQQIDMKIGDITYPLIFSYAL
FT                   QGKVTIGTRSVIAKGKTFKTLGSNINKIISHESLPTNEYLLLELGDFKQN"
FT   gene            533248..533874
FT                   /locus_tag="RC0543"
FT   CDS_pept        533248..533874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0543"
FT                   /product="protocatechuate-3,4-dioxygenase, beta
FT                   subunit-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03081"
FT                   /db_xref="GOA:Q92I77"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I77"
FT                   /protein_id="AAL03081.1"
FT                   /translation="MKKFIFCFLCLWTLNIFAASKTYPNKLNRCKITRNIFNDYEPKVF
FT                   ETTNNLLRKTGRLSKFYGERILIKGKVLDQNCVPVADAKVYLWQAGSGGKYPYEPLKTR
FT                   VDKRRFTSKSDSSFTGSGIATTNNKGEYYFISMLPYTSSRYLRSANIRIEHPSLTTLET
FT                   RLDLSDQNMCDNECGEVNPILIEPQENMPSYCFDLVLQGTTLKRY"
FT   repeat_region   complement(533883..533974)
FT                   /note="REP01, repeated element"
FT   gene            534082..534726
FT                   /gene="tlpA"
FT                   /locus_tag="RC0544"
FT   CDS_pept        534082..534726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="RC0544"
FT                   /product="thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:RC0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03082"
FT                   /db_xref="GOA:Q92I76"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I76"
FT                   /protein_id="AAL03082.1"
FT                   /translation="MTLRNYNKYLICIIVFLLSIIIFIPKIHARLYEHPKDKLAFLRGS
FT                   SVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWSAPCVKEMPDLDMLQKDFRKLPFSV
FT                   IPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALWVVSLPTSILIDPNGKIVTS
FT                   FVGNTNWYDEKVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIQKDAL"
FT   repeat_region   534742..534850
FT                   /note="REP04, repeated element"
FT   gene            534892..535806
FT                   /gene="sohB"
FT                   /locus_tag="RC0545"
FT   CDS_pept        534892..535806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="RC0545"
FT                   /product="possible protease sohB"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03083"
FT                   /db_xref="GOA:Q92I75"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I75"
FT                   /protein_id="AAL03083.1"
FT                   /translation="MNEVNKSTMANAEFDQIITKRQISKLDQLFASVFGNSKEVIAVLR
FT                   LSGVIGKVSTMQSGLTLESLNALIEKAFKIKKLKALCLIINSPGGSPVQSELIAKRIRD
FT                   LAEENKIKIYSFIEDMAASGGYWLACSGDRIYALPSSVIGSIGVVSSGFGFHEAINKLG
FT                   IERRVYTEGKNKSVLDPFKPINKDDLKIIKDLQKQVYEHFIEYVKTRRAGKLTQQDEIL
FT                   FNGEFWAGQTALDYGLIDGIGDIYSVMKEKFGDNIKFQYLCAKQPWLKKKLGMGSKILT
FT                   DNLANSLIDAVENKIINDKFDMK"
FT   gene            535808..536254
FT                   /gene="dut"
FT                   /locus_tag="RC0546"
FT   CDS_pept        535808..536254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="RC0546"
FT                   /product="deoxyuridine 5-triphosphate nucleotidohydrolase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03084"
FT                   /db_xref="GOA:Q92I74"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I74"
FT                   /protein_id="AAL03084.1"
FT                   /translation="MTITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAA
FT                   IQLIPTGIAIALPDSFEAQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE
FT                   DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSGGFGSTGV"
FT   repeat_region   536264..536396
FT                   /note="REP02, RS3-like repeat"
FT   gene            536471..538432
FT                   /gene="slt"
FT                   /locus_tag="RC0547"
FT   CDS_pept        536471..538432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="RC0547"
FT                   /product="putative soluble lytic murein transglycosylase
FT                   precursor"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03085"
FT                   /db_xref="GOA:Q92I73"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I73"
FT                   /protein_id="AAL03085.1"
FT                   /translation="MKITIKLLTSILLLLALKVNANSDAVDNVKQVFTYIDQKNWSQAE
FT                   DLALEVNNKILTKIVLSQKYLDNKYSDNSFEHVIRFLCNNPDWPQNKLLEERAEEYLNN
FT                   NTNKKVIVDWFSKHSPLTGKGYKFYAAAASSLIKDQKILLPIIKEAWVYANFTPEEENA
FT                   YYNKWHKYLTASDHLERIEEHLWKNDIRSAEQSLKYVEQGYRNAFKVQIAIIGKSPNAE
FT                   KLFKSVPEKYYTSGLLYRYLDFKKMQKPTKEIITLFKKAKNNRKHFAKWCRIQSYYARE
FT                   FIEYKDFANSYRMATLPFATCPETIREQEWLAGWLSLSFLKKPDQALVHFNKFIKVVKT
FT                   PISLARGFYWLGRTYAAKGDKQMARKFYVQAAKYSFTFYGQVANIELNRTKLVLPPIPV
FT                   ITSEERKIIENKEIIKAIRLLVKYNKNYLALIYSKAAMKNTKNSAEIQIIANIIKANNN
FT                   TNHMVEVAKIAAQNNAFIPDCAFPTPYNLVGLPIPPHLTYGIIRQESVFDHKAVSYANA
FT                   MGLMQLIKGTACDTARSINVKCNVADLTRNPVYNIKLGAHHFKKLLDNHKGSYILSIAS
FT                   YNAGSHNVVKWIDRFGDPRDIKDTRKVIDWIELIPYRETRDYVQRVLENVQIYRVILNK
FT                   NSSLYFKRDLHACDIAKS"
FT   gene            538519..539478
FT                   /locus_tag="RC0548"
FT   CDS_pept        538519..539478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0548"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03086"
FT                   /db_xref="GOA:Q92I72"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I72"
FT                   /protein_id="AAL03086.1"
FT                   /translation="MKKLEQHFKKHRNDNDIQVKKYKDDLNVIGIRYDHKFAHVAVPNH
FT                   ATGGFEYFKWDWMTSITGSHSEIVPIFKKIVSILKEAQSNPAQYENLVSNLDASTKNAL
FT                   EVTIRSNNITVPIQDTNKVMSEILSGMQTWLDTKSHIPVDLKQQFLDLGSNHLELFIKA
FT                   AYNKFNNKWIVKEFVDNAVKTGEEGRKYLADCDCSSTDQLWTKLVEPIIENLRISENST
FT                   DKSEDDEISEASANKLGAKVKTLALSNTHELPAQKEALKLVYDMRKGNIDKATVVQNIN
FT                   FFGQDDTVLGGSVEYSGLTIDQIKAKAVEIAGDDAVLE"
FT   gene            539564..540619
FT                   /gene="mccF"
FT                   /locus_tag="RC0549"
FT   CDS_pept        539564..540619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mccF"
FT                   /locus_tag="RC0549"
FT                   /product="microcin C7 self-immunity protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03087"
FT                   /db_xref="GOA:Q92I71"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I71"
FT                   /protein_id="AAL03087.1"
FT                   /translation="MSTVSRKNKIKTGCRGQAPRHDIVGLPVQQYLSIIFMILKNISLL
FT                   IILFFSISTFSAGHSLKNISITVVAPATGADNKTLSDLKNINGLNLQISSKCFAKGKLP
FT                   FLASSDEVRFNCLRDALFDESDNIVWSLRGGYGSARIIPDLLKLSKPNKEKFFIGYSDI
FT                   TALHLFLSQEWGWKTIHGSNIADLLKPEQDQGNFTKLAEILKGKVKQVTIDNLVPLNDI
FT                   AKSSDLVNGKLTGGNLTMVQTSIGTSWQIKTKGKILFLEDVNVVPFRLDRELLHLKQAG
FT                   LLEDVKAIIFGSFGKDLDATMLVLRNFADSLDIPVFKTNRFGHEKINDPIIYNTNSKII
FT                   KSKEFKLVMGV"
FT   repeat_region   540694..540715
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(540719..540743)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   540760..540790
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(540798..543314)
FT                   /locus_tag="RC0550"
FT   CDS_pept        complement(540798..543314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0550"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03088"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I70"
FT                   /protein_id="AAL03088.1"
FT                   /translation="MTADYSFLKSFAEYIIDKLGKDTKVQIILPNNFSCLELKKILTDK
FT                   YKIKLPIIIPFNSLISKKIDSDYISKIEELLILSSIITEYKELPLNKNESLKAAELLRK
FT                   LFNDLIINNIDIKLIEVYNNSNYWQKIYKFLEYCFLRWQEEISFTQKQTKAVYKLKLLQ
FT                   EEIIKIKTGHKQVILAGIFKPNVFFKRFEEELKDYIIHYNPASKQISDGISYYEPNDIY
FT                   EETKQISYICSRNKDRRIAIVTNNNKLKRVYCNFLDKYEDLLGNDLRLTNIGELLTSII
FT                   KILCNNFDLKLLFLLLKNPLINCPTVQQLELMLSNKNRFISSPKYLLQLQFDNEDIREY
FT                   CRNLIDILFTDTPHNIQAILTLTKEITEKLLPTIWEKEGGAELLEFLTNLTAYSKYINS
FT                   TDKKDFPKIFSFLLSNIKYYKNTDAASIIIGRPEDLALCEFDLIILPHFNNENWTLSAK
FT                   AHPWLSKQALQILNIDYDEIAPTLYSDYFNLFLQNKQIVILNAKKYDGKLSVPSNLFLK
FT                   LEKGSVSPRDLITGSSNYMDTVVKPRYDKSIEIHSPSFPTTLSVTEIETLIKNPYGFYA
FT                   KKILGLRKKDHIWEEPKISDFGNLIHKVLEEYSKNYDKQYINLNLLDKQNALINIGNHI
FT                   LYSTILPSYTKKTWQIKLTAFSKAFILFDIERRKNCKEIYFETKGELRLNIVGQDIKII
FT                   GIADRIEISKSNNITILDYKTGTIPTKKEIELGLSPQLIIESLMLLENGFTKCNSLSLL
FT                   CHPQPLLCYSRESRNPVINNNITIAYVKITSTEPYVHTTEITLSIETLNRHKAGLVKLL
FT                   EHYITNQFFSYDLNLSKYNDYLHLSR"
FT   repeat_region   541006..541030
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(541679..541708)
FT                   /note="REP03, repeated element"
FT   gene            543464..543862
FT                   /locus_tag="RC0551"
FT   CDS_pept        543464..543862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0551"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03089"
FT                   /db_xref="GOA:Q92I69"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I69"
FT                   /protein_id="AAL03089.1"
FT                   /translation="MKIFIILFTIIVSIISRAYANNLNSHIAYCDNIQVEQQEDLVIQK
FT                   LVKLFVTEMNCIISGCLQQWDEDNRVKYSIAWQEQCGPVIYGQYQLEGNGRGSTFVYER
FT                   SKNSVCCWPFGYEYNKAFVICSSNDVKN"
FT   gene            complement(543866..544594)
FT                   /locus_tag="RC0552"
FT   CDS_pept        complement(543866..544594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0552"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03090"
FT                   /db_xref="GOA:Q92I68"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I68"
FT                   /protein_id="AAL03090.1"
FT                   /translation="MYKKPIIGVTPDLAQNCEKYTYAAFPWYALRRNYTDAIIAAGGVP
FT                   LLLPYQSDTINQLMELVDGVVMPGGDEDIHPKFYEPEYAEDIVVSNEERDNFEILVLKK
FT                   ALERDIPVLGICRGMQLLNVIFKGTLIKHIPDYIETVINHTQPSPKNIVSHAINIEANT
FT                   KLAKIANNQLQTMVNSTHHQAAKQLGNDLIVSATAEDGIIEAIESTKHKFVIGVQWHPE
FT                   YLNDNGVDLELFKEFVKVSK"
FT   gene            complement(544803..546401)
FT                   /gene="coxA"
FT                   /locus_tag="RC0553"
FT   CDS_pept        complement(544803..546401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="RC0553"
FT                   /product="cytochrome c oxidase polypeptide I"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03091"
FT                   /db_xref="GOA:Q92I67"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I67"
FT                   /protein_id="AAL03091.1"
FT                   /translation="MDITTTEIYHDGHHTPHGWRRWLFSTNHKDIGIMYIIFAVFAGIV
FT                   GGLFSLLFRLELAMPGGTFLNHDFQLYNVLITAHAVIMVFFMIMPALFGGFGNYFVPLL
FT                   IGAPDMAFPRLNNISFWLLVPAFLLLMGSAFVDGGPGTGWTLYPPLSNLSGHPGAAVDM
FT                   AIFSLHLTGLSSILGSINLIVTIFNMRAPGMGLFKMPLFVWSILVTAFLIILAMPVLGG
FT                   AITMLLTDRNFGTTFFKPDGGGDPVLFQHLFWFFGHPEVYIVILPGFGIVSQVISTFSR
FT                   KPIFGYQGMIGAMVIIGFVGFIVWAHHMFTVGLSYNALIYFTAGTMIIAVPTGIKIFSW
FT                   IATMWGGSITFPTPMLFSIGFIILFTIGGVTGIILSNSALDRVLHDTYYVVAHFHYTMS
FT                   LGALFTAFAGFYYWFGKISGKQYPDILGKIHFWITFIGVNLTFFPQHFLGLAGMPRRIP
FT                   DYPEAFAGWNMVSSIGAGISMFAALYFVFIVFYTLKYGKDCPNNPWGEGADTLEWTLTS
FT                   PPPFHTFETPPHIEG"
FT   gene            complement(546407..546790)
FT                   /locus_tag="RC0554"
FT   CDS_pept        complement(546407..546790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0554"
FT                   /product="acetyltransferase-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03092"
FT                   /db_xref="GOA:Q92I66"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I66"
FT                   /protein_id="AAL03092.1"
FT                   /translation="MTNHNNPYPHLFPKQAKETIFLKHFIHNLNIIVGNYTYYNDANHP
FT                   EKFEYENVRGAYFAKLIIGKFCAIAMGTSIVLLSVILQRYRFPDEIVEQLLEIQWWDWD
FT                   YDKITRNIPAIVETDIEQLKQAE"
FT   gene            complement(546983..547930)
FT                   /gene="coxB"
FT                   /locus_tag="RC0555"
FT   CDS_pept        complement(546983..547930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="RC0555"
FT                   /product="cytochrome c oxidase polypeptide II"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03093"
FT                   /db_xref="GOA:Q92I65"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I65"
FT                   /protein_id="AAL03093.1"
FT                   /translation="MKNIIRHFSKPAYREEFKEDTSPRTAEYKSVSEDSSTGLTYTLPP
FT                   KAKFGKMSIALICFLIVSCNCFASEPLPWQVTFQPPASPIMEELHHFHNFLLYISTAIV
FT                   LFVAGLLGFVCIRFNAKNNPVPAKFSHNVLIEIIWTVIPIIILVIIAVPSFKILRHAEK
FT                   IPKTDLTIKVVGYQWYWHYIYPDHDNLEFDSVMISDENLKPNHKRLLDVDNRIVIPENA
FT                   TVRFLITAGDVIHSFAVPSLGFKIDAVPGRINETWTRVAKKGVYYGQCSELCGIHHGFM
FT                   PIAIEVVSKEDFDNWIASKNKTAMNGKKPKLVAN"
FT   repeat_region   complement(547772..547915)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(548101..548403)
FT                   /locus_tag="RC0556"
FT   CDS_pept        complement(548101..548403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0556"
FT                   /product="glycerol-3-phosphate cytidyltransferase
FT                   (tagD)-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03094"
FT                   /db_xref="GOA:Q92I64"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I64"
FT                   /protein_id="AAL03094.1"
FT                   /translation="MIYLHYGHIEFLRKTKKHGKYLIVALEPDETIIKYKKRQPIHNQL
FT                   QRAKILSSFTFVDKVLILPKLQDFNDYARLVQNICPSVIAVTKHDPQLINKFKQN"
FT   gene            548691..550121
FT                   /locus_tag="RC0557"
FT   CDS_pept        548691..550121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0557"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03095"
FT                   /db_xref="GOA:Q92I63"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I63"
FT                   /protein_id="AAL03095.1"
FT                   /translation="MYIVHIITSNEKLIQIIFRAILMNDTALSYDFNGILPSSFISARL
FT                   RKILTSASLLLFIGLVIFVSFAVNNYVNNTLSITLVQPDSSEEETISFKEVVVKKGDTI
FT                   KSILIEQHIPKNEIDKIVSLIKEGKLSSALKIGQQITFEYETKIIENEDEDLTSEVAFL
FT                   NKIVIIIDKLKTIEVIREGDNFKVEEIVVPLSKKVAKSSVSIEANFMSALKKLGLSDNS
FT                   IIELINAYAYQIDFQRQIKRGDTATVITEKYVTEDGKFSHHGKILYVSLNLSGKEYNIY
FT                   RYSHDNNANNHAFFSEDGKSVKRSLLKTPLKVIKVSSHYGNRKHPILGYTKMHRGVDFA
FT                   APTGTPIYSAGNGVITEIGWKSGYGKFIQVKHSGTLSTAYAHASNFAKNLKVGSIVKQG
FT                   QIIAYVGSTGRATAPHLHYEVKIDGKHVNPMSVKTTPGIELNGKNLEKFKQFKKEIKTL
FT                   SVKLDKELQADKAATVSL"
FT   repeat_region   complement(550169..550306)
FT                   /note="REP02, RS3-like repeat"
FT   gene            550300..550920
FT                   /gene="lspA"
FT                   /locus_tag="RC0558"
FT   CDS_pept        550300..550920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="RC0558"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03096"
FT                   /db_xref="GOA:Q92I62"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I62"
FT                   /protein_id="AAL03096.1"
FT                   /translation="MTFTIMLPLLKKLYLTFARSSRIIITLVIIDQLSKWWFIDNLRWK
FT                   SGLMLKVTSFLNMVYTWNYGISFGLMREYYQYSNAIFLITNTIIVCYLYYLMIRSKTIG
FT                   SFAGYSFVIGGAVGNLIDRFFRGAVFDFIHFHYQNYSFPVFNLADCFIIIGVIILIEDY
FT                   YSTKKVIEEKAKGNYDNAQIEAMAEKIRNTDKGGNDKIASLQN"
FT   repeat_region   550902..551044
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            551073..551321
FT                   /locus_tag="RC0559"
FT   CDS_pept        551073..551321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0559"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03097"
FT                   /db_xref="GOA:Q92I61"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I61"
FT                   /protein_id="AAL03097.1"
FT                   /translation="MKKIFVLFTVLLITSACSKKLKETVGISTVGPNEYQVQRAKALEV
FT                   PPHYYLPDPGHSKTTYSNVKGQGEFNEGEQALMQDMH"
FT   repeat_region   complement(551322..551446)
FT                   /note="REP04, repeated element"
FT   gene            551492..552994
FT                   /gene="murD"
FT                   /locus_tag="RC0560"
FT   CDS_pept        551492..552994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="RC0560"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03098"
FT                   /db_xref="GOA:Q92I60"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I60"
FT                   /protein_id="AAL03098.1"
FT                   /translation="MNSHTKQKIGVFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFE
FT                   ELYSKTAIAALSDSRWQNLDTIVLSPGIPLTHEIVNIAKSFNIPITSDIDLLFAKSKNL
FT                   KFIAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAKASKDGYVLELSSFQLD
FT                   LVKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVF
FT                   IKLQQEQRIKLIPFSVAQILENGISVVDDKISANFCDDISFELQHNSESFRQDEFQGEP
FT                   AEPECIKIREHRQDLQNSLVSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKK
FT                   ILESISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEG
FT                   GIEEIKPYFSHIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEI
FT                   KNILLAPSCSSYDQFKNFEERGELFIKLCSILSLRGLITGSS"
FT   repeat_region   552287..552408
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   repeat_region   552960..553054
FT                   /note="REP03, repeated element"
FT   gene            553111..554259
FT                   /gene="ftsW"
FT                   /locus_tag="RC0561"
FT   CDS_pept        553111..554259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="RC0561"
FT                   /product="cell division protein ftsW"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03099"
FT                   /db_xref="GOA:Q92I59"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I59"
FT                   /protein_id="AAL03099.1"
FT                   /translation="MNNYNMHNEISNNFIKLWWRSTDRQIIISLIILFAFSLMLVTTSG
FT                   SAVASRIGLEESYFASRQMFYLAAASGLILLFSCLNKKWLRRFAIVGFIASIVLLIAVK
FT                   FFGYEVKGAVRWINILGLSIQPSEFIKPFFAVVTGWILSLKFNDDFPSFTICVILYSIV
FT                   AILLMIQPDFGMLVMITAVFGIQLFIAGMPIFWIVLAGFLGMIGVTIAYFWLPHVTQRI
FT                   NSFLDPDSSENYQVSKSLKAFEHGGLYGRGPGEGAVKQVLPDSHTDFIFAVAGEEFGAI
FT                   ICLIVIGIFAFIVLRSLIKLLNETDKFVQFAASGIIAQLGLQAIINMGVTLHLLPTKGM
FT                   TLPFISYGGSSTLAIAIATGMLLGFTRYRTPLNSYKIRNIEI"
FT   gene            554256..555386
FT                   /gene="murG"
FT                   /locus_tag="RC0562"
FT   CDS_pept        554256..555386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="RC0562"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03100"
FT                   /db_xref="GOA:Q92I58"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I58"
FT                   /protein_id="AAL03100.1"
FT                   /translation="MKKIILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIK
FT                   QDMKVIFHILDLKRSGNIFLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAA
FT                   IFLRVPIIIHEQNSYLGKVNKFFASFAKKIAISYAKIKNLPEFAKSKIVVTGGVVRENI
FT                   RELKVIEMSSRGLTTGSKKSLIKALDSVVKPRNDKLFTIFIFGGSQGAKLFSELIPASI
FT                   QILMQKQPSLELNIIQQAALDDQVKIKDIYSKLNITYAFAEFFDNMALQYKEADLVISR
FT                   AGASTIEELTYIGLPAIFIPLPSAADNHQYYNAQLLEDEKTGWCLEQNNISAGKLADKI
FT                   LELISNPKILEDASQNLLKRRKEGHKLLSNLIEEVI"
FT   repeat_region   complement(555398..555430)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(555431..555462)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(555609..555752)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            555781..556431
FT                   /locus_tag="RC0563"
FT   CDS_pept        555781..556431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0563"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03101"
FT                   /db_xref="GOA:Q92I57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I57"
FT                   /protein_id="AAL03101.1"
FT                   /translation="MLKKIIILFLGMFLLSACTDNFRSYFQRSANNRLVDSKGAKGGKR
FT                   KPVYNNKYITLAKKNIVEDNLDDDNDDDYDSDSPLRGERIDPVKRNREMYLKMIKRDIA
FT                   RQKAEAGFAESDDDMTLSRANKKVRKDDSDKEKKIQEELNQIKAMLRETKRDISKYTCP
FT                   NAVVNQNYAPPVTNYEPVNYPPVKNSKPYNNNSKVKQKFILEDDDNGSNACSI"
FT   repeat_region   557110..557183
FT                   /note="REP03, repeated element"
FT   gene            complement(557289..557483)
FT                   /locus_tag="RC0564"
FT   CDS_pept        complement(557289..557483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0564"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03102"
FT                   /db_xref="GOA:Q92I56"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I56"
FT                   /protein_id="AAL03102.1"
FT                   /translation="MYFRPIMMTTLAALIRTMPIALGVGATRTERRSLGPAVVGGLLTH
FT                   CNYLLFIHHTDNLPIFRNS"
FT   gene            complement(557487..558206)
FT                   /locus_tag="RC0565"
FT   CDS_pept        complement(557487..558206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0565"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03103"
FT                   /db_xref="GOA:Q92I55"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I55"
FT                   /protein_id="AAL03103.1"
FT                   /translation="MQIDRYKAAKLGILVEHVQNILYAAYGAEQISTLYTPTAQYDVIL
FT                   ELDPKYQTDSSMLSLVNINSTSGNLVTLTTLAKIVNTVGPLSISHFGQLPSVMVSFNLQ
FT                   DGYSISDAVPKVNQAIRELQMLTTITGSFQDTVQACQPSFSDLGLLLGLAVIVIYIILG
FT                   MLYESFVHPITILLGLPTAILGALLALLIFNSELDMYGFVGLIMLIGIVKKNAIMIIDF
FT                   ALELERTGNKSSACSNL"
FT   gene            complement(558213..558677)
FT                   /locus_tag="RC0566"
FT   CDS_pept        complement(558213..558677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0566"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03104"
FT                   /db_xref="GOA:Q92I54"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I54"
FT                   /protein_id="AAL03104.1"
FT                   /translation="MPYSYTGQILVFTDAAQTISFDAMVQEQQQVSDVLLKNPNIDSFF
FT                   SAVGVSGRNSAVNQGTILISLKPRDQRIGADAVIDQLRSKLNHLVGLRVYIQNVPTITI
FT                   DGPATKSQYQYTMQELDQDVLFSFAPKLKDKLARLPGFINVTSDLQIAQP"
FT   gene            complement(558725..559237)
FT                   /locus_tag="RC0567"
FT   CDS_pept        complement(558725..559237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0567"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03105"
FT                   /db_xref="GOA:Q92I53"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I53"
FT                   /protein_id="AAL03105.1"
FT                   /translation="MSLMALTLAMSFVVDDAIVVLENITRHMGKGESKIAGCINGTKEI
FT                   GFTIVSRTLSLMTIFITILFMSGILGKLLHELAIVITTSILLSGVISITVTPMLCNVFL
FT                   RDRHCEERSDEALSGQPTEIATAPLTPRNNDLPLTEKAFEYVKQKYGSSLTTVVEHSKT
FT                   TMLIFFS"
FT   gene            complement(559429..559938)
FT                   /locus_tag="RC0568"
FT   CDS_pept        complement(559429..559938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0568"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03106"
FT                   /db_xref="GOA:Q92I52"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I52"
FT                   /protein_id="AAL03106.1"
FT                   /translation="MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNN
FT                   IGLDQVSNIISSANVNLPTGALYGTDIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLK
FT                   NIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTNTIEIVDSIKEVLPLLRRQIPEGI
FT                   NINIMF"
FT   gene            complement(560007..560225)
FT                   /locus_tag="RC0569"
FT   CDS_pept        complement(560007..560225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0569"
FT                   /product="probable RND efflux transporter-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03107"
FT                   /db_xref="GOA:Q92I51"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I51"
FT                   /protein_id="AAL03107.1"
FT                   /translation="MPGADPTTMASSVALPLEKQCSTISDIDSMSSVNSNGTTQITLQF
FT                   NLDRNIDAAAQDIQATTERLTYPALIL"
FT   repeat_region   560441..560516
FT                   /note="REP01, repeated element"
FT   gene            complement(560770..561066)
FT                   /locus_tag="RC0570"
FT   CDS_pept        complement(560770..561066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0570"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03108"
FT                   /db_xref="GOA:Q92I50"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I50"
FT                   /protein_id="AAL03108.1"
FT                   /translation="MDIGDLVSPDFVRLVTINTSSPIYVSFSVPEKYLDRINKSQKSNH
FT                   LALTVRTISDQEIKDGEIVFVDRLIQIAALSKLKQHYLTKTKYYGRNSVFVYP"
FT   gene            complement(561354..561572)
FT                   /locus_tag="RC0571"
FT   CDS_pept        complement(561354..561572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0571"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03109"
FT                   /db_xref="GOA:Q92I49"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I49"
FT                   /protein_id="AAL03109.1"
FT                   /translation="MVWVIKHHNKSSKQITIAAPVEVTQVIRKDLSDVIELAGVAETDQ
FT                   SADIQSQVTGQILSVNFDDGQEVKTGD"
FT   gene            complement(561639..562016)
FT                   /locus_tag="RC0572"
FT   CDS_pept        complement(561639..562016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0572"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03110"
FT                   /db_xref="GOA:Q92I48"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I48"
FT                   /protein_id="AAL03110.1"
FT                   /translation="MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPV
FT                   LPKILPSELLEQRPDIKAAEQNLLAADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFT
FT                   NSAETWQVDGNIAGPIFDFGK"
FT   gene            complement(562286..562528)
FT                   /locus_tag="RC0573"
FT   CDS_pept        complement(562286..562528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0573"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03111"
FT                   /db_xref="GOA:Q92I47"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I47"
FT                   /protein_id="AAL03111.1"
FT                   /translation="MLNNLIEESLTGNSDIELAMSNVLAAQAQLNLTNAYRFPQINLQG
FT                   GANQTKNSKETKAPNEPKFSNNLGLASVLNYELDL"
FT   gene            complement(562547..562726)
FT                   /locus_tag="RC0574"
FT   CDS_pept        complement(562547..562726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0574"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03112"
FT                   /db_xref="GOA:Q92I46"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I46"
FT                   /protein_id="AAL03112.1"
FT                   /translation="MNFIYRFCIYLKYILVLSISSFLLCGCNAKHDNIPPKLSLPTTWN
FT                   NYSLEQNNNVSSKW"
FT   repeat_region   complement(562896..562971)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   gene            complement(562945..563961)
FT                   /gene="capM2"
FT                   /locus_tag="RC0575"
FT   CDS_pept        complement(562945..563961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capM2"
FT                   /locus_tag="RC0575"
FT                   /product="capM protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03113"
FT                   /db_xref="GOA:Q92I45"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I45"
FT                   /protein_id="AAL03113.1"
FT                   /translation="MKILNIMLSRDLGGIQQAFLDYSTALEMQKIEIINITSYKAKINS
FT                   FLHKQSLKLPNIVPFDLLSVLIFKYIIHKTKPDIIIAHGNRAINFSKFAKSQNIKLIGI
FT                   AHNYSLKGLRKCDFVIALTHHMKEFLLKNHFAESRICILPNMINIAKDFIPNKTYRKPV
FT                   VIGVLARFVAKKGVDVFIKAIKILKEKKYDLHAVIGGSGEEKDNLIALAHKLNLQDQIS
FT                   FTGWVNDRDKFFKQIDIFCLPSLHEPFGIIVLEAMEASMPIVSTDTEGPTAILNDMQDG
FT                   LICKAGSAEDLAAKIVYLIENPIKAKEFSKNAYLTLKQNYEIKVVSEKLQHILESFR"
FT   gene            complement(563961..564245)
FT                   /locus_tag="RC0576"
FT   CDS_pept        complement(563961..564245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0576"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03114"
FT                   /db_xref="GOA:Q92I44"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I44"
FT                   /protein_id="AAL03114.1"
FT                   /translation="MIGHDFIIKKAFYALDQASWSEKELNTYEKMIKTEMDNLAVKEQK
FT                   IIDAEAKGEARGEAKQKISIAKKMLAKNKPLDKIIDFTGLTEKEIEQLK"
FT   gene            complement(564242..564517)
FT                   /locus_tag="RC0577"
FT   CDS_pept        complement(564242..564517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0577"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03115"
FT                   /db_xref="GOA:Q92I43"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I43"
FT                   /protein_id="AAL03115.1"
FT                   /translation="MKIIKKMAVYAKLRGVIFLAIADFILLPDKKDWRSNHRLLDTKTY
FT                   ENDLQDFYFIFLELEKFNKELDQLENLQKNGHSFFKHAHESTLEGI"
FT   gene            complement(564650..564844)
FT                   /locus_tag="RC0578"
FT   CDS_pept        complement(564650..564844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0578"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03116"
FT                   /db_xref="GOA:Q92I42"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I42"
FT                   /protein_id="AAL03116.1"
FT                   /translation="MLISRFLDPKNNYAFLKIFGTEKNKDILIHFLNNILGYTGKEIIT
FT                   EVTFLKKSKVPTSLLIDNL"
FT   gene            564933..565745
FT                   /gene="dapF"
FT                   /locus_tag="RC0579"
FT   CDS_pept        564933..565745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="RC0579"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03117"
FT                   /db_xref="GOA:Q92I41"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I41"
FT                   /protein_id="AAL03117.1"
FT                   /translation="MISKINFVKMHGLGNDFVIVNKRDLSSSYDLSQLAKNMAERHTGI
FT                   GCDQFIIYEEHNDFYEMIIYNIDGSSAKLCGNATRCLAKLIYLDTGKQDITVMVGNKKL
FT                   LCNVNDENNISVNVGSVSFNEAWMPSRDKVWEFAERYMIDLKETICVDIGNPHVVIFSK
FT                   LEPQDQKIVGERLQAKELFADGVNVNFAEVKDNKIYLSVWERGAGLTLACGSGACGSFA
FT                   AGLKRGFIHSPSTIVFKHGNLTMKEENGNIIMQGAATLVARGEYYCEQ"
FT   gene            565720..566985
FT                   /locus_tag="RC0580"
FT   CDS_pept        565720..566985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0580"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03118"
FT                   /db_xref="GOA:Q92I40"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I40"
FT                   /protein_id="AAL03118.1"
FT                   /translation="MGNIIVSNNLRQNVVTFGCRLNIYESEIIRKNLELSGIDNVAIFN
FT                   TCAVTKAAEKQARQAIRRAKKNNPDLKIIVTGCSAQTSPQMYGNMPEVDKVIGNEEKLL
FT                   PNYYQITDAKITVNDIMSVKETASHLVSSFDCKSRAFIQVQNGCDHFCTFCIIPYGRGK
FT                   SRSVAIGAIAEQVKHLVLNGFKEVVFTGVDVTAYGSDLPGSPTFAQMIKRVLNLVPELK
FT                   RLRLSSIDVAEIDDELFELIAYSERIMPHFHISLQAGDDMILKRMKRRHNRANVIEFCR
FT                   KLRAIRPEVSFGADIIAGFPTETPEMFENTRKLISEAELQYLHVFPYSEREGTPAARMP
FT                   QVPKNIRKERAAILRQEGQNQLTEFFKKHIGQKVELLVENNNIAHTENFIPVKLDKPLE
FT                   IGQIFKAKLVAIEENYMKCMLV"
FT   repeat_region   567080..567100
FT                   /note="REP01, repeated element"
FT   repeat_region   567105..567144
FT                   /note="REP01, repeated element"
FT   gene            567226..568275
FT                   /gene="pheS"
FT                   /locus_tag="RC0581"
FT   CDS_pept        567226..568275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="RC0581"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03119"
FT                   /db_xref="GOA:Q92I39"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I39"
FT                   /protein_id="AAL03119.1"
FT                   /translation="MENIETILRLAEDKILLVQNLKALQEYKVEFLGKNGIVTGELKKL
FT                   GSLNEQERKEFGLKINKLKDKIQNIIKAKAEILEEQELNFKLAADKIDLTIPARRYKQG
FT                   SIHPITQCSEELIQVFSQFGFTIENGPNIENDFHNFTALNFEDDHPARQMHDTFYLKSQ
FT                   ENNKPLLLRTHTSTVQIRAMKNGKPPFRFIAPGRTYRSDSDMTHTPMFHQIEGLVMDKN
FT                   INMGHLKYVITTFIKSFFENSNIELRFRPSFFPFTEPSAEVDIRMNKNDKWLEVLGCGM
FT                   VHPNVLKNVGIDSSEYQGFAFGLGVERFAMLKYNIKDLRQFFEGDMRWLKHYNFGSFDI
FT                   PNLAGGLTK"
FT   gene            568272..570728
FT                   /gene="pheT"
FT                   /locus_tag="RC0582"
FT   CDS_pept        568272..570728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="RC0582"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03120"
FT                   /db_xref="GOA:Q92I38"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I38"
FT                   /protein_id="AAL03120.1"
FT                   /translation="MKFTLSWLKQFLETSASVTEIAEALTAIGLEVEEVIDKAAELQKF
FT                   EVAYITNIKPHPSADKLKLCDVETKSGMLQIVCGARNARAGIKVVLANIGIEIPNGKFK
FT                   IKESVIRGEKSCGMLCSEEELLLASESEGIIELSEDAVVGENFTKYYGLDDPIFVINVT
FT                   PNRGDALGVYGIARDLAAKGIGILKELEISVIKSTFISKMKLNVQDKEACPLFTFREIR
FT                   NLKNKPSPDWLRKLLKNVGVKTISSLVDVTNYISYSFGQPMHAYDADRIKGGITVARHC
FT                   EKHSDEAISGQQNEIATAALQPRNDVAKCHALNGKEYLLTENDLVIKDESGIQGLAGVI
FT                   GEADSSCTDSTTNIILEAACFNAKMVAASGRRFQIDTDARYRNERNIDRNFTEKALDIA
FT                   TNLILSICGNGEVSEVVKVGEKESQKKPLDFSACYLEKITGIKLNIKAIEAILNKLGFI
FT                   TDVKGEIIKVIAPSWRHDITILEDIAEEIARIYGYDKIESIKLPELDQDNNKLREHKRI
FT                   SSFKRILASKGYDEVVTNSFMSSEDAKLFAELKEELFLLNPISIGDNYMRPTILPNLLS
FT                   IVSKNLARSIKDMAFFEVGPSFIDLNTEATYLTAIISGSYNNKNPHSFGRGYDVFDLKG
FT                   DLELVADYAGLSIDKCIATNGTALPQYYHPTRAVNIGLGKNLLGHFGQIHPKILKYYDI
FT                   NQEIFAFELNITNLPLIKAKFGKRDEFAVSDFQANFRDYAFIVGQDHRVGEIISYINNF
FT                   NKKLIKSVILFDIYSGDKLPEGKKSIAVKIELQADDRTLSDTDLNSFSKDLVAAISQKF
FT                   QGTLRE"
FT   gene            570733..571872
FT                   /gene="dnaN"
FT                   /locus_tag="RC0583"
FT   CDS_pept        570733..571872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RC0583"
FT                   /product="DNA polymerase III beta chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03121"
FT                   /db_xref="GOA:Q92I37"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:5W7Z"
FT                   /db_xref="PDB:6DM6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I37"
FT                   /protein_id="AAL03121.1"
FT                   /translation="MLKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLEL
FT                   SSTNMDLYLSQKIAVQVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNC
FT                   KFNLFTLPVSSFPAMDSINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIK
FT                   DKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLS
FT                   SNKIKFICNENTSMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIITVEK
FT                   FRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDV
FT                   LKAVKSDVVELYFSDVSAPVLIKFPENPKDIFVVMPVKV"
FT   gene            572227..572736
FT                   /locus_tag="RC0584"
FT   CDS_pept        572227..572736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0584"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03122"
FT                   /db_xref="GOA:Q92I36"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I36"
FT                   /protein_id="AAL03122.1"
FT                   /translation="MVMKKIIGLFVVIILSAISTSILAGDYPKTEREQKWDEVGSIAGE
FT                   EGLVFRPGRVKNESTKAVGGSVNKYLWQAALETISVAPLASADSNGGVIITEWYSPRSN
FT                   PNFRFKINIFIKDDVISPDSIEVKVFEEMLKNKQWVLNENTSNLAITLEDKILRKAREI
FT                   YINSVR"
FT   repeat_region   complement(572750..572839)
FT                   /note="REP01, repeated element"
FT   gene            572865..575372
FT                   /gene="leuS"
FT                   /locus_tag="RC0585"
FT   CDS_pept        572865..575372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="RC0585"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03123"
FT                   /db_xref="GOA:Q92I35"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I35"
FT                   /protein_id="AAL03123.1"
FT                   /translation="MNQIEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVG
FT                   HVRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAIKNNSHPKKWTYSNIKNMKK
FT                   QLKSMGFSYDWSREINSCDPEYYKHEQKFFLELYERNLAYQKESFVNWDPVDNTVLANE
FT                   QVVDGRGWRSGAIVVKRYLKQWFLKITDYAEELLNEIQNLKEWPEAVRSMQEKWIGKSI
FT                   GANFHFKIKDNEETTIEVFSTKPETIFGASFIGIAFNHPIIERLVSKTPEILAFITQCS
FT                   HITRSSELEKAEKEGVFTGLFVTHPFDSNIVLPVIITNFVLMDYGTGAIFGCPAHDECD
FT                   HELAVKMNLSIKQVIKADMDVQKTAYTEDGILINSDFLNGLTSNEAKQEVIGEFEKLGI
FT                   GKRSVNYRLKDWGISRQRFWGCPIPMIHCEICGIVPVPYKDLPVTLPDDVNFDGHGNPL
FT                   DHHPSWKHVNCPKCDKPAVRETDTFDTFFESSWYFTRYCNSNATEMTDKKACDYWLPVD
FT                   KYIGGIEHAVMHLLYARFFTKVMNEQNYVSVREPFKGLFTQGMVLHATYKDEHNNWLYP
FT                   EEVVKKGNEFFHKESNNRVVQGRIEKMSKSKKNLIDLETMQEQYGADAIRLFVLSDSPP
FT                   EKDLEWSASGIEGCSRFINKLEYMFKAIDSLKDDVNSEVNKELNRLVHFTIKHVAEDIK
FT                   HFALNRAIARMRELSNAISAEISKDKIDVKTVRHGFNVLVQLLNPFIPHITEEIWQKLG
FT                   NKERLYNLSFPAFDESMLELDTYIMAVQVNGKLRDTYEFKTSVSEDEIKQVTVSLPKVQ
FT                   KFLEGKEPKKIILVPRKIVNILV"
FT   repeat_region   complement(575360..575478)
FT                   /note="REP04, repeated element"
FT   repeat_region   575526..575625
FT                   /note="REP03, repeated element"
FT   gene            complement(575890..576048)
FT                   /locus_tag="RC0586"
FT   CDS_pept        complement(575890..576048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0586"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03124"
FT                   /db_xref="GOA:Q92I34"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I34"
FT                   /protein_id="AAL03124.1"
FT                   /translation="MTNRKKIDVLDSESDLNLSLDSIANLCYPRIITCETEEDTLSIDG
FT                   GVFAAFW"
FT   repeat_region   complement(576078..576225)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(576312..576923)
FT                   /gene="rnd2"
FT                   /locus_tag="RC0587"
FT   CDS_pept        complement(576312..576923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd2"
FT                   /locus_tag="RC0587"
FT                   /product="ribonuclease D"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03125"
FT                   /db_xref="GOA:Q92I33"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I33"
FT                   /protein_id="AAL03125.1"
FT                   /translation="MTIKIYQNDLPNNFKLEGDLAIDTETMGLNLHRDKLCLLQFSNGN
FT                   GEAHLVHFTNQDYTAPNVKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISS
FT                   KLVRTYTDSHGLKDLCRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDI
FT                   LQKMLLKENRYELAQDIFRFLPIRANLDLIGWNEIDIFMH"
FT   repeat_region   complement(576984..577018)
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(577031..577058)
FT                   /note="REP03, repeated element"
FT   gene            complement(577074..577379)
FT                   /locus_tag="RC0588"
FT   CDS_pept        complement(577074..577379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0588"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03126"
FT                   /db_xref="GOA:Q92I32"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I32"
FT                   /protein_id="AAL03126.1"
FT                   /translation="MIIHLNNHAKKIILNIVLALLLGYFVFHCIYGNKGIIAYLKVNRQ
FT                   LEKAYDELKGLRAERVELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFNHQ"
FT   gene            complement(577376..578068)
FT                   /gene="cdsA"
FT                   /locus_tag="RC0589"
FT   CDS_pept        complement(577376..578068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="RC0589"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03127"
FT                   /db_xref="GOA:Q92I31"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I31"
FT                   /protein_id="AAL03127.1"
FT                   /translation="MITQKGKEHLVKDKQKSNIYLRILSGIVLVPLFVIAILWCKPLFY
FT                   ILMILVGTGMLSEWYNMTYSSIPDLLIGLIIIPIPISLLIFLSMEDTNRWLIMLYFCIM
FT                   WSVDTFAMIGGKTFKGAKLAPKLSPKKTWSGLVTGVLSAGLVAVLVSFIPNFHIENYYF
FT                   SNKIYLFIISCILALIAQLSDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTTLI
FT                   LFLMKIYL"
FT   gene            complement(578028..578735)
FT                   /locus_tag="RC0590"
FT   CDS_pept        complement(578028..578735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0590"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03128"
FT                   /db_xref="GOA:Q92I30"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I30"
FT                   /protein_id="AAL03128.1"
FT                   /translation="MQQHLKYKIMTNIKHLAIIMDGNARWADQHNLTKSEGHKAGADKI
FT                   RELLPEFLNLNIPYITLYTFSSENWQRSSTEVDFLIKLLSIYLKTELNNLHKNGVKIKV
FT                   IGRLTLLSSSLQKQINNAIELTKNNNKITLCIAFSYGSRQEIVDACTKIITSGKKAVSD
FT                   SDIQHALYDPEMPDVDLLIRPGGVYRISNFLLWQAAYAELYFSPKYWPDFNKYDIQEAI
FT                   NDYSKRKRTFGKR"
FT   gene            complement(578713..578874)
FT                   /locus_tag="RC0591"
FT   CDS_pept        complement(578713..578874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0591"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03129"
FT                   /db_xref="GOA:Q92I29"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I29"
FT                   /protein_id="AAL03129.1"
FT                   /translation="MSFPCRCQIVITRIGKAEGVTISEILYCFMRLPHSLQSLAMTEKS
FT                   IHAATSKI"
FT   repeat_region   578751..578786
FT                   /note="REP01, repeated element"
FT   gene            complement(578881..580320)
FT                   /gene="envZ"
FT                   /locus_tag="RC0592"
FT   CDS_pept        complement(578881..580320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="RC0592"
FT                   /product="osmolarity sensor protein envZ"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03130"
FT                   /db_xref="GOA:Q92I28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I28"
FT                   /protein_id="AAL03130.1"
FT                   /translation="MRAMHFISKLLQHISKSFRQDEFKSEPTQRIKIREHRRILKNSLV
FT                   SSSLKYALPRTLFVRFMFIIIIPILIGQIVAIFLFYDRHWYNVSYYTSTIIINEIESLI
FT                   KEHRNNSRKITHLSENYLNLSYQFQLNKKLSIKQPKLGEPLTIFKNILATKIHEKNIVK
FT                   LNKENKIEVFLELKDGVLYITFPAKLLLNPTVYIFVLWIISLTVILLSVSIIFSKNQIK
FT                   SILTLADSMDKFGRGVLKGKNFKPSGALEIRKAGLAFLKMKARIEKQITKKTTMLAMIS
FT                   HDLRTPLTRMKLQLELMEESEEIEGLKQDILTMQQMINSYLDFAKGESTEEFEDILLLP
FT                   WMERFFNKWSHVNIEFIKPTNLDKLEVCIKPHSFERALSNLIGNAIKHGTKIKISSKDN
FT                   SSTVAIIIEDNGPGIDDTETHLVFKPFYRSDKARQLDNASNVGLGLAITKEIINDHKGS
FT                   IYLEDSKDLGGLSVRIEIPKI"
FT   repeat_region   complement(580172..580287)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   gene            complement(580295..580975)
FT                   /gene="ompR"
FT                   /locus_tag="RC0593"
FT   CDS_pept        complement(580295..580975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="RC0593"
FT                   /product="petR protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03131"
FT                   /db_xref="GOA:Q92I27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I27"
FT                   /protein_id="AAL03131.1"
FT                   /translation="MHTYKAHILIVDDDSRILALLKQFLNKNAFLVSTASSVIEAKNLL
FT                   KTSNYDLIILDVMLPEITGLDFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYI
FT                   TKPFEPRELLLRINNLINNYNNFTKETNIIKFGNNFYNSDTKEFTKNNQIVSLSSTEQK
FT                   LLEILIKNSGKSTSRFELSKIMGGLSMRSIDVQITRIRSKIEDNPKEPKYLKTVRNEGY
FT                   ALYI"
FT   repeat_region   complement(581014..581041)
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(581065..581090)
FT                   /note="REP03, repeated element"
FT   repeat_region   581101..581131
FT                   /note="REP02, RS3-like repeat"
FT   gene            581191..582063
FT                   /gene="ilvE"
FT                   /locus_tag="RC0594"
FT   CDS_pept        581191..582063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RC0594"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03132"
FT                   /db_xref="GOA:Q92I26"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I26"
FT                   /protein_id="AAL03132.1"
FT                   /translation="MTMVKLEQIFWHVWINGDLVPYQFARIHVLTHSLHYSGSVFEGER
FT                   AYNGKVFKLKEHTARLIKSAEALGLKVPYNVDEIIKAHECVIKQNNIKDAYIRPLIWCG
FT                   DESLNITNQYLSTNLLIAGIPSMPRSFEKGINLHVSRWRKAMPDSTPVQSKSAAQYNMA
FT                   ITSKKEAKALGYEDALLLDYEGYIAECTTTNIFFVKDKILYTPIADRFLNGITRQTIIE
FT                   IAKDLGLEVKEERLKLEQIEDFTGCFVTGTAIEVQNIDSIDLGNKKIIFDDHKIADRLK
FT                   EEYRRVVRE"
FT   repeat_region   582114..582214
FT                   /note="REP01, repeated element"
FT   gene            582251..583135
FT                   /gene="dapA"
FT                   /locus_tag="RC0595"
FT   CDS_pept        582251..583135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="RC0595"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03133"
FT                   /db_xref="GOA:Q92I25"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I25"
FT                   /protein_id="AAL03133.1"
FT                   /translation="MHNIFKGLITALITPFKDNKLDLYALERIVKHQIKHEVDAVLIAG
FT                   STGESSSLSFEEYKLLLQTSVEIVNKCIPIISGCSSNNTTYARALAAESTKIGVDGFMA
FT                   SPPSYVKPTQHGIYKHFEALHEACNLPIMLYSAPTRSGVDFSDETILRLSKLPRILALK
FT                   DCGVDLERPLRIRATVKKDFNILTGNDEVVLAFNAQGGVGWTSVASNIVPNICKELLEK
FT                   WNKNDTKGALEIHQKLLPLYTALFVESNPIPIKYAAHYLGLCENEIRPPLTEASDSAKK
FT                   QIENIITSLSIKI"
FT   gene            583132..583590
FT                   /gene="smpB"
FT                   /locus_tag="RC0596"
FT   CDS_pept        583132..583590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="RC0596"
FT                   /product="small protein B homolog"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03134"
FT                   /db_xref="GOA:Q92I24"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I24"
FT                   /protein_id="AAL03134.1"
FT                   /translation="MTEYKKVIAQNKKALFNYFIEERLEAGIVLKGSEVRSLRQGKASI
FT                   EESHAADTRHEVFLYNCHIAEYEKANRFNHATRRPRKLLLHTKEIKKIIGRIRIKGYTL
FT                   VALSMYFNKKNKVKVELGIAKGKKLHDKRESIKEKDWKRDQSRLIRQK"
FT   repeat_region   complement(583646..583670)
FT                   /note="REP02, RS3-like repeat"
FT   gene            583721..584512
FT                   /locus_tag="RC0597"
FT   CDS_pept        583721..584512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0597"
FT                   /product="thiol:disulfide interchange protein dsbA-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03135"
FT                   /db_xref="GOA:Q92I23"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I23"
FT                   /protein_id="AAL03135.1"
FT                   /translation="MQHIIGKILVIFIVIIGVLFVFKTMKTYSTNPVSVEVKQSEDARK
FT                   CEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQENETKVNNYIKDNKLSIEDSTSFPV
FT                   IGNKDGDVTIIAFYDYNCSYCKKGDVSINELLQNDPKVKVVLRPLPILGDVSEYLARIV
FT                   LAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTESGLNATEIEEIADSNEIKDLITQN
FT                   MKIARGLRIQGVPAYIIDSKLIPGLIDFPQLLNIVKEIRGN"
FT   repeat_region   584577..584626
FT                   /note="REP01, repeated element"
FT   repeat_region   584637..584682
FT                   /note="REP01, repeated element"
FT   gene            complement(584745..585623)
FT                   /gene="sucD"
FT                   /locus_tag="RC0598"
FT   CDS_pept        complement(584745..585623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="RC0598"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03136"
FT                   /db_xref="GOA:Q92I22"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I22"
FT                   /protein_id="AAL03136.1"
FT                   /translation="MAILINKKTQVICQGFTGLQGTFHSEQAIAYGTNMVGGVTPGKGG
FT                   HTHLDLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLD
FT                   MVKVKRALVGSKTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVA
FT                   QTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFI
FT                   KQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADI
FT                   GKTMLDLLNKG"
FT   repeat_region   585661..585690
FT                   /note="REP03, repeated element"
FT   repeat_region   585709..585739
FT                   /note="REP03, repeated element"
FT   gene            complement(585799..586959)
FT                   /gene="sucC"
FT                   /locus_tag="RC0599"
FT   CDS_pept        complement(585799..586959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="RC0599"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03137"
FT                   /db_xref="GOA:Q92I21"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I21"
FT                   /protein_id="AAL03137.1"
FT                   /translation="MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVV
FT                   KAQIHAGGRGKAGGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDI
FT                   LKEYYFSIVFDRSASCITFIASTEGGIDIEAVAEKTPDKIIKFSVDPATGLQDFHMRGI
FT                   AYELGFKDNQAKQMKEIVKSVYNAFIETDATQIEINPLIVNSDGNLLALDAKITFDDNG
FT                   LFRHPNITAMRDHDEEDPLETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGA
FT                   SPANFLDVGGGADRERVKEALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIG
FT                   IKVPLVVRLAGTNVEKGEEILSNSGLAIIPAHDLADAANKIVEAIR"
FT   gene            complement(586992..587411)
FT                   /locus_tag="RC0600"
FT   CDS_pept        complement(586992..587411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0600"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03138"
FT                   /db_xref="GOA:Q92I20"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I20"
FT                   /protein_id="AAL03138.1"
FT                   /translation="MKLLVLRLSKMIGIDTNILTRTFLEDDKIQGKAAQNFLKNNITSK
FT                   IFIASYALLEFVWVLKVNKFTRQEIYETVINLIDNSGFIIGHQDIIISATEQYIKGKAD
FT                   FADYIIIAEGEVNSANKFITFDKDLVREVKNASYP"
FT   gene            complement(587368..587619)
FT                   /locus_tag="RC0601"
FT   CDS_pept        complement(587368..587619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0601"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03139"
FT                   /db_xref="GOA:Q92I19"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I19"
FT                   /protein_id="AAL03139.1"
FT                   /translation="MSKSARVVISSKQVVIPKYIRNKLGLHSGSELIINYKKNETLELL
FT                   PINKDIYSFFGKGKHKAKNGPVDVDEAISIAVIENDRN"
FT   gene            complement(587938..588246)
FT                   /locus_tag="RC0602"
FT   CDS_pept        complement(587938..588246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0602"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03140"
FT                   /db_xref="GOA:Q92I18"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I18"
FT                   /protein_id="AAL03140.1"
FT                   /translation="MSIIMLLTNTENSYGLIAKLFHWIMSIIVIVMLVVGVLMDNFLEL
FT                   PLKWQLYGIHEATGIVVLSLVIIRLLWKFYNANVLLPEDMPNWQKKPLILIYICYSF"
FT   repeat_region   complement(588315..588375)
FT                   /note="REP03, repeated element"
FT   gene            complement(588401..590431)
FT                   /locus_tag="RC0603"
FT   CDS_pept        complement(588401..590431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0603"
FT                   /product="acylamino-acid-releasing enzyme"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03141"
FT                   /db_xref="GOA:Q92I17"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I17"
FT                   /protein_id="AAL03141.1"
FT                   /translation="MSKIFYIIGTILIISVGIFMFQTITDNNQIIPRKVLFGNPDKARV
FT                   SLTHDGKYILYVAPKDGVLNIWLAPSDDISKAEAITHDKGRGIWSYAKAYNNKNILYTQ
FT                   DFNGDENDRIYSYNIETKETKLLTPAKGVKAQIAGASHKKPNEILIYLNERNPEYFDIY
FT                   KLNLDTLEKELIYKNDRFTDYITDENLNLRFGSLLDKDGAVEYYELKDGEPKLFTKISM
FT                   EDSFNTSILGFDASGETLYMLEGRNRNTSALKAITLATGSEEILAEDAKADIGLFTVHP
FT                   TKQTPQAVSIDYDRVSYKILDKDIEDDIKYLQSIDRGDLIINSRTLDDKTWIVAYMADN
FT                   APVKYYKYDRANKKAEFLFTNRKELEQYNLAKMIPIIIKSRDGLDLVSYITFPNDVKLD
FT                   KNNIPDRKVPLILNVHGGPWVRDSWGYNPEHQWLANRGYAVLSINYRGSTGFGKDFLNA
FT                   GNLEYAGKMHTDLIDGVNWAIKNNIVDSDKVCIMGGSYGGYATLVGLTMTPDVFACGID
FT                   VVGMSNLLTHVQSKAPYMTPLLSIYKTRIGPWDTEEEKEFLRQRSPINFVDNIKKPLFI
FT                   AQGVHDVRVVQAESEQIVNSMQAKHIPVVYALYKDEGHGFAKAGNRISYYALAEQFLAK
FT                   VLKGRAEHIGDDLKNANLILNDKEKISGTEAEKIIDTAVGN"
FT   gene            complement(590514..591149)
FT                   /locus_tag="RC0604"
FT   CDS_pept        complement(590514..591149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0604"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03142"
FT                   /db_xref="GOA:Q92I16"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I16"
FT                   /protein_id="AAL03142.1"
FT                   /translation="MSPQIIELLIFAVIAFYIINKLITTLGSTSEEEQTKQKSYFGEPI
FT                   IKDVTYSIVKSNKEEKNIPTAQDIKAFKDIIVEHNITAIVDGMEQVHKRLYSFDPVKFI
FT                   NNAKTAFQMIIEAAYKKDAKELSELIDKRYLEEFEKITPSYGDFFDSSALSAKYSEIYM
FT                   FGNNIFIKLLFQGKNVVDKIEDLKEEWTFTRNANTKEVDWFLSNIERV"
FT   gene            complement(591473..591982)
FT                   /locus_tag="RC0605"
FT   CDS_pept        complement(591473..591982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0605"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03143"
FT                   /db_xref="GOA:Q92I15"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I15"
FT                   /protein_id="AAL03143.1"
FT                   /translation="MLCNGCRPILDERVHFAYGKSLIMFLGVFIFGCITFFITKYIKSL
FT                   KLNYIIYDIITFVGIAVFAYIFIIINAETLWWLAVGSSLIIIGTSNDSGLSTLIFGNPI
FT                   TYFLDQISYALYLSVLTTEFFVAYYWIYPTPLWLKFATSVTIATMLHYKIELPARQFIH
FT                   QLKVNR"
FT   gene            complement(592575..592937)
FT                   /gene="rbfA"
FT                   /locus_tag="RC0606"
FT   CDS_pept        complement(592575..592937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RC0606"
FT                   /product="ribosome-binding factor A"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03144"
FT                   /db_xref="GOA:Q92I14"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I14"
FT                   /protein_id="AAL03144.1"
FT                   /translation="MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTIT
FT                   KVIVTADLKIANCYFLPFNTKLTIDEIMDALNNSKNAIRNFITNKINMKFSPDIRFHYD
FT                   HGFDNAIKVAHLLKDL"
FT   gene            complement(592934..593368)
FT                   /locus_tag="RC0607"
FT   CDS_pept        complement(592934..593368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0607"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03145"
FT                   /db_xref="GOA:Q92I13"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I13"
FT                   /protein_id="AAL03145.1"
FT                   /translation="MNQFEAYSLLFVDSFVSNLVIGFQNELIFHSMKMFGGYNSLIMLL
FT                   VAICASLSGNAINYIFGKIVLNIFYASKNTQNILRHKNLTKLYYKYEIFIIFLMAFAFW
FT                   GSFISLFSGFFKTKFLKFLGIGCLAKACYYALELYIFFNA"
FT   repeat_region   complement(593406..593438)
FT                   /note="REP01, repeated element"
FT   repeat_region   complement(593439..593470)
FT                   /note="REP01, repeated element"
FT   gene            593511..594032
FT                   /locus_tag="RC0608"
FT   CDS_pept        593511..594032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0608"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03146"
FT                   /db_xref="GOA:Q92I12"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I12"
FT                   /protein_id="AAL03146.1"
FT                   /translation="MKKQIIYPDFIARIFSTALDLSVFAFIAIPISQFCSFNLLWLFFN
FT                   DYFLSNNINLHNPNEMFNSVMSQEFYEYLKAGNFNKYILFNISIFATNILVIGSYFITL
FT                   WYYKGATLSKMFLRMKIVDAVTLNRPTLKQLIKRFLGYMTFPIGIFFILFSSKKQALHD
FT                   KIAGTVVIKS"
FT   repeat_region   594049..594102
FT                   /note="REP04, repeated element"
FT   repeat_region   594142..594176
FT                   /note="REP04, repeated element"
FT   gene            594180..594785
FT                   /gene="recR"
FT                   /locus_tag="RC0609"
FT   CDS_pept        594180..594785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RC0609"
FT                   /product="recombination protein RecR"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03147"
FT                   /db_xref="GOA:Q92I11"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I11"
FT                   /protein_id="AAL03147.1"
FT                   /translation="MNETNDNDIDQLIYLFSKLPGLGIRSARRIALYLLQDKDIRLKSL
FT                   INNLVEIDKKIVKCEICGNMDTENMCRICSSEYRDKSIIAIVETVAELWAMERSGNFKG
FT                   LYHVLGHNLSATSRQNPSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLK
FT                   EHPAKISRLASGIPIGGELDYLDEGTVSAAINLRQPFE"
FT   gene            complement(595668..596174)
FT                   /locus_tag="RC0610"
FT   CDS_pept        complement(595668..596174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0610"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03148"
FT                   /db_xref="GOA:Q92I10"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I10"
FT                   /protein_id="AAL03148.1"
FT                   /translation="MCIKKYSYEELKNHELFKEYEISEYNALINKNSKVEIFFEYKPSS
FT                   NSSNPITKIINKFIAKENIFRLAVVEKNIALMEEVAKDILKSAPIVLNLLKTQGEMVSK
FT                   ISNFIAEILLFVKPEFQPDIIKQLANIEDFAILGSFSEILLATKKYDEIITLLAPRPAN
FT                   LVNNE"
FT   gene            complement(596090..596311)
FT                   /locus_tag="RC0611"
FT   CDS_pept        complement(596090..596311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0611"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03149"
FT                   /db_xref="GOA:Q92I09"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I09"
FT                   /protein_id="AAL03149.1"
FT                   /translation="MYSAIVKNFDIKNNYLRTIEEIKNSEFANLAIKKIKEVKTPKKLL
FT                   ECVLKNTVTKNLKIMSYLKSMRLVNIML"
FT   gene            complement(596487..597254)
FT                   /locus_tag="RC0612"
FT   CDS_pept        complement(596487..597254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0612"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03150"
FT                   /db_xref="GOA:Q92I08"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I08"
FT                   /protein_id="AAL03150.1"
FT                   /translation="MNINKIALIYNHNSKHLAIIEEIKKLYNYCKIEEAEVIIVIGGDG
FT                   ELLHNIHRYMHLNIPFYGVNLGSLGFLMNPLDTKKLLQNIHESTVSILNPLLMQVEDTS
FT                   GQIYTALAINEVSIFRKTNQAAKFRIEVNGIERMSELVADGALVATPAGSSAYNLSASG
FT                   PILPLESNMLCLTPICSFRPRRWHGALLLASATIKFEILNTNKRPVNATADFQEFNNIT
FT                   NVTVKSTKDKPVKLLFNKNHTLEDRIIKEQFGG"
FT   gene            597341..599023
FT                   /locus_tag="RC0613"
FT   CDS_pept        597341..599023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0613"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03151"
FT                   /db_xref="GOA:Q92I07"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I07"
FT                   /protein_id="AAL03151.1"
FT                   /translation="MSSFNIKNHKNDLLFVPLGGSNEIGMNLNLYHYQGQWLMIDCGSG
FT                   FADDYLPGVDMIIADSSFIEKYKKDIVGLILTHAHEDHLGGVQYLWNRLKCPIYITTFT
FT                   ANFLKIRLNEYDFAKNIKIHEVKPGSKINLDPFSLEMVPLTHSAPEMQAIMIRTDAGNI
FT                   LHTGDWKFDNDPILGKKADEELLKSYGDEGVLALVCDSTNVFNKGSSGSEGDVRKSLVD
FT                   IIAGCPQMVVVSTFASNLARLDTIIHAAGLAGRKVVLTGRSLHRMMLAAQESGYLKDIA
FT                   PLISERDVSRFRREELLVIATGCQGEPMAATAKLASNSHPSIKLVPKDTMIFSSKIIPG
FT                   NEKKIFRLFNIFVKAGVEVITERDHFVHVSGHPSIDELQKMYSLIRPNICIPVHGEPVH
FT                   IHEHVKLAKKNGIKQVVEVENGSVVLLEPNNAKVISKVENGYLAVDGNYLLPVESPIFK
FT                   ARRRMRESGIVVASVVINKKGLLAANPMLSMPGLLDPKEDMALVNLIKNDIKELVTIQN
FT                   KQAKKALSDEQVIEAIKGTIRKTLKQEINKSPVIIVNLEKAVE"
FT   gene            complement(598982..599371)
FT                   /locus_tag="RC0614"
FT   CDS_pept        complement(598982..599371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0614"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03152"
FT                   /db_xref="GOA:Q92I06"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I06"
FT                   /protein_id="AAL03152.1"
FT                   /translation="MLCKISFAIASSRKNKVTLLQFCAAKEARLVPKLPPPYTAIFLNL
FT                   FMCLFFLCHLQVCRYRCLACLCHSHEGGNPVKPYKNKFLYGFFIKYVTSVSILKLCFWI
FT                   PASVGMTLSEIALLHSFLKIYYYNG"
FT   repeat_region   599038..599174
FT                   /note="REP02, RS3-like repeat"
FT   gene            599232..600209
FT                   /gene="gpsA"
FT                   /locus_tag="RC0615"
FT   CDS_pept        599232..600209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="RC0615"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03153"
FT                   /db_xref="GOA:Q92I05"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I05"
FT                   /protein_id="AAL03153.1"
FT                   /translation="MNKFKNIAVYGGGSFGTSLASLAAQNCNNVTLFLRDEAIAKEILH
FT                   NKTNVKYLGDIKLPAHLQATTNLDIIKDFELIIIALPSYAFDDSIKLLKTHSISKDNTL
FT                   LIATKGFARNPTALLSDRLKTLLPYNPTAFFVGPNLAKELAKNLPASASIASLDIDIAN
FT                   KIAYNLSSKIFTTNVSSDIVTLQVAGALKNIFAIKSGIDLARKQGENARATLIVAALKE
FT                   IAILSKALGGMQKNSDILLEGVVGDLVLTCYSLGSRNTKFGYELGISSDKKKFLQEYKE
FT                   LAEGREALKLVLDLIKKYNLHMPIISEVASCVIPYVIPAKAGMT"
FT   repeat_region   complement(600179..600208)
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   600219..600245
FT                   /note="REP10, short repeated element"
FT   gene            600434..601363
FT                   /locus_tag="RC0616"
FT   CDS_pept        600434..601363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0616"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03154"
FT                   /db_xref="GOA:Q92I04"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I04"
FT                   /protein_id="AAL03154.1"
FT                   /translation="MIIFSIVFFKTVSVLLSVVIGFLAGKYSNVERDSISSLLFYFISP
FT                   IVFFTIPASTTLTLAALSVTVVTFVIATLLSLFSYYFFGKFWQDHTRNIIALSAGTANG
FT                   GYFMLPIAAALFDDYTLSIYMMAVIGVNIYECSVGFYICMRSFANTTDSILKVVKLPIL
FT                   NAFFLGCLFSFCGFALPDFLDDFIYNMKGSFSILGMVMVGLALSSLQKFEVDIKFTLAT
FT                   FAAKFLFYPLGVGLFIMFDHFVTKWYNNDYYNALKLLSTAPLAANTIVIANLQKFYPEK
FT                   VAATVFLSLLFVVIYMPTMVSIFLSDLN"
FT   gene            601432..602304
FT                   /locus_tag="RC0617"
FT   CDS_pept        601432..602304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0617"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03155"
FT                   /db_xref="GOA:Q92I03"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I03"
FT                   /protein_id="AAL03155.1"
FT                   /translation="MKINSIKIGPYINLLPLQYIPKHKISYLEFGDPKNKNIIVCAHGL
FT                   TRNAHDFDKIAKELSKNYRVIAINYPGRSDSENFKKANHYNYTTYIKDTLFFLKRLNIK
FT                   NPIWLGTSMGGIIGMILASKYKNIFKALILNDIGAFIDAAPLIKIGGYAKKTILLDDLA
FT                   SAKEHLKLIYAQSGIKDEEDWDYLTKYSVISTFGGKYKMNYDPAITKGMKNASNQEDIK
FT                   LWSVWNKIKCRILVIHGMKSQILTKSTIKKMKETKIFDLYEIKYAGHAPSLMNPEEINY
FT                   VKSWLEKKS"
FT   repeat_region   602340..602472
FT                   /note="REP02, RS3-like repeat"
FT   gene            602503..603435
FT                   /gene="trxB1"
FT                   /locus_tag="RC0618"
FT   CDS_pept        602503..603435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="RC0618"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03156"
FT                   /db_xref="GOA:Q92I02"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92I02"
FT                   /protein_id="AAL03156.1"
FT                   /translation="MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTIT
FT                   TDVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVSDYVEKVDLSKRPFKVFTGAGNEYD
FT                   AESIIICTGAEAKWLGIASEQKFRGFGVSACATCDGFFFKNQEIVVVGGGNSAVEEALY
FT                   LTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQ
FT                   NVHTKEISLLNCSGVFIAIGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGD
FT                   VQDKIYRQAVTAAGTGCMAALEAEKFLNK"
FT   gene            603662..603958
FT                   /locus_tag="RC0619"
FT   CDS_pept        603662..603958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0619"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03157"
FT                   /db_xref="GOA:Q92I01"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I01"
FT                   /protein_id="AAL03157.1"
FT                   /translation="MKHANLEIELAEAAFSKKFLIYSAIKFYLNHFYPNSQSEKFTELE
FT                   ITGVRYDQVIKAPDIRLATDKPTTTNIFKNLTLDSICYIRIGFLMEMTQMVGC"
FT   gene            604279..604488
FT                   /locus_tag="RC0620"
FT   CDS_pept        604279..604488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0620"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03158"
FT                   /db_xref="GOA:Q92I00"
FT                   /db_xref="UniProtKB/TrEMBL:Q92I00"
FT                   /protein_id="AAL03158.1"
FT                   /translation="MYDFIIIENSAILSDIGYKFPQEILNLILSAIAPEDIINIIKHAN
FT                   LANISYDVLESQMGGEDFGINNSL"
FT   gene            604613..606040
FT                   /gene="gabD"
FT                   /locus_tag="RC0621"
FT   CDS_pept        604613..606040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="RC0621"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03159"
FT                   /db_xref="GOA:Q92HZ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ9"
FT                   /protein_id="AAL03159.1"
FT                   /translation="MNLLKNITGKNYINGEFIEFGKQISVINPATLKEIATVPNLGLSE
FT                   INSAINNTVTSFSLWSQSSFEARIAILRRWYNLVIENIEELSYILTLEQGKVLAESKKE
FT                   ILYGASFIDWYTYAIHNIHSTIKPGNSNTHKIVTQYEPVGPSAAITPWNFPNAMITRKV
FT                   VPAIAAGCSVILKPSSLTPLSALVLAKFASDAGLPAGVFNVITGSSDIIGKAFCEDFRL
FT                   RKLSFTGATNVGKILYQNAANTLKRLSLELGGNAPFIITADNNLEKVVSDLVIAKTRNS
FT                   GQSCTSPNRIFIEESIYEKFIEILKAKFTKLKAGDGFDKESDIGPLINSAAIEKIQKLL
FT                   ADAQSKGAKLICGGKTVDNFIEPTIIIDCLDNMDIFRIEIFGPVVACYKFKDLDEVIEH
FT                   ANNTEYGLQGYVYSNNISVAQMIASKLDFGMVSINDPLPANAKAPFAGRKASGFGVEGS
FT                   FEGIFEYLNTKYINLQN"
FT   repeat_region   606063..606095
FT                   /note="REP02, RS3-like repeat"
FT   repeat_region   complement(606107..606162)
FT                   /note="REP02, RS3-like repeat"
FT   gene            606194..606406
FT                   /locus_tag="RC0622"
FT   CDS_pept        606194..606406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0622"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03160"
FT                   /db_xref="GOA:Q92HZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ8"
FT                   /protein_id="AAL03160.1"
FT                   /translation="MLVLVDNLEVQIEKIYEVFDLIDNEGADLLLWAVSDCLAELLAQY
FT                   KESLTIEYVDPLMQLIKKGLKSKIL"
FT   gene            606531..607376
FT                   /gene="lgtD"
FT                   /locus_tag="RC0623"
FT   CDS_pept        606531..607376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtD"
FT                   /locus_tag="RC0623"
FT                   /product="glycosyl transferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03161"
FT                   /db_xref="GOA:Q92HZ7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ7"
FT                   /protein_id="AAL03161.1"
FT                   /translation="MYSNLPKISIVLPVYNRKKLLPFAIESCLNQSFKDFELIIIDDCS
FT                   KDNSVIVARTYAEQDSRIKVIVNETNKRLPASLNIAFKEAKGEYFTWTSDDNLFHENAL
FT                   EKMVKILDNSPEIGLVYTDYTLIDDHGKVGIRLYQEPPEFLPIRDCVGACFLYRADLAR
FT                   QVGGYNENMQLVDDYEYWLRFGLVTKFAHIPESLYFYRVHNQSLTIERKVEAKQAKRVL
FT                   KALFKDQYIIPAEIKPINDLYNWFIEDRNLSSYFRLFKIIICSPIITISYIIKNLRRIR
FT                   "
FT   repeat_region   complement(607393..607422)
FT                   /note="REP02, RS3-like repeat"
FT   gene            607454..609415
FT                   /gene="uvrD"
FT                   /locus_tag="RC0624"
FT   CDS_pept        607454..609415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="RC0624"
FT                   /product="DNA helicase II"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03162"
FT                   /db_xref="GOA:Q92HZ6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HZ6"
FT                   /protein_id="AAL03162.1"
FT                   /translation="MQNQDFIHTLNPEQQKAVLHTEGPLLLLAGAGTGKTKVLTSRIAN
FT                   IIHQNLASPQNILAVTFTNKAAKEMAERVNSLINCYGLNIGTFHSMAARILRDQIEHLN
FT                   LGLNNRFTIISHDDQLKLVKDIVKLKDIDTKKYAPKLIHIIISRWKDQGLLPTKLSVSD
FT                   TNLPLQRVAKLVYEEYQKNLLISNVLDFGDLLLYNNELFIKNSEILRYYQEKYRYILID
FT                   EYQDTNVVQYLWARMLASLYKNICCVGDDDQSIYGWRGAEVGNILRFEKDFAGATIIKL
FT                   EQNYRSTLPILAAASNVINNNKNRHGKTLWTDRENGEKIKIISCWSDKEEARYIAGEID
FT                   KLVRENRYNAGNIAILVRAGFQTRSFEEAFINSAMPYKIIGGLRFYERMEIRDVLAYIR
FT                   ISLNQNDNLALERIINVPKRAIGAASLNKIRGYALERNISNFAAIKEMLEIGEIKAKSY
FT                   ETLKDLVTKIDNWYERFSIDAPINVVKAILDDSGYLEMLQEEKTEEAFGRIENINEMLR
FT                   AIAEFNDVHDFIEHSSLVMENEVLETNYGGSVTIMTLHAAKGLEFDVVFLPGWEEGVFP
FT                   SQRSLDEEGEKGLEEERRIAYVGITRAKKDLYITHAESRKIFYEIVRSYPSRFITEIPD
FT                   EITIRTSSMKKYNSFYKF"
FT   gene            609449..609973
FT                   /locus_tag="RC0625"
FT   CDS_pept        609449..609973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0625"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03163"
FT                   /db_xref="GOA:Q92HZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ5"
FT                   /protein_id="AAL03163.1"
FT                   /translation="MLELANQKISKEQYREKLIDKTLDNLKENVSETTLGNYRKFLTKN
FT                   TTPKLNKQEQINDPQQVEALTQAALKIAEFLKITYEKEAKALSSINELGVNEPNIIKTL
FT                   LPAISKLPSEKMIEQGKEIIKNFAPLLESSNSVLVNGTKRVLAELNPGYLRNTRMGGEE
FT                   YSIRITKSNQT"
FT   gene            610087..610257
FT                   /locus_tag="RC0626"
FT   CDS_pept        610087..610257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0626"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03164"
FT                   /db_xref="GOA:Q92HZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ4"
FT                   /protein_id="AAL03164.1"
FT                   /translation="MKNLSEELQREKQAPNIVKQNKTIPQGYKSSISTPISHVENLNKS
FT                   RESGQQSGHSK"
FT   gene            610349..611701
FT                   /locus_tag="RC0627"
FT   CDS_pept        610349..611701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0627"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03165"
FT                   /db_xref="GOA:Q92HZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ3"
FT                   /protein_id="AAL03165.1"
FT                   /translation="MAEIITNIDDTIKKNDEVTEILAAVKDKIVDIKNVDRRLDTLHKN
FT                   IVTPDPIQQYLQSAEYITSTLEVLASQIISEVVENKDIQKLVDNLHINLGQDIKLIPSL
FT                   ADKLKFDVARAEAALKGFVLPLNQGGPFDALSLMGIEDEEEILANPIRATKEALIAVSG
FT                   KSIPKEQYAQAVKDQAIEILKQDPKNTPDKLEKYEKFIMQGDKNQKFNKNSKQFIPRVN
FT                   QLSQVEFKALQNAATYTVQQISNRLEKNNKISKQLEQIIILTHSSGIKNPEIIRKLNKL
FT                   DSTYLTENSTKIATELKDINDRGTSLWEKFKQIFTGRNYLEKRLGKVVDKYITLSDGYV
FT                   VKTINDKIFSNALTNPEITAGLTKFLNENKDKVATNPEFKNLIPVTGEPIIVQPQQINN
FT                   FNLAELRKINPIAFDKTIFEDSIKLRSSNLKPPHITPKPSTKNQEAVRRKG"
FT   repeat_region   611751..611776
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(611878..612909)
FT                   /gene="tdcB"
FT                   /locus_tag="RC0628"
FT   CDS_pept        complement(611878..612909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="RC0628"
FT                   /product="threonine dehydratase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03166"
FT                   /db_xref="GOA:Q92HZ2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ2"
FT                   /protein_id="AAL03166.1"
FT                   /translation="MNLLLQPPQNVAAAHNRIKQYLHLTPIVHSESLNEMLGHEIFFKV
FT                   ESLQKTGAFKVRGVLNHLLELKEQGKLPDKIVGYSTGNHGIGLAYASKLFGIKTRIYLP
FT                   LNTSKVKQQAALYYGGEVIYTYTRQEAEEKAKEDEKQGFYYMHPSDSDSTIAGAGTLCY
FT                   EALQQLGFSPDAIFASCGGGGLISGAYLAKELISPTSLLIGSEPLNANDAYLSVKDNKT
FT                   YRFNYAPNTIADGLKTLSISARTFEYLKKLDDFYLAEEYEIYYWTAWLTHLLKVICEPS
FT                   SSINMVSVVNFLKTQSKPQKLLVLISGGNIDPILYNELWKEEYLSISPKSLCSDVISAK
FT                   AAI"
FT   repeat_region   611881..611906
FT                   /note="REP02, RS3-like repeat"
FT   gene            612992..615331
FT                   /gene="lon"
FT                   /locus_tag="RC0629"
FT   CDS_pept        612992..615331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="RC0629"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03167"
FT                   /db_xref="GOA:Q92HZ1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HZ1"
FT                   /protein_id="AAL03167.1"
FT                   /translation="MMHKKSLPLMALRDMVVFPGVIAPIFVGRPKSLQALSHTTISEED
FT                   NSKYILVTLQKKFDQENPSTHELYNTAILAKIIQIVKLPNNTAKILIEAVARVKLSNIK
FT                   GEEAFEANYEIIPDEEIFDVNNMRSLVDNAVQLFSKYAINDKKVNAEIIETINKEISNS
FT                   TNFIDIINILASHLITSLEAKQHLLEETSPFKRITTVISMLNSNIVNSETEQALQKRVR
FT                   KQIEKTQRDYYLHEQMKAIQKELDEDKSELADIENKIKSLKLSKEAKEKAEAELKKLRT
FT                   MNQMSAESGVTRNYLETLLSLPWGKYDNSKIDINQAEKILNRDHFGLEKVKERIIEYLA
FT                   VLQRSSKIRGPILCLIGPPGVGKTSLVKSIAEGMGRKYTKLALGGVRDEAEIRGHRKTY
FT                   LGSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPASALLEVLDPEQNSHFVDHYL
FT                   EVEYDLSNVIFIATANSHDLPRALSDRMEKIYISGYVEETKLQIARNYLVPKQFKMHKI
FT                   KKDEITISETAILDLIRYYTKESGVRALEREIGALTRKALKQILADKSVKHIAIDSNHL
FT                   EEFLGAKKYNFGLAEKEDQIGSTTGLAYTEVGGELLTIEALAFPGKGEIKTTGKLGDVM
FT                   KESAMAAYSCFRSRATNFGLKYDNYKDFDIHIHVPAGAIPKDGPSAGCALFTTIVSLMT
FT                   KIPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEENVKDLKDIPPNIK
FT                   ESLEIISVSNIDQVLKHALVGTPINK"
FT   repeat_region   complement(615513..615537)
FT                   /note="REP08, short repeated element"
FT   repeat_region   615538..615597
FT                   /note="REP03, repeated element"
FT   repeat_region   complement(615840..615905)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   repeat_region   complement(615914..615941)
FT                   /note="REP07, Rickettsia palindromic element 3"
FT   gene            616015..616167
FT                   /locus_tag="RC0630"
FT   CDS_pept        616015..616167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0630"
FT                   /product="cell surface antigen-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03168"
FT                   /db_xref="GOA:Q92HZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HZ0"
FT                   /protein_id="AAL03168.1"
FT                   /translation="MKESKILRKFLATASLCGTLFTSSNTAGATIPNLGSVKLEFRCRS
FT                   CRRSI"
FT   gene            616623..617393
FT                   /locus_tag="RC0631"
FT   CDS_pept        616623..617393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0631"
FT                   /product="cell surface antigen-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03169"
FT                   /db_xref="GOA:Q92HY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY9"
FT                   /protein_id="AAL03169.1"
FT                   /translation="MSGAGNITINAANINLTNNNSILTLFDCNITTLTGNINNTAGVDG
FT                   QGILNLAHDLGSSNIITGDIGNIGSLAAVNVLLGAATLNSTILKATNINLQSNTSVLNL
FT                   DDDITVTGNIDGAKGVNGNFIGNAILNGNINNFNILQCNGGNGKILDLQSNTTVNSIVF
FT                   ADSVLAAGTISVNSLLDVGGITFNNSNASGGTLIINTEDTINIALLNAIQAKIQINANL
FT                   TINDPSAGDIGDIRIADNTTYTIDAANGNVNLLK"
FT   gene            complement(617892..618155)
FT                   /locus_tag="RC0632"
FT   CDS_pept        complement(617892..618155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0632"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03170"
FT                   /db_xref="GOA:Q92HY8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY8"
FT                   /protein_id="AAL03170.1"
FT                   /translation="MFRWFQPSNQELIRTIQKENTAEAQKLIAAMDITELSKVRDIYIS
FT                   ISRTICSIRTYILSYITVTYQIQCTAYTAGAKYYSICSYATG"
FT   gene            complement(618439..618512)
FT                   /locus_tag="RCRNA14"
FT   tRNA            complement(618439..618512)
FT                   /locus_tag="RCRNA14"
FT                   /product="tRNA-Asp"
FT   gene            618908..619216
FT                   /locus_tag="RC0633"
FT   CDS_pept        618908..619216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0633"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03171"
FT                   /db_xref="GOA:Q92HY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY7"
FT                   /protein_id="AAL03171.1"
FT                   /translation="MTKPYVIKLTTPFERIKLYNPIPDIALRSAIIMQAIIDATNTSTK
FT                   KEATKAEYNAKKWLVENNENFNATCLEIGIEPNYVRKTAKKLIKSQQNKDKRPKLYG"
FT   gene            619333..619911
FT                   /gene="yhbH"
FT                   /locus_tag="RC0634"
FT   CDS_pept        619333..619911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="RC0634"
FT                   /product="probable sigma(54) modulation protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03172"
FT                   /db_xref="GOA:Q92HY6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY6"
FT                   /protein_id="AAL03172.1"
FT                   /translation="MIISVSGQHISIGNNLQEYSKERATQVVKKYFTDIINIDIHFSKE
FT                   GINFKCDIIVKYGSGKHNIVKSNDSCSDIYVAFDKAMSKLEKQLRKYKSKFKNHHAGKV
FT                   KISEIAYEGTKYIINPQSDSETSNAEDNDNPAIIAEKPVEILKLSVKEAVMQMDLEDLP
FT                   VVVFKNINNDRINIVYYRKDGNISWVDYN"
FT   gene            620030..620422
FT                   /locus_tag="RC0635"
FT   CDS_pept        620030..620422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0635"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03173"
FT                   /db_xref="GOA:Q92HY5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY5"
FT                   /protein_id="AAL03173.1"
FT                   /translation="MLRGDVESIKIGNNTNVQDGSVIHASRFNGPVEIGDNITIGHLSL
FT                   IHACTIHNNAFIGMRATIMDYAVIEEYAFIAAGSLILPKKIIKSQELWMGSPAKFVRYL
FT                   TDQDLEYMQDNVRHYVELENVYKILV"
FT   repeat_region   complement(620411..620436)
FT                   /note="REP04, repeated element"
FT   gene            complement(620453..621319)
FT                   /gene="folD"
FT                   /locus_tag="RC0636"
FT   CDS_pept        complement(620453..621319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="RC0636"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03174"
FT                   /db_xref="GOA:Q92HY4"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HY4"
FT                   /protein_id="AAL03174.1"
FT                   /translation="MNNIIDGKALANEILADLKLEIQELTSQTNASPKLAIVLVGDNPA
FT                   SIIYVRHKIKNAHKIGIYTLLINLSATIHTNDLISKINELNLDNEISGIIVQLPLPSSI
FT                   DKNKILSAVSPSKDIDGFHPLNVGYLHSGISQGFIPCTALGCLAAIKKYEPNLTGKNVV
FT                   IIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFN
FT                   PKSIVIDVGINRISSNKIIGDVDFENVQSKVQYITPVPGGIGPMTIAFLLKNTVKAFKD
FT                   SLYTLDT"
FT   repeat_region   complement(621349..621448)
FT                   /note="REP01, repeated element"
FT   gene            complement(621456..622478)
FT                   /gene="trxB2"
FT                   /locus_tag="RC0637"
FT   CDS_pept        complement(621456..622478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="RC0637"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03175"
FT                   /db_xref="GOA:Q92HY3"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HY3"
FT                   /protein_id="AAL03175.1"
FT                   /translation="MYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITL
FT                   YPEKPIYDIPAYPKIAAEELIKQLALQAAPFNPIYHLNQQAIELNKQDDFFEIKTSKNT
FT                   LIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGDSAV
FT                   DWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSEL
FT                   QSVIVKDLQNNTRKLDANILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGI
FT                   YAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKALHFEYSTTKNTGKRSKSVTK
FT                   "
FT   gene            623130..623498
FT                   /locus_tag="RC0638"
FT   CDS_pept        623130..623498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0638"
FT                   /product="late-developmental spore coat protein-like
FT                   protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03176"
FT                   /db_xref="GOA:Q92HY2"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY2"
FT                   /protein_id="AAL03176.1"
FT                   /translation="MYSSATPLAFGTYVPTVDALQTNTIIIKCILGTNYTVALNAGTAP
FT                   AATTSTRKMTGVVNTNSYLPYNLYSNAGRTQNWGHQSSDWVMGTGLDQTLTIYGKILQG
FT                   ANVPSDTYNDTITIIVAY"
FT   gene            623600..623911
FT                   /locus_tag="RC0639"
FT   CDS_pept        623600..623911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0639"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03177"
FT                   /db_xref="GOA:Q92HY1"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY1"
FT                   /protein_id="AAL03177.1"
FT                   /translation="MTVQNNDYAPKKFQLIRLKRTYKDGIEEYKETKDLVATPVTFTLH
FT                   DGKIQLIRVALKNTQNYSTKAKYRIFIKELPRRVKLENSVTSTVDLVVQHSIPITISG"
FT   gene            624011..624457
FT                   /locus_tag="RC0640"
FT   CDS_pept        624011..624457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0640"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03178"
FT                   /db_xref="GOA:Q92HY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HY0"
FT                   /protein_id="AAL03178.1"
FT                   /translation="MQVELSLNLLVILRLESAADTNVHEDQELGLLPQLPLAVKFENSA
FT                   NEIAGESELMVSLEVNYTETDILPTIVQNAQGHYLIPLEDIEHFDVQEDYLKQGLVNYH
FT                   DTAYINLDLLEGTKYDLNFENLDLNITFPAEKFNLNHLMLQVVL"
FT   gene            624578..625012
FT                   /locus_tag="RC0641"
FT   CDS_pept        624578..625012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0641"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03179"
FT                   /db_xref="GOA:Q92HX9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX9"
FT                   /protein_id="AAL03179.1"
FT                   /translation="MYSYSFLFQTEAVKSNFSKITNTTKNQNKFTRLDTNWTYENVDKM
FT                   TNWWVGDNSITKVSSWSNSTRFAGIQYATNFAVRPNLVTYPLLDFRGKSELPSSIEIFS
FT                   NSIPIYNTKAHMGDFDITNIPVITGRGDLIVKTQDITGKV"
FT   gene            625016..625237
FT                   /locus_tag="RC0642"
FT   CDS_pept        625016..625237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0642"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03180"
FT                   /db_xref="GOA:Q92HX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX8"
FT                   /protein_id="AAL03180.1"
FT                   /translation="MTIPYYASPSLLRPGLSHFSYEAGFQRQDFTIYSSAYKYLVLNTD
FT                   YMLGMNDYLTSGGHFEFLKNNGAVGVII"
FT   gene            625482..625703
FT                   /locus_tag="RC0643"
FT   CDS_pept        625482..625703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0643"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03181"
FT                   /db_xref="GOA:Q92HX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX7"
FT                   /protein_id="AAL03181.1"
FT                   /translation="MSFVVNNTMQKGKRSNILSSTYQRNITKKGFLSFTIGTDLNSKRK
FT                   NNFAYIPFNLNLDSNKSISLTDLYFISK"
FT   gene            625750..626010
FT                   /locus_tag="RC0644"
FT   CDS_pept        625750..626010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0644"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03182"
FT                   /db_xref="GOA:Q92HX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX6"
FT                   /protein_id="AAL03182.1"
FT                   /translation="MGWGYNANLIKAKATNYNVQVNRNGKNNDIGVYLQKNDTAIMKQF
FT                   NIKGGIFSIDKSYYETRPINGGLALIKVNSLKNVGVYNNSR"
FT   gene            625982..626218
FT                   /locus_tag="RC0645"
FT   CDS_pept        625982..626218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0645"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03183"
FT                   /db_xref="GOA:Q92HX5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX5"
FT                   /protein_id="AAL03183.1"
FT                   /translation="MSGFIIIAGDTDDKGKMLVPNLTPYVPSEIRLDDENLPLNTEFEE
FT                   IALKVAPRTKSAVLLDFNIKIIKSIEMTVFDST"
FT   repeat_region   complement(626452..626473)
FT                   /note="REP03, repeated element"
FT   gene            626732..627025
FT                   /locus_tag="RC0646"
FT   CDS_pept        626732..627025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0646"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03184"
FT                   /db_xref="GOA:Q92HX4"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX4"
FT                   /protein_id="AAL03184.1"
FT                   /translation="MINGVRKLNYNLYKDAGFTQILGNGTSSTVTFTDSYTLGLEPVTK
FT                   NYTVYARLPSQPLAAASTFQDTITVTQPWLYNKKSLKSKFFSLGSNFVAYMD"
FT   gene            627506..629329
FT                   /gene="nrdA"
FT                   /locus_tag="RC0647"
FT   CDS_pept        627506..629329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="RC0647"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03185"
FT                   /db_xref="GOA:Q92HX3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX3"
FT                   /protein_id="AAL03185.1"
FT                   /translation="MNTFKKNKFQITINNNHNNLLTPFGKAILRDRYLMKGEDFQDLFA
FT                   RVSSYYAENKQHAQKLYEYMSKMWFMPATPILSNGGTDRGLPISCFLNETDDSLDDIVN
FT                   LWTENVWLAARGGGIGSYWGNVRAINEGIRDKGHSSGIIPFIKVMDSMTLAISQGSIRR
FT                   GSSAVYLPINHPEIEEFIDIRRPTGGDVNRKALNIHHGIAITDEFMKAVENNTDFDLVS
FT                   PATKKVVNKVRARDLWVKLLTTRIETGEPYLLFIDSVNKSIPEHHKKLGLQVKMSNLCS
FT                   EITLPTGIDHLGKSRTAVCCLSSLNLEYYEEWKDDKEFIHSIMLFLDNVLEDFINKAPD
FT                   TMARAKYSALRERSVGLGVMGFHSFLQMKKVPIESVMAKVWNKKIFEYISAETDKASIE
FT                   IGKEKGACPDALDAGSNERFSNKTAIAPTASISVIAGNASPGIEPFAANSFVQKTLTGS
FT                   FNVRNKHLEKLLEEKGFNNDQVWSSIATHEGSVQHLTFLSEEEKQVFKTAYEIDQNWLI
FT                   ELASDRTPYITQAQSLNIFLPGNVSKKYLNNIHFKAWTKGVKSLYYCRSTSIQRADKIS
FT                   HDVLKADFKDLEEQNDKLAETGNYEECLACQ"
FT   gene            629403..629798
FT                   /locus_tag="RC0648"
FT   CDS_pept        629403..629798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0648"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03186"
FT                   /db_xref="GOA:Q92HX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX2"
FT                   /protein_id="AAL03186.1"
FT                   /translation="MTRLSQYIMRLLEELRIINLEYISNEQAPDLGQNTRSIVDVKVRD
FT                   NSGNIYIVEMQDGYADASLARVPFYSCIAFSSQLKRGKEYVDLAPVVMVVIISGFQALP
FT                   EEKECISYHQTINVGNGKHQLKCLRIC"
FT   gene            629752..629934
FT                   /locus_tag="RC0649"
FT   CDS_pept        629752..629934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0649"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03187"
FT                   /db_xref="GOA:Q92HX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX1"
FT                   /protein_id="AAL03187.1"
FT                   /translation="MSATVSINLNACVFVELDKFTKEADELESLEDDWLYMMAKFDRAK
FT                   EPPQHTKDENSIISL"
FT   gene            629990..630334
FT                   /locus_tag="RC0650"
FT   CDS_pept        629990..630334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0650"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03188"
FT                   /db_xref="GOA:Q92HX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HX0"
FT                   /protein_id="AAL03188.1"
FT                   /translation="MLATQTEELNQKSKYNEGKAEGIEIGDTRRNTKIAKEMLADNEPI
FT                   EKIIKYTKLSKEEIEKLKEEKLCHYLMQVQFINRFHIHGHMKLGTLNKKFIGYRKKYRL
FT                   PTMLKIGNIT"
FT   gene            630190..631176
FT                   /gene="nrdB"
FT                   /locus_tag="RC0651"
FT   CDS_pept        630190..631176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="RC0651"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03189"
FT                   /db_xref="GOA:Q92HW9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW9"
FT                   /protein_id="AAL03189.1"
FT                   /translation="MSLLDASPIYKPFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWK
FT                   YNLTPGEKHLLTQIFRFFTQADIEVNNCYMKHYSRVFKPTEILMMLSAFSNMETVHIAA
FT                   YSHLLDTVGMPEVEYSAFLKYKEMKDKYDYMQQFGVDAKEDIATTLAVFGAFTEGLQLF
FT                   ASFAIMLNFPRFNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRI
FT                   YEACTTIVHFEDAFIELAFEVGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNP
FT                   LPWLDEMLNGVEHTNFFENRTTEYSKAATTGSWEEVFTEMDATAEAK"
FT   gene            631325..634174
FT                   /locus_tag="RC0652"
FT   CDS_pept        631325..634174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0652"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03190"
FT                   /db_xref="GOA:Q92HW8"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW8"
FT                   /protein_id="AAL03190.1"
FT                   /translation="MAVINNKNYQKVVEKVLSSSRANKVLKSAIQDLSSSKSISLRTIL
FT                   LGARFILTNPVNTYNLVKLANSSKIYLDPEFQKSLLKKSPIWEFLKKHSDDLPKIGQIL
FT                   ANAGFREFQDKSALDEKGLEILKECFKNEQVLKKLQEIAVEVKQELPDWNKVTSRTLDM
FT                   LVTDKNFQKFFNEKSEDITKYIRTGATEILPSDYIKTFDDILQKPEKKNLLKIFNEHPD
FT                   FKQELAKNINNPNTLKRFNKLSPEKQIIIENFLEEAKEQAKPFLKEYFETYKIDLKILD
FT                   IIPTLLNKMPETKEIFDTLNAPNQGVMISLEKSLEMVAGDDKLKSFFANNKTILPNIAL
FT                   GIIENTPSVQSVTKEYNFDKQMLSIVGEVMSKPEVAHEIIADLNKGDYMSLTGNIISAL
FT                   NDPSFKLKDILVEQSKGGLFDNLITGVLEQDAKNSQTIKQQLINYGLEANDVTKLTSIM
FT                   PILLDQSESLKKVFRDFIQGDYTGMAKELIALTKDNPEIKKYLNNNREIFASILDKTLV
FT                   EIPGINNLDKKELYNVLPSMLNHPNELVKVIEEVEKSNYREAASAIYTLAQKTNYLEGQ
FT                   LPNMIKAGFSYATEKLKDVFSPSQDFKDKTIDAITIRNNLHKIQNGKFSLEGAILVGDL
FT                   SNIDFSGVSLKNADLTKVTSLKDCNFKNINLAEAKLPDNLMLLTDTYNLDKAIPPLVPK
FT                   LIKEQQAKLIDKAIDKLFLQIQAEGKRNVLSKKNFAQQVKRLYEENQTIKDYIIEKLNS
FT                   LPMNMVTNLATPRTNQYKHITNHVNSPLQILNPLYENIANKQNIKSNLLANILSEKISQ
FT                   KLFDKGDNRGEDFYMINQMLKPIVSEYSKENPDNINNFLEPKNLEKLASNIASTLYSKS
FT                   KYTGVGTITGGIYLPKEIFNEQLKDNFKNEFKNINKLNVLKEATNIVSNLDSNVHVVDN
FT                   HDKSHTYASLPTKSKQIHR"
FT   gene            634602..634850
FT                   /locus_tag="RC0653"
FT   CDS_pept        634602..634850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0653"
FT                   /product="RP511-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03191"
FT                   /db_xref="GOA:Q92HW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW7"
FT                   /protein_id="AAL03191.1"
FT                   /translation="MLKKHADDLPKIGQILAKAGFREFQDKSAFDEKGLEILKECFKND
FT                   ALLKSLQEIALKIKQEVPDYNKVTSKTLGMLSTDKNC"
FT   gene            635192..635404
FT                   /locus_tag="RC0654"
FT   CDS_pept        635192..635404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0654"
FT                   /product="RP511-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03192"
FT                   /db_xref="GOA:Q92HW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW6"
FT                   /protein_id="AAL03192.1"
FT                   /translation="MPETTEIFDTLNANQGVMVAREKSLEMVAGDDKLKSFFADNKTVL
FT                   PDIAVAIIENTPNIQSITQEYNFDK"
FT   gene            635405..635563
FT                   /locus_tag="RC0655"
FT   CDS_pept        635405..635563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0655"
FT                   /product="RP511-like protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03193"
FT                   /db_xref="GOA:Q92HW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW5"
FT                   /protein_id="AAL03193.1"
FT                   /translation="MLSIVGEVMSKPEIAHAIITDINKGDDMTVTSRVITAFNEPSFKL
FT                   KYISRAK"
FT   gene            complement(636208..637299)
FT                   /gene="miaA"
FT                   /locus_tag="RC0656"
FT   CDS_pept        complement(636208..637299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="RC0656"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03194"
FT                   /db_xref="GOA:Q92HW4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HW4"
FT                   /protein_id="AAL03194.1"
FT                   /translation="MLACNDDTSLYLLVKQVTKKEIYSNDLENGNVKRGASMQSLYLIG
FT                   DPKCCRNNSSKQKSIIILCGPTASGKSYLGHELAKAYNGEIINIDSMQVYKEIPIITAS
FT                   PPKSYKTEILYHLYNFLSMTEDFSVIKYLKLATEKIKEITDRGKLPILIGGTGLYINSL
FT                   VFGYNNIPDISEDLQEQVRNLHVKIGNIELWSKLEKFDPLAASKINQNDTQRLIRAYEV
FT                   FMQTGKSIFSFQTLPKEQILSDFNFKIIFLNPERKFLYKTCDERLDKIFKEGAIDEIAL
FT                   IKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYAKRQVTWFKNQIQD
FT                   KITLEYANQEEFTQTLKNPFKII"
FT   gene            complement(637804..639192)
FT                   /gene="exoC"
FT                   /locus_tag="RC0657"
FT   CDS_pept        complement(637804..639192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoC"
FT                   /locus_tag="RC0657"
FT                   /product="phosphomannomutase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03195"
FT                   /db_xref="GOA:Q92HW3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW3"
FT                   /protein_id="AAL03195.1"
FT                   /translation="MQINKEIFRAYDIRGNSLKDLTEEVAYKIGFGFAEMTITKDNDKI
FT                   CVGLDGRLSSPTLCKALELGLTNAGAEIINIGVVPTPVLYFADKHFTPAGSIMVTGSHN
FT                   PRDDNGFKILQNGKPFFGDQIQELLTKILDNYSNTTPASPYVIPAKAGIHNIQSKYLKR
FT                   ILDGININPKLKVAWDCGNGATGDIVEELKKHLSNKNIIIHSKIDGNFPSHHPDPTNPA
FT                   NLQELIKVVKEQDCDLGIAFDGDGDRIGIISSSGKILLGDQILCIFAEDILKENPNATI
FT                   IVDVKVSQFIVTKIKSYGGHPIIWRTGHPFIKSKMLETKALLAGEMSGHIFFADKYFGF
FT                   DDAIYAALRFLDLLSRSSKTLDEIIEDVPKSYSTPEIKIFVPSELKLQIIKEIKEKSLE
FT                   EKIEFNDIDGVRVNTAHGWWLLRSSNTESIIVARAESDSKNGLEEIITIINKYLEKYGL
FT                   LINY"
FT   repeat_region   638732..638759
FT                   /note="REP02, RS3-like repeat"
FT   gene            complement(639362..640084)
FT                   /gene="abcT2"
FT                   /locus_tag="RC0658"
FT   CDS_pept        complement(639362..640084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT2"
FT                   /locus_tag="RC0658"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03196"
FT                   /db_xref="GOA:Q92HW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW2"
FT                   /protein_id="AAL03196.1"
FT                   /translation="MDSLHVKNISKSYKKRNILTDISLNIKQGEIVGLFGPNGAGKTTC
FT                   FNIIIGLMKLDSGQLLLNDINITNLPIYLRARLGLGYLLQEPSIFRELSVEDNIKAVVE
FT                   ISNNDKEVIEQKTHNLLEKFSIVHLKDLSAASLSGGERRRLEIARALAIEPKFIMLDEP
FT                   LAGIDPLAISDIKNLITYLREFNIGILITDHNVRDTLDIVDRAYVIFEGKVLLEGSAKE
FT                   IANSKKVKEVYLGESFSF"
FT   repeat_region   complement(640140..640169)
FT                   /note="REP01, repeated element"
FT   gene            complement(640270..640854)
FT                   /locus_tag="RC0659"
FT   CDS_pept        complement(640270..640854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0659"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03197"
FT                   /db_xref="GOA:Q92HW1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HW1"
FT                   /protein_id="AAL03197.1"
FT                   /translation="MSLQSSIYRIRHLAKPAYREEFKGDIECSTAAYKEVLEDTSTDST
FT                   SKLPLEAKFGKMSIIKLVLLLIISTIIYANDKNISNLHITSDSLIIDRTKQKAAYLGNV
FT                   IVYFDNAILRTKELYIFYKTIDEKQTIDHIVVPTKLTVERKINNELLLADSAKYFCDNK
FT                   QLILLGNVILQRDDNVLKTNKLIYYVDIIKK"
FT   repeat_region   complement(640681..640824)
FT                   /note="REP05, Rickettsia palindromic element 1"
FT   gene            complement(640823..641419)
FT                   /locus_tag="RC0660"
FT   CDS_pept        complement(640823..641419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0660"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03198"
FT                   /db_xref="GOA:Q92HW0"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92HW0"
FT                   /protein_id="AAL03198.1"
FT                   /translation="MPSSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVT
FT                   KKSLKDNKNFDLKYNIILKDSIFEGVNKNLNAYKIKTERAIKESNNKYKLDIINAIYNV
FT                   NQDQTLIINAKEGFLDEESSILDLKNDVKLFFDEIIFNTNDARIDLVNKNITGHSPAKL
FT                   LYKNSSITSDSFNTKDENNIIIFKGNVSTIIDLSD"
FT   gene            complement(641425..642384)
FT                   /gene="kpsF"
FT                   /locus_tag="RC0661"
FT   CDS_pept        complement(641425..642384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="RC0661"
FT                   /product="kpsF protein"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03199"
FT                   /db_xref="GOA:Q92HV9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HV9"
FT                   /protein_id="AAL03199.1"
FT                   /translation="MTNTNNYRIIAKRVISSEASALEKLSENIPEDFNRIIEFLLSFKG
FT                   RIILTGIGKSGYIARKIAASFSSTGMPAFYLHPAEASHGDLGMVTRNDLVIMLSNSGET
FT                   KELFNIIEYCKNSSIKIAAMTMNKNSTLAKRSDFLLIVPEYPEASVIEVPTISSLIMLS
FT                   LGDALMTVIHEKRGFTKDDFKIYHPGGTIGANLTKIKHLMRSGDEIPLVYEDTSFAKTI
FT                   IIMSKKRLGCTLVTDKNQNLVGIITDGDLRRHINDQIHLKTASSIMTKNPIHISSEIFA
FT                   KEALNLMKAKNITNIPIVDDNIIIGIIHIHDLLRIGVS"
FT   gene            complement(642389..642565)
FT                   /locus_tag="RC0662"
FT   CDS_pept        complement(642389..642565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RC0662"
FT                   /product="unknown"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RC0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAL03200"
FT                   /db_xref="GOA:Q92HV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92HV8"
FT                   /protein_id="AAL03200.1"
FT                   /translation="MRGSYEVIDEAISGVCYYFMRLPCSLRLLAMTVRVSTKIAHNTNN
FT                   LLDTVDKPRYDNE"
FT   repeat_region   complement(642397..642427)
FT                   /note="REP03, repeated element"
FT   repeat_region   642471..642569
FT                   /note="REP01, repeated element"
FT   gene            complement(642584..644833)
FT                   /gene="pnp"
FT                   /locus_tag="RC0663"
FT   CDS_pept        complement(642584..644833)
FT                   /codon_start=1
FT