(data stored in ACNUC7421 zone)

EMBL: AE007317

ID   AE007317; SV 1; circular; genomic DNA; STD; PRO; 2038615 BP.
XX
AC   AE007317; AE008385-AE008568;
XX
PR   Project:PRJNA278;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Streptococcus pneumoniae R6, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae R6
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2038615
RX   DOI; 10.1128/JB.183.19.5709-5717.2001.
RX   PUBMED; 11544234.
RA   Hoskins J.A., Alborn W.Jr., Arnold J., Blaszczak L., Burgett S.,
RA   DeHoff B.S., Estrem S., Fritz L., Fu D.-J., Fuller W., Geringer C.,
RA   Gilmour R., Glass J.S., Khoja H., Kraft A., LaGace R., LeBlanc D.J.,
RA   Lee L.N., Lefkowitz E.J., Lu J., Matsushima P., McAhren S., McHenney M.,
RA   McLeaster K., Mundy C., Nicas T.I., Norris F.H., O'Gara M., Peery R.,
RA   Robertson G.T., Rockey P., Sun P.-M., Winkler M.E., Yang Y.,
RA   Young-Bellido M., Zhao G., Zook C., Baltz R.H., Jaskunas S.Richard.,
RA   Rosteck P.R.Jr., Skatrud P.L., Glass J.I.;
RT   "Genome of the bacterium Streptococcus pneumoniae strain R6";
RL   J. Bacteriol. 183(19):5709-5717(2001).
XX
RN   [2]
RP   1-2038615
RA   Hoskins J.A., Alborn W.Jr., Arnold J., Blaszczak L., Burgett S.,
RA   DeHoff B.S., Estrem S., Fritz L., Fu D.-J., Fuller W., Geringer C.,
RA   Gilmour R., Glass J.S., Hann A., Khoja H., Kraft A., LaGace R.,
RA   LeBlanc D.J., Lee L.N., Lefkowitz E.J., Lu J., Matsushima P., McAhren S.,
RA   McHenney M., McLeaster K., Mundy C., Nicas T.I., Norris F.H., O'Gara M.,
RA   Peery R., Robertson G.T., Rockey P., Sun P.-M., Winkler M.E., Yang Y.,
RA   Young-Bellido M., Zhao G., Zook C., Baltz R.H., Jaskunas S.Richard.,
RA   Rosteck P.R.Jr., Skatrud P.L., Glass J.I.;
RT   ;
RL   Submitted (27-JUL-2001) to the INSDC.
RL   Infectious Diseases Research, Eli Lilly and Company, Lilly Research Labs,
RL   Indianapolis, IN 46285-0438, USA
XX
DR   MD5; 15d6aff3cc414f2abf5e0277d8d9d0f4.
DR   BioSample; SAMN02603218.
DR   EnsemblGenomes-Gn; EBG00001194453.
DR   EnsemblGenomes-Gn; EBG00001194454.
DR   EnsemblGenomes-Gn; EBG00001194455.
DR   EnsemblGenomes-Gn; EBG00001194456.
DR   EnsemblGenomes-Gn; EBG00001194457.
DR   EnsemblGenomes-Gn; EBG00001194458.
DR   EnsemblGenomes-Gn; EBG00001194459.
DR   EnsemblGenomes-Gn; EBG00001194460.
DR   EnsemblGenomes-Gn; EBG00001194461.
DR   EnsemblGenomes-Gn; EBG00001194462.
DR   EnsemblGenomes-Gn; EBG00001194463.
DR   EnsemblGenomes-Gn; EBG00001194464.
DR   EnsemblGenomes-Gn; EBG00001194465.
DR   EnsemblGenomes-Gn; EBG00001194466.
DR   EnsemblGenomes-Gn; EBG00001194467.
DR   EnsemblGenomes-Gn; EBG00001194468.
DR   EnsemblGenomes-Gn; EBG00001194469.
DR   EnsemblGenomes-Gn; EBG00001194470.
DR   EnsemblGenomes-Gn; EBG00001194471.
DR   EnsemblGenomes-Gn; EBG00001194472.
DR   EnsemblGenomes-Gn; EBG00001194473.
DR   EnsemblGenomes-Gn; EBG00001194474.
DR   EnsemblGenomes-Gn; EBG00001194475.
DR   EnsemblGenomes-Gn; EBG00001194476.
DR   EnsemblGenomes-Gn; EBG00001194477.
DR   EnsemblGenomes-Gn; EBG00001194478.
DR   EnsemblGenomes-Gn; EBG00001194479.
DR   EnsemblGenomes-Gn; EBG00001194480.
DR   EnsemblGenomes-Gn; EBG00001194481.
DR   EnsemblGenomes-Gn; EBG00001194482.
DR   EnsemblGenomes-Gn; EBG00001194483.
DR   EnsemblGenomes-Gn; EBG00001194484.
DR   EnsemblGenomes-Gn; EBG00001194485.
DR   EnsemblGenomes-Gn; EBG00001194486.
DR   EnsemblGenomes-Gn; EBG00001194487.
DR   EnsemblGenomes-Gn; EBG00001194488.
DR   EnsemblGenomes-Gn; EBG00001194489.
DR   EnsemblGenomes-Gn; EBG00001194490.
DR   EnsemblGenomes-Gn; EBG00001194491.
DR   EnsemblGenomes-Gn; EBG00001194492.
DR   EnsemblGenomes-Gn; EBG00001194493.
DR   EnsemblGenomes-Gn; EBG00001194494.
DR   EnsemblGenomes-Gn; EBG00001194495.
DR   EnsemblGenomes-Gn; EBG00001194496.
DR   EnsemblGenomes-Gn; EBG00001194497.
DR   EnsemblGenomes-Gn; EBG00001194498.
DR   EnsemblGenomes-Gn; EBG00001194499.
DR   EnsemblGenomes-Gn; EBG00001194500.
DR   EnsemblGenomes-Gn; EBG00001194501.
DR   EnsemblGenomes-Gn; EBG00001194502.
DR   EnsemblGenomes-Gn; EBG00001194503.
DR   EnsemblGenomes-Gn; EBG00001194504.
DR   EnsemblGenomes-Gn; EBG00001194505.
DR   EnsemblGenomes-Gn; EBG00001194506.
DR   EnsemblGenomes-Gn; EBG00001194507.
DR   EnsemblGenomes-Gn; EBG00001194508.
DR   EnsemblGenomes-Gn; EBG00001194509.
DR   EnsemblGenomes-Gn; EBG00001194510.
DR   EnsemblGenomes-Gn; EBG00001194511.
DR   EnsemblGenomes-Gn; EBG00001194512.
DR   EnsemblGenomes-Gn; EBG00001194513.
DR   EnsemblGenomes-Gn; EBG00001194514.
DR   EnsemblGenomes-Gn; EBG00001194515.
DR   EnsemblGenomes-Gn; EBG00001194516.
DR   EnsemblGenomes-Gn; EBG00001194517.
DR   EnsemblGenomes-Gn; EBG00001194518.
DR   EnsemblGenomes-Gn; EBG00001194519.
DR   EnsemblGenomes-Gn; EBG00001194520.
DR   EnsemblGenomes-Gn; EBG00001194521.
DR   EnsemblGenomes-Gn; EBG00001194522.
DR   EnsemblGenomes-Gn; EBG00001194523.
DR   EnsemblGenomes-Gn; EBG00001194524.
DR   EnsemblGenomes-Gn; EBG00001194525.
DR   EnsemblGenomes-Gn; EBG00001194526.
DR   EnsemblGenomes-Gn; EBG00001194527.
DR   EnsemblGenomes-Gn; EBG00001194528.
DR   EnsemblGenomes-Gn; EBG00001194529.
DR   EnsemblGenomes-Gn; EBG00001194530.
DR   EnsemblGenomes-Gn; EBG00001194531.
DR   EnsemblGenomes-Gn; EBG00001194532.
DR   EnsemblGenomes-Gn; EBG00001194533.
DR   EnsemblGenomes-Gn; EBG00001194534.
DR   EnsemblGenomes-Gn; EBG00001194535.
DR   EnsemblGenomes-Gn; EBG00001194536.
DR   EnsemblGenomes-Gn; EBG00001194537.
DR   EnsemblGenomes-Gn; EBG00001194538.
DR   EnsemblGenomes-Gn; EBG00001194539.
DR   EnsemblGenomes-Gn; EBG00001194540.
DR   EnsemblGenomes-Gn; EBG00001194541.
DR   EnsemblGenomes-Gn; EBG00001194542.
DR   EnsemblGenomes-Gn; EBG00001194543.
DR   EnsemblGenomes-Gn; EBG00001194544.
DR   EnsemblGenomes-Gn; EBG00001194545.
DR   EnsemblGenomes-Gn; EBG00001194546.
DR   EnsemblGenomes-Gn; EBG00001194547.
DR   EnsemblGenomes-Gn; EBG00001194548.
DR   EnsemblGenomes-Gn; EBG00001194549.
DR   EnsemblGenomes-Gn; EBG00001194550.
DR   EnsemblGenomes-Gn; EBG00001194551.
DR   EnsemblGenomes-Gn; EBG00001194552.
DR   EnsemblGenomes-Gn; EBG00001194553.
DR   EnsemblGenomes-Gn; EBG00001194554.
DR   EnsemblGenomes-Gn; EBG00001194555.
DR   EnsemblGenomes-Gn; EBG00001194556.
DR   EnsemblGenomes-Gn; EBG00001194557.
DR   EnsemblGenomes-Gn; EBG00001194558.
DR   EnsemblGenomes-Gn; EBG00001194559.
DR   EnsemblGenomes-Gn; EBG00001194560.
DR   EnsemblGenomes-Gn; EBG00001194561.
DR   EnsemblGenomes-Gn; EBG00001194562.
DR   EnsemblGenomes-Gn; EBG00001194563.
DR   EnsemblGenomes-Gn; EBG00001194564.
DR   EnsemblGenomes-Gn; sprr01.
DR   EnsemblGenomes-Gn; sprr02.
DR   EnsemblGenomes-Gn; sprr03.
DR   EnsemblGenomes-Gn; sprr04.
DR   EnsemblGenomes-Gn; sprr05.
DR   EnsemblGenomes-Gn; sprr06.
DR   EnsemblGenomes-Gn; sprr07.
DR   EnsemblGenomes-Gn; sprr08.
DR   EnsemblGenomes-Gn; sprr09.
DR   EnsemblGenomes-Gn; sprr10.
DR   EnsemblGenomes-Gn; sprr11.
DR   EnsemblGenomes-Gn; sprr12.
DR   EnsemblGenomes-Gn; sprs01.
DR   EnsemblGenomes-Gn; sprs02.
DR   EnsemblGenomes-Gn; sprs03.
DR   EnsemblGenomes-Gn; sprt01.
DR   EnsemblGenomes-Gn; sprt02.
DR   EnsemblGenomes-Gn; sprt03.
DR   EnsemblGenomes-Gn; sprt04.
DR   EnsemblGenomes-Gn; sprt05.
DR   EnsemblGenomes-Gn; sprt06.
DR   EnsemblGenomes-Gn; sprt07.
DR   EnsemblGenomes-Gn; sprt08.
DR   EnsemblGenomes-Gn; sprt09.
DR   EnsemblGenomes-Gn; sprt10.
DR   EnsemblGenomes-Gn; sprt11.
DR   EnsemblGenomes-Gn; sprt12.
DR   EnsemblGenomes-Gn; sprt13.
DR   EnsemblGenomes-Gn; sprt14.
DR   EnsemblGenomes-Gn; sprt15.
DR   EnsemblGenomes-Gn; sprt16.
DR   EnsemblGenomes-Gn; sprt17.
DR   EnsemblGenomes-Gn; sprt18.
DR   EnsemblGenomes-Gn; sprt19.
DR   EnsemblGenomes-Gn; sprt20.
DR   EnsemblGenomes-Gn; sprt21.
DR   EnsemblGenomes-Gn; sprt22.
DR   EnsemblGenomes-Gn; sprt23.
DR   EnsemblGenomes-Gn; sprt24.
DR   EnsemblGenomes-Gn; sprt25.
DR   EnsemblGenomes-Gn; sprt26.
DR   EnsemblGenomes-Gn; sprt27.
DR   EnsemblGenomes-Gn; sprt28.
DR   EnsemblGenomes-Gn; sprt29.
DR   EnsemblGenomes-Gn; sprt30.
DR   EnsemblGenomes-Gn; sprt31.
DR   EnsemblGenomes-Gn; sprt32.
DR   EnsemblGenomes-Gn; sprt33.
DR   EnsemblGenomes-Gn; sprt34.
DR   EnsemblGenomes-Gn; sprt35.
DR   EnsemblGenomes-Gn; sprt36.
DR   EnsemblGenomes-Gn; sprt37.
DR   EnsemblGenomes-Gn; sprt38.
DR   EnsemblGenomes-Gn; sprt39.
DR   EnsemblGenomes-Gn; sprt40.
DR   EnsemblGenomes-Gn; sprt41.
DR   EnsemblGenomes-Gn; sprt42.
DR   EnsemblGenomes-Gn; sprt43.
DR   EnsemblGenomes-Gn; sprt44.
DR   EnsemblGenomes-Gn; sprt45.
DR   EnsemblGenomes-Gn; sprt46.
DR   EnsemblGenomes-Gn; sprt47.
DR   EnsemblGenomes-Gn; sprt48.
DR   EnsemblGenomes-Gn; sprt49.
DR   EnsemblGenomes-Gn; sprt50.
DR   EnsemblGenomes-Gn; sprt51.
DR   EnsemblGenomes-Gn; sprt52.
DR   EnsemblGenomes-Gn; sprt53.
DR   EnsemblGenomes-Gn; sprt54.
DR   EnsemblGenomes-Gn; sprt55.
DR   EnsemblGenomes-Gn; sprt56.
DR   EnsemblGenomes-Gn; sprt57.
DR   EnsemblGenomes-Gn; sprt58.
DR   EnsemblGenomes-Tr; EBT00001772707.
DR   EnsemblGenomes-Tr; EBT00001772708.
DR   EnsemblGenomes-Tr; EBT00001772709.
DR   EnsemblGenomes-Tr; EBT00001772710.
DR   EnsemblGenomes-Tr; EBT00001772711.
DR   EnsemblGenomes-Tr; EBT00001772712.
DR   EnsemblGenomes-Tr; EBT00001772713.
DR   EnsemblGenomes-Tr; EBT00001772714.
DR   EnsemblGenomes-Tr; EBT00001772715.
DR   EnsemblGenomes-Tr; EBT00001772716.
DR   EnsemblGenomes-Tr; EBT00001772717.
DR   EnsemblGenomes-Tr; EBT00001772718.
DR   EnsemblGenomes-Tr; EBT00001772719.
DR   EnsemblGenomes-Tr; EBT00001772720.
DR   EnsemblGenomes-Tr; EBT00001772721.
DR   EnsemblGenomes-Tr; EBT00001772722.
DR   EnsemblGenomes-Tr; EBT00001772723.
DR   EnsemblGenomes-Tr; EBT00001772724.
DR   EnsemblGenomes-Tr; EBT00001772725.
DR   EnsemblGenomes-Tr; EBT00001772726.
DR   EnsemblGenomes-Tr; EBT00001772727.
DR   EnsemblGenomes-Tr; EBT00001772728.
DR   EnsemblGenomes-Tr; EBT00001772729.
DR   EnsemblGenomes-Tr; EBT00001772730.
DR   EnsemblGenomes-Tr; EBT00001772731.
DR   EnsemblGenomes-Tr; EBT00001772732.
DR   EnsemblGenomes-Tr; EBT00001772733.
DR   EnsemblGenomes-Tr; EBT00001772734.
DR   EnsemblGenomes-Tr; EBT00001772735.
DR   EnsemblGenomes-Tr; EBT00001772736.
DR   EnsemblGenomes-Tr; EBT00001772737.
DR   EnsemblGenomes-Tr; EBT00001772738.
DR   EnsemblGenomes-Tr; EBT00001772739.
DR   EnsemblGenomes-Tr; EBT00001772740.
DR   EnsemblGenomes-Tr; EBT00001772741.
DR   EnsemblGenomes-Tr; EBT00001772742.
DR   EnsemblGenomes-Tr; EBT00001772743.
DR   EnsemblGenomes-Tr; EBT00001772744.
DR   EnsemblGenomes-Tr; EBT00001772745.
DR   EnsemblGenomes-Tr; EBT00001772746.
DR   EnsemblGenomes-Tr; EBT00001772747.
DR   EnsemblGenomes-Tr; EBT00001772748.
DR   EnsemblGenomes-Tr; EBT00001772749.
DR   EnsemblGenomes-Tr; EBT00001772750.
DR   EnsemblGenomes-Tr; EBT00001772751.
DR   EnsemblGenomes-Tr; EBT00001772752.
DR   EnsemblGenomes-Tr; EBT00001772753.
DR   EnsemblGenomes-Tr; EBT00001772754.
DR   EnsemblGenomes-Tr; EBT00001772755.
DR   EnsemblGenomes-Tr; EBT00001772756.
DR   EnsemblGenomes-Tr; EBT00001772757.
DR   EnsemblGenomes-Tr; EBT00001772758.
DR   EnsemblGenomes-Tr; EBT00001772759.
DR   EnsemblGenomes-Tr; EBT00001772760.
DR   EnsemblGenomes-Tr; EBT00001772761.
DR   EnsemblGenomes-Tr; EBT00001772762.
DR   EnsemblGenomes-Tr; EBT00001772763.
DR   EnsemblGenomes-Tr; EBT00001772764.
DR   EnsemblGenomes-Tr; EBT00001772765.
DR   EnsemblGenomes-Tr; EBT00001772766.
DR   EnsemblGenomes-Tr; EBT00001772767.
DR   EnsemblGenomes-Tr; EBT00001772768.
DR   EnsemblGenomes-Tr; EBT00001772769.
DR   EnsemblGenomes-Tr; EBT00001772770.
DR   EnsemblGenomes-Tr; EBT00001772771.
DR   EnsemblGenomes-Tr; EBT00001772772.
DR   EnsemblGenomes-Tr; EBT00001772773.
DR   EnsemblGenomes-Tr; EBT00001772774.
DR   EnsemblGenomes-Tr; EBT00001772775.
DR   EnsemblGenomes-Tr; EBT00001772776.
DR   EnsemblGenomes-Tr; EBT00001772777.
DR   EnsemblGenomes-Tr; EBT00001772778.
DR   EnsemblGenomes-Tr; EBT00001772779.
DR   EnsemblGenomes-Tr; EBT00001772780.
DR   EnsemblGenomes-Tr; EBT00001772781.
DR   EnsemblGenomes-Tr; EBT00001772782.
DR   EnsemblGenomes-Tr; EBT00001772783.
DR   EnsemblGenomes-Tr; EBT00001772784.
DR   EnsemblGenomes-Tr; EBT00001772785.
DR   EnsemblGenomes-Tr; EBT00001772786.
DR   EnsemblGenomes-Tr; EBT00001772787.
DR   EnsemblGenomes-Tr; EBT00001772788.
DR   EnsemblGenomes-Tr; EBT00001772789.
DR   EnsemblGenomes-Tr; EBT00001772790.
DR   EnsemblGenomes-Tr; EBT00001772791.
DR   EnsemblGenomes-Tr; EBT00001772792.
DR   EnsemblGenomes-Tr; EBT00001772793.
DR   EnsemblGenomes-Tr; EBT00001772794.
DR   EnsemblGenomes-Tr; EBT00001772795.
DR   EnsemblGenomes-Tr; EBT00001772796.
DR   EnsemblGenomes-Tr; EBT00001772797.
DR   EnsemblGenomes-Tr; EBT00001772798.
DR   EnsemblGenomes-Tr; EBT00001772799.
DR   EnsemblGenomes-Tr; EBT00001772800.
DR   EnsemblGenomes-Tr; EBT00001772801.
DR   EnsemblGenomes-Tr; EBT00001772802.
DR   EnsemblGenomes-Tr; EBT00001772803.
DR   EnsemblGenomes-Tr; EBT00001772804.
DR   EnsemblGenomes-Tr; EBT00001772805.
DR   EnsemblGenomes-Tr; EBT00001772806.
DR   EnsemblGenomes-Tr; EBT00001772807.
DR   EnsemblGenomes-Tr; EBT00001772808.
DR   EnsemblGenomes-Tr; EBT00001772809.
DR   EnsemblGenomes-Tr; EBT00001772810.
DR   EnsemblGenomes-Tr; EBT00001772811.
DR   EnsemblGenomes-Tr; EBT00001772812.
DR   EnsemblGenomes-Tr; EBT00001772813.
DR   EnsemblGenomes-Tr; EBT00001772814.
DR   EnsemblGenomes-Tr; EBT00001772815.
DR   EnsemblGenomes-Tr; EBT00001772816.
DR   EnsemblGenomes-Tr; EBT00001772817.
DR   EnsemblGenomes-Tr; EBT00001772818.
DR   EnsemblGenomes-Tr; sprr01-1.
DR   EnsemblGenomes-Tr; sprr02-1.
DR   EnsemblGenomes-Tr; sprr03-1.
DR   EnsemblGenomes-Tr; sprr04-1.
DR   EnsemblGenomes-Tr; sprr05-1.
DR   EnsemblGenomes-Tr; sprr06-1.
DR   EnsemblGenomes-Tr; sprr07-1.
DR   EnsemblGenomes-Tr; sprr08-1.
DR   EnsemblGenomes-Tr; sprr09-1.
DR   EnsemblGenomes-Tr; sprr10-1.
DR   EnsemblGenomes-Tr; sprr11-1.
DR   EnsemblGenomes-Tr; sprr12-1.
DR   EnsemblGenomes-Tr; sprs01-1.
DR   EnsemblGenomes-Tr; sprs02-1.
DR   EnsemblGenomes-Tr; sprs03-1.
DR   EnsemblGenomes-Tr; sprt01-1.
DR   EnsemblGenomes-Tr; sprt02-1.
DR   EnsemblGenomes-Tr; sprt03-1.
DR   EnsemblGenomes-Tr; sprt04-1.
DR   EnsemblGenomes-Tr; sprt05-1.
DR   EnsemblGenomes-Tr; sprt06-1.
DR   EnsemblGenomes-Tr; sprt07-1.
DR   EnsemblGenomes-Tr; sprt08-1.
DR   EnsemblGenomes-Tr; sprt09-1.
DR   EnsemblGenomes-Tr; sprt10-1.
DR   EnsemblGenomes-Tr; sprt11-1.
DR   EnsemblGenomes-Tr; sprt12-1.
DR   EnsemblGenomes-Tr; sprt13-1.
DR   EnsemblGenomes-Tr; sprt14-1.
DR   EnsemblGenomes-Tr; sprt15-1.
DR   EnsemblGenomes-Tr; sprt16-1.
DR   EnsemblGenomes-Tr; sprt17-1.
DR   EnsemblGenomes-Tr; sprt18-1.
DR   EnsemblGenomes-Tr; sprt19-1.
DR   EnsemblGenomes-Tr; sprt20-1.
DR   EnsemblGenomes-Tr; sprt21-1.
DR   EnsemblGenomes-Tr; sprt22-1.
DR   EnsemblGenomes-Tr; sprt23-1.
DR   EnsemblGenomes-Tr; sprt24-1.
DR   EnsemblGenomes-Tr; sprt25-1.
DR   EnsemblGenomes-Tr; sprt26-1.
DR   EnsemblGenomes-Tr; sprt27-1.
DR   EnsemblGenomes-Tr; sprt28-1.
DR   EnsemblGenomes-Tr; sprt29-1.
DR   EnsemblGenomes-Tr; sprt30-1.
DR   EnsemblGenomes-Tr; sprt31-1.
DR   EnsemblGenomes-Tr; sprt32-1.
DR   EnsemblGenomes-Tr; sprt33-1.
DR   EnsemblGenomes-Tr; sprt34-1.
DR   EnsemblGenomes-Tr; sprt35-1.
DR   EnsemblGenomes-Tr; sprt36-1.
DR   EnsemblGenomes-Tr; sprt37-1.
DR   EnsemblGenomes-Tr; sprt38-1.
DR   EnsemblGenomes-Tr; sprt39-1.
DR   EnsemblGenomes-Tr; sprt40-1.
DR   EnsemblGenomes-Tr; sprt41-1.
DR   EnsemblGenomes-Tr; sprt42-1.
DR   EnsemblGenomes-Tr; sprt43-1.
DR   EnsemblGenomes-Tr; sprt44-1.
DR   EnsemblGenomes-Tr; sprt45-1.
DR   EnsemblGenomes-Tr; sprt46-1.
DR   EnsemblGenomes-Tr; sprt47-1.
DR   EnsemblGenomes-Tr; sprt48-1.
DR   EnsemblGenomes-Tr; sprt49-1.
DR   EnsemblGenomes-Tr; sprt50-1.
DR   EnsemblGenomes-Tr; sprt51-1.
DR   EnsemblGenomes-Tr; sprt52-1.
DR   EnsemblGenomes-Tr; sprt53-1.
DR   EnsemblGenomes-Tr; sprt54-1.
DR   EnsemblGenomes-Tr; sprt55-1.
DR   EnsemblGenomes-Tr; sprt56-1.
DR   EnsemblGenomes-Tr; sprt57-1.
DR   EnsemblGenomes-Tr; sprt58-1.
DR   EuropePMC; PMC1112048; 15901699.
DR   EuropePMC; PMC1140415; 15897461.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC1317417; 16332865.
DR   EuropePMC; PMC1386717; 16423288.
DR   EuropePMC; PMC141814; 12486041.
DR   EuropePMC; PMC1855495; 17261623.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2074928; 17660309.
DR   EuropePMC; PMC2168654; 17675389.
DR   EuropePMC; PMC2168755; 17766420.
DR   EuropePMC; PMC2648205; 19114491.
DR   EuropePMC; PMC2678160; 19361343.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2788362; 19958473.
DR   EuropePMC; PMC2807444; 20042094.
DR   EuropePMC; PMC2863574; 20233933.
DR   EuropePMC; PMC2874796; 20426878.
DR   EuropePMC; PMC2885674; 19423627.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3043496; 21147955.
DR   EuropePMC; PMC3067147; 21263055.
DR   EuropePMC; PMC3165651; 21764929.
DR   EuropePMC; PMC3279804; 22347584.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC3343019; 22570729.
DR   EuropePMC; PMC3372098; 22442329.
DR   EuropePMC; PMC3384302; 22373923.
DR   EuropePMC; PMC3416215; 22661692.
DR   EuropePMC; PMC3416792; 22900070.
DR   EuropePMC; PMC3578082; 23168398.
DR   EuropePMC; PMC3726389; 23879707.
DR   EuropePMC; PMC3828180; 24244172.
DR   EuropePMC; PMC3911122; 24142257.
DR   EuropePMC; PMC4012785; 24751142.
DR   EuropePMC; PMC4023712; 24492357.
DR   EuropePMC; PMC403657; 12799345.
DR   EuropePMC; PMC4187955; 25070090.
DR   EuropePMC; PMC4190663; 25268848.
DR   EuropePMC; PMC4263131; 25407023.
DR   EuropePMC; PMC4432121; 25779578.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4471560; 26081630.
DR   EuropePMC; PMC4719686; 26785630.
DR   EuropePMC; PMC5158041; 27977735.
DR   EuropePMC; PMC5192475; 28050252.
DR   EuropePMC; PMC532437; 15576764.
DR   EuropePMC; PMC5361624; 28348877.
DR   EuropePMC; PMC5673960; 29109543.
DR   EuropePMC; PMC5869694; 29588455.
DR   EuropePMC; PMC95463; 11544234.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; AE007317.
DR   SILVA-SSU; AE007317.
DR   StrainInfo; 269575; 0.
XX
CC   On or before Feb 19, 2009 this sequence version replaced
CC   gi:15457528, gi:15457541, gi:15457554, gi:15457565, gi:15457577,
CC   gi:15457585, gi:15457597, gi:15457610, gi:15457625, gi:15457637,
CC   gi:15457647, gi:15457659, gi:15457673, gi:15457685, gi:15457698,
CC   gi:15457711, gi:15457723, gi:15457736, gi:15457762, gi:15457775,
CC   gi:15457785, gi:15457794, gi:15457801, gi:15457814, gi:15457829,
CC   gi:15457839, gi:15457852, gi:15457864, gi:15457879, gi:15457885,
CC   gi:15457895, gi:15457912, gi:15457923, gi:15457935, gi:15457949,
CC   gi:15457963, gi:15457975, gi:15457985, gi:15457993, gi:15458005,
CC   gi:15458012, gi:15458023, gi:15458039, gi:15458055, gi:15458068,
CC   gi:15458081, gi:15458092, gi:15458105, gi:15458117, gi:15458131,
CC   gi:15458139, gi:15458144, gi:15458159, gi:15458165, gi:15458181,
CC   gi:15458191, gi:15458208, gi:15458223, gi:15458234, gi:15458250,
CC   gi:15458259, gi:15458272, gi:15458286, gi:15458301, gi:15458310,
CC   gi:15458326, gi:15458341, gi:15458352, gi:15458366, gi:15458377,
CC   gi:15458389, gi:15458394, gi:15458407, gi:15458419, gi:15458433,
CC   gi:15458447, gi:15458463, gi:15458482, gi:15458495, gi:15458511,
CC   gi:15458521, gi:15458539, gi:15458552, gi:15458565, gi:15458572,
CC   gi:15458583, gi:15458591, gi:15458603, gi:15458614, gi:15458628,
CC   gi:15458642, gi:15458651, gi:15458661, gi:15458666, gi:15458677,
CC   gi:15458686, gi:15458699, gi:15458713, gi:15458724, gi:15458734,
CC   gi:15458746, gi:15458755, gi:15458769, gi:15458782, gi:15458792,
CC   gi:15458806, gi:15458821, gi:15458832, gi:15458840, gi:15458855,
CC   gi:15458866, gi:15458877, gi:15458888, gi:15458902, gi:15458915,
CC   gi:15458926, gi:15458936, gi:15458952, gi:15458968, gi:15458979,
CC   gi:15458993, gi:15459008, gi:15459019, gi:15459031, gi:15459044,
CC   gi:15459055, gi:15459064, gi:15459068, gi:15459084, gi:15459095,
CC   gi:15459108, gi:15459122, gi:15459138, gi:15459151, gi:15459161,
CC   gi:15459173, gi:15459185, gi:15459197, gi:15459208, gi:15459223,
CC   gi:15459237, gi:15459250, gi:15459265, gi:15459280, gi:15459292,
CC   gi:15459309, gi:15459324, gi:15459334, gi:15459346, gi:15459358,
CC   gi:15459372, gi:15459384, gi:15459393, gi:15459398, gi:15459416,
CC   gi:15459434, gi:15459445, gi:15459456, gi:15459462, gi:15459478,
CC   gi:15459491, gi:15459504, gi:15459511, gi:15459525, gi:15459533,
CC   gi:15459548, gi:15459560, gi:15459571, gi:15459578, gi:15459588,
CC   gi:15459602, gi:15459611, gi:15459619, gi:15459633, gi:15459644,
CC   gi:15459654, gi:15459664, gi:15459674, gi:15459685, gi:15459696,
CC   gi:15459710, gi:15459721, gi:15459737, gi:15459747.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2038615
FT                   /organism="Streptococcus pneumoniae R6"
FT                   /strain="R6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:171101"
FT   gene            1..1362
FT                   /gene="dnaA"
FT                   /locus_tag="spr0001"
FT   CDS_pept        1..1362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="spr0001"
FT                   /product="DNA biosynthesis, initiation, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98805"
FT                   /db_xref="GOA:Q8DRQ4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRQ4"
FT                   /protein_id="AAK98805.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1521..2657
FT                   /gene="dnaN"
FT                   /locus_tag="spr0002"
FT   CDS_pept        1521..2657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="spr0002"
FT                   /product="DNA biosynthesis; sliding clamp subunit, required
FT                   for high processivity; DNA polymerase III beta-subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:spr0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98806"
FT                   /db_xref="GOA:P59651"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59651"
FT                   /protein_id="AAK98806.1"
FT                   /translation="MIHFSINKNLFLQALNITKRAISSKNAIPILSTVKIDVTNEGVTL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2722..2916
FT                   /locus_tag="spr0003"
FT   CDS_pept        2722..2916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0003"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98807"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZD3"
FT                   /protein_id="AAK98807.1"
FT                   /translation="MYQVGNFVEMKKPHACTIKSTGKKANRWEITRVGADIKIKCSNCE
FT                   HVVMMGRYDFERKMNKIID"
FT   gene            3000..4115
FT                   /locus_tag="spr0004"
FT   CDS_pept        3000..4115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0004"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98808"
FT                   /db_xref="GOA:Q8DRQ3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRQ3"
FT                   /protein_id="AAK98808.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            4186..4755
FT                   /gene="pth"
FT                   /locus_tag="spr0005"
FT   CDS_pept        4186..4755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="spr0005"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:spr0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98809"
FT                   /db_xref="GOA:Q8DRQ2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRQ2"
FT                   /protein_id="AAK98809.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQS
FT                   IDKVDDSVNYYLQEKKFEKTMQRYNG"
FT   gene            4756..8265
FT                   /gene="mfd"
FT                   /locus_tag="spr0006"
FT   CDS_pept        4756..8265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="spr0006"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98810"
FT                   /db_xref="GOA:Q8DRQ1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="PDB:2QSR"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRQ1"
FT                   /protein_id="AAK98810.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTSICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKEIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNVDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQGYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEK
FT                   NSI"
FT   gene            8323..8589
FT                   /locus_tag="spr0007"
FT   CDS_pept        8323..8589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0007"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98811"
FT                   /db_xref="GOA:P64406"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64406"
FT                   /protein_id="AAK98811.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            8582..8950
FT                   /locus_tag="spr0008"
FT   CDS_pept        8582..8950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0008"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98812"
FT                   /db_xref="GOA:Q8CZD2"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZD2"
FT                   /protein_id="AAK98812.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9001..10338
FT                   /locus_tag="spr0009"
FT   CDS_pept        9001..10338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0009"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRQ0"
FT                   /protein_id="AAK98813.1"
FT                   /translation="MKSWKNWLIKINYCVYKKKRKGRMRKFLIILLLPSFLTISKVVST
FT                   EKEVVYTSKEIYYLSQSDFGIYFREKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQI
FT                   TEWRLNKQGIPVFKLSNHQFIAADKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEV
FT                   KSSLSAYSQVSIDKTMFVEGREFLHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDS
FT                   FSIYVKQLTTGKEAGINQDEKMYAASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVND
FT                   FPGSYKPEGSGSLPKKEDNKEYSLKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKM
FT                   SAIMGDDWDPKEKLISSKMAGKFMEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHK
FT                   IGDADEFKHDTGVVYADSPFILSIFTKNSDYDTISKIAKDVYEVLK"
FT   gene            10335..11612
FT                   /locus_tag="spr0010"
FT   CDS_pept        10335..11612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0010"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative cell cycle protein of the MesJ/Ycf62
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:spr0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98814"
FT                   /db_xref="GOA:Q8DRP9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRP9"
FT                   /protein_id="AAK98814.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKFKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEGELIQQI
FT                   PVSRETSIHIRHRKTGDVLIKNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            11616..12158
FT                   /gene="hgt"
FT                   /locus_tag="spr0011"
FT   CDS_pept        11616..12158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgt"
FT                   /locus_tag="spr0011"
FT                   /product="Hypoxanthine guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:spr0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98815"
FT                   /db_xref="GOA:Q8DRP8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRP8"
FT                   /protein_id="AAK98815.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKEREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12174..14132
FT                   /gene="ftsH"
FT                   /locus_tag="spr0012"
FT   CDS_pept        12174..14132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="spr0012"
FT                   /product="Cell-division protein / general stress protein
FT                   (class III heat-shock)"
FT                   /EC_number="3.4.24.-"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98816"
FT                   /db_xref="GOA:P59652"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59652"
FT                   /protein_id="AAK98816.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMLGAQSPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14254..14733
FT                   /gene="comX1"
FT                   /locus_tag="spr0013"
FT   CDS_pept        14254..14733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1"
FT                   /locus_tag="spr0013"
FT                   /product="Competence-specific global transcription
FT                   modulator"
FT                   /note="Putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98817"
FT                   /db_xref="GOA:Q8CM18"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM18"
FT                   /protein_id="AAK98817.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   EGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            14827..14898
FT                   /locus_tag="sprt01"
FT                   /note="tRNA-Glu1"
FT   tRNA            14827..14898
FT                   /locus_tag="sprt01"
FT                   /product="tRNA-Glu"
FT   gene            15161..16674
FT                   /locus_tag="sprr01"
FT                   /note="rRNA_16S-1"
FT   rRNA            15161..16674
FT                   /locus_tag="sprr01"
FT                   /product="16S ribosomal RNA"
FT   gene            16748..16820
FT                   /locus_tag="sprt02"
FT                   /note="tRNA-Ala1"
FT   tRNA            16748..16820
FT                   /locus_tag="sprt02"
FT                   /product="tRNA-Ala"
FT   gene            16945..19846
FT                   /locus_tag="sprr02"
FT                   /note="rRNA_23S-1"
FT   rRNA            16945..19846
FT                   /locus_tag="sprr02"
FT                   /product="23S ribosomal RNA"
FT   gene            19924..20038
FT                   /locus_tag="sprr03"
FT                   /note="rRNA_5S-1"
FT   rRNA            19924..20038
FT                   /locus_tag="sprr03"
FT                   /product="5S ribosomal RNA"
FT   gene            20044..20117
FT                   /locus_tag="sprt03"
FT                   /note="tRNA-Asn1"
FT   tRNA            20044..20117
FT                   /locus_tag="sprt03"
FT                   /product="tRNA-Asn"
FT   gene            20207..20554
FT                   /locus_tag="spr0014"
FT                   /note="transposase A"
FT   CDS_pept        20207..20554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0014"
FT                   /product="Transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98818"
FT                   /db_xref="GOA:Q8CM37"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM37"
FT                   /protein_id="AAK98818.1"
FT                   /translation="MWYNLFMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKEPHLL"
FT   gene            complement(20593..20751)
FT                   /locus_tag="spr0015"
FT   CDS_pept        complement(20593..20751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0015"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98819"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZD1"
FT                   /protein_id="AAK98819.1"
FT                   /translation="MLDLQPKKSSDIFFQILYLLLTDLLMSDHILDKNKYRILFHQSKQ
FT                   VLGALNY"
FT   gene            20733..21071
FT                   /locus_tag="spr0016"
FT                   /note="transposase B"
FT   CDS_pept        20733..21071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0016"
FT                   /product="Transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98820"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP7"
FT                   /protein_id="AAK98820.1"
FT                   /translation="MVAGLTNGELIAPMTYEEMVTSDFFEAWFQKFLLPTLTTPSVIIM
FT                   DNARFHRMGKLELLCEEFGHKLLPLPPYSPEYNPIEKTWAYIKKNLKKVLPSCNTFYEA
FT                   LFSCSCFN"
FT   gene            complement(21106..21312)
FT                   /locus_tag="spr0017"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(21106..21312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0017"
FT                   /product="Degenerate transposase (orf2)"
FT                   /note="SPR0017-0019 constitute an IS1167 element in which
FT                   the orf1 and orf2 components are degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:spr0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98821"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP6"
FT                   /protein_id="AAK98821.1"
FT                   /translation="MFKTFLKDKEKIVNALQLPYSNAKLEATNNLIKLIKHNAFGFRNF
FT                   ENFKKERTKFVLSRSSLSSTHYS"
FT   gene            complement(21455..21604)
FT                   /locus_tag="spr0018"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(21455..21604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0018"
FT                   /product="Degenerate transposase (orf2)"
FT                   /note="SPR0017-0019 constitute an IS1167 element in which
FT                   the orf1 and orf2 components are degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:spr0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP5"
FT                   /protein_id="AAK98822.1"
FT                   /translation="MEMSFIAQDFDKLNIITVLESRTQAIIRNPMNTRLSSATGSSFNK
FT                   IVRN"
FT   gene            complement(21645..21851)
FT                   /locus_tag="spr0019"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(21645..21851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0019"
FT                   /product="Degenerate transposase (orf1)"
FT                   /note="SPR0017-0019 constitute an IS1167 element in which
FT                   the orf1 and orf2 components are degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:spr0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP4"
FT                   /protein_id="AAK98823.1"
FT                   /translation="MELAETSIVKKNHQIPCIINQKIAQKLIEKTSMTDIDHQLSISTS
FT                   TVIRKINNFHFEHDFSRLPEIMS"
FT   gene            22162..22404
FT                   /locus_tag="spr0020"
FT   CDS_pept        22162..22404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0020"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98824"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZD0"
FT                   /protein_id="AAK98824.1"
FT                   /translation="MIMLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLV
FT                   RYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            22635..23921
FT                   /gene="purA"
FT                   /locus_tag="spr0021"
FT   CDS_pept        22635..23921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="spr0021"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98825"
FT                   /db_xref="GOA:P65888"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65888"
FT                   /protein_id="AAK98825.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEGVTTDNLRISDRAHV
FT                   ILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFRERLERN
FT                   LAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILNDALDNGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRNLEDLPENARNYVRR
FT                   VSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            24122..24589
FT                   /locus_tag="spr0022"
FT   CDS_pept        24122..24589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0022"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98826"
FT                   /db_xref="GOA:Q8DRP3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP3"
FT                   /protein_id="AAK98826.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYDILTDERLNHRVEVETGILEDECAAIMQDFFRNRRKK"
FT   gene            24631..24815
FT                   /gene="scRNA"
FT                   /locus_tag="sprs01"
FT   ncRNA           24631..24815
FT                   /gene="scRNA"
FT                   /locus_tag="sprs01"
FT                   /ncRNA_class="scRNA"
FT   gene            24776..25219
FT                   /gene="dut"
FT                   /locus_tag="spr0023"
FT   CDS_pept        24776..25219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="spr0023"
FT                   /product="Deoxyuridinetriphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:spr0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98827"
FT                   /db_xref="GOA:Q8DRP2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP2"
FT                   /protein_id="AAK98827.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            25158..25736
FT                   /locus_tag="spr0024"
FT   CDS_pept        25158..25736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0024"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98828"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRP1"
FT                   /protein_id="AAK98828.1"
FT                   /translation="MQMEMQLMAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGF
FT                   GIDLAPLSEMGRQQVQKLSKNPLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLL
FT                   HEWQVYKTGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVV
FT                   VVAHRMLMRQFVPNEKIDFCQVIECELEI"
FT   gene            25849..27111
FT                   /gene="radA"
FT                   /locus_tag="spr0025"
FT   CDS_pept        25849..27111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="spr0025"
FT                   /product="DNA repair: sensitivity to gamma and UV
FT                   radiation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98829"
FT                   /db_xref="GOA:Q8DRP0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:5LKM"
FT                   /db_xref="PDB:5LKQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRP0"
FT                   /protein_id="AAK98829.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            27115..27681
FT                   /locus_tag="spr0026"
FT   CDS_pept        27115..27681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0026"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98830"
FT                   /db_xref="GOA:Q8DRN9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN9"
FT                   /protein_id="AAK98830.1"
FT                   /translation="MTNSLKNDKIGEIFDYQIFKEGIVSYFEQFMQANQAYVALHGQLN
FT                   LPLKPKTRVAIVTCMDPRLHVAQALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGT
FT                   REIVVLHHTDCGAQTFENEPFQEYLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESP
FT                   LIPDDVIISGAIYNVDTGSMTVVEL"
FT   gene            27706..28365
FT                   /locus_tag="spr0027"
FT   CDS_pept        27706..28365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0027"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98831"
FT                   /db_xref="GOA:Q8CZC9"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC9"
FT                   /protein_id="AAK98831.1"
FT                   /translation="MKKSSILFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLA
FT                   LFYMIPALYFLFRIGKKWELPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDSP
FT                   FLNAFESAIVAPLVEEPLKLLPLVFVLALIPVRKLKFLFLLGIASGLGFQMIEDIGYIR
FT                   TDLPEGFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIV"
FT   gene            28583..29602
FT                   /gene="prsA"
FT                   /locus_tag="spr0028"
FT   CDS_pept        28583..29602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="spr0028"
FT                   /product="Phosphoribosylpyrophosphate synthase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98832"
FT                   /db_xref="GOA:P65240"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65240"
FT                   /protein_id="AAK98832.1"
FT                   /translation="MENLVKSTSDTYIPEEIMSFSDLKLFALSSNKELAERVAQEIGIE
FT                   LGKSSVRQFSDGEIQVNIEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESV
FT                   NVVMPYYGYARQDRKARAREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDH
FT                   LMGAPLIADYFERRGMVGSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNT
FT                   SEVMNIIGKVEGKTCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDN
FT                   IQKSAIKKLVVLDTIYLPEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(29624..30016)
FT                   /locus_tag="spr0029"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(29624..30016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0029"
FT                   /product="Degenerate transposase (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98833"
FT                   /db_xref="GOA:Q8DRN8"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN8"
FT                   /protein_id="AAK98833.1"
FT                   /translation="MEQLHFITKLLDIKDPNVQILNIINKDTHKEIIAKLDYDAPSCPE
FT                   CGNQLKKYDFQKPSKIPYLETTGIPTRILLRKRRFKCYHCSKMMVAETSDDVQSYFFSF
FT                   YYITVLNLALLDSPLLSIYSEKRRKT"
FT   gene            complement(30143..30481)
FT                   /locus_tag="spr0030"
FT   CDS_pept        complement(30143..30481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0030"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC8"
FT                   /protein_id="AAK98834.1"
FT                   /translation="MEFFGNKPFTQQPQRAITQANQLLDYKSWSEEDRKMFSQLHMREE
FT                   QVLLAQDYALETARAEDLEQGLERGKVEGRAERKLFTFLDIVRQGLLTSEVASQQLGMS
FT                   VSEFEALL"
FT   gene            complement(30700..31053)
FT                   /locus_tag="spr0031"
FT   CDS_pept        complement(30700..31053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC7"
FT                   /protein_id="AAK98835.1"
FT                   /translation="MILRHLGISPTNDLVAKKIFSNPEITCQFIRDMLDLPAKNVTILE
FT                   GSDIHVLLSMPYSVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQ
FT                   NLEKIHQREGDTH"
FT   repeat_region   complement(31068..31174)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            31306..33939
FT                   /gene="polA"
FT                   /locus_tag="spr0032"
FT   CDS_pept        31306..33939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="spr0032"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:spr0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98836"
FT                   /db_xref="GOA:P59200"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59200"
FT                   /protein_id="AAK98836.1"
FT                   /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAAGLHTNAIYGFQL
FT                   MLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMG
FT                   IRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVAEFE
FT                   AFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEHGSLEGIYEN
FT                   IDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGKFYDEM
FT                   GFKQLKQALNMSSADVAEGLDFTIVDQISQDMLSEESIFHFELFGENYHTDNLVGFAWS
FT                   CGDQLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAFDIRLAKY
FT                   LLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKLAVLVETEP
FT                   ILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIVVKKETLLEMQAENELVIEKLTQEI
FT                   YELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLAPIAPIVKKIL
FT                   DYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPARLEQGRL
FT                   IRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIER
FT                   PDNVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYFERFPGIKNYMDE
FT                   VVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGSAADILKIAMIQL
FT                   DKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQLSVPLIADENEGA
FT                   TWYEAK"
FT   gene            34024..34461
FT                   /locus_tag="spr0033"
FT   CDS_pept        34024..34461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0033"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98837"
FT                   /db_xref="GOA:Q8DRN7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN7"
FT                   /protein_id="AAK98837.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   repeat_region   complement(34493..34650)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            complement(34652..35674)
FT                   /locus_tag="spr0034"
FT   CDS_pept        complement(34652..35674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0034"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98838"
FT                   /db_xref="GOA:Q8DRN6"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRN6"
FT                   /protein_id="AAK98838.1"
FT                   /translation="MEVFMSFLSKNGAGILACLLISILSWYLGGFFPVIGAPVFAIFIG
FT                   MLLHPFLSSYKQLDAGLTFSSKKLLQYAVVLLGFGLNISQVFAVGQSSLPVILSTISIA
FT                   LIIAYLFQRFFALDTKLATLVGVGSSICGGSAIAATAPVIHAKEKEVAQAISVIFFFNV
FT                   LAALIFPTLGTWLHLSNEGFALFAGTAVNDTSSVTAAASAWDSLYQSNTLESATIVKLT
FT                   RTLAIIPITLFLSYWQSRQQENKQSLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFF
FT                   TPLKQLSKFLIVMAMSAIGLKTNLVAMVKSSGKSILLGAICWIAIILTTLGMQTLIGIF
FT                   "
FT   gene            35811..36980
FT                   /gene="aspC"
FT                   /locus_tag="spr0035"
FT   CDS_pept        35811..36980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="spr0035"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98839"
FT                   /db_xref="GOA:Q8DRN5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN5"
FT                   /protein_id="AAK98839.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQVISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPATFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            36977..37747
FT                   /locus_tag="spr0036"
FT   CDS_pept        36977..37747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0036"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98840"
FT                   /db_xref="GOA:Q8DRN4"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRN4"
FT                   /protein_id="AAK98840.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGTCLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            37744..38736
FT                   /gene="plsX"
FT                   /locus_tag="spr0037"
FT   CDS_pept        37744..38736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="spr0037"
FT                   /product="Involved in fatty acid/phospholipid synthesis"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98841"
FT                   /db_xref="GOA:Q8DRN3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRN3"
FT                   /protein_id="AAK98841.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            38742..38975
FT                   /gene="acpP"
FT                   /locus_tag="spr0038"
FT   CDS_pept        38742..38975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="spr0038"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98842"
FT                   /db_xref="GOA:Q8DRN2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN2"
FT                   /protein_id="AAK98842.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
FT   gene            39018..39311
FT                   /locus_tag="spr0039"
FT                   /note="IS1381-truncation"
FT   CDS_pept        39018..39311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0039"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98843"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN1"
FT                   /protein_id="AAK98843.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTVEDKAC
FT                   NHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            39514..39744
FT                   /gene="thmA"
FT                   /locus_tag="spr0040"
FT   CDS_pept        39514..39744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thmA"
FT                   /locus_tag="spr0040"
FT                   /product="Amphipathic pore-forming peptide precursor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98844"
FT                   /db_xref="GOA:Q8DRN0"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRN0"
FT                   /protein_id="AAK98844.1"
FT                   /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQL
FT                   GIKTRTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            complement(40224..40991)
FT                   /gene="IS1167"
FT                   /locus_tag="spr0041"
FT   CDS_pept        complement(40224..40991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IS1167"
FT                   /locus_tag="spr0041"
FT                   /product="Transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98845"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM9"
FT                   /protein_id="AAK98845.1"
FT                   /translation="MEMSFIAQDFEKLDIITVLEGRTQAIIRNHFLRYDRVVRCRVKII
FT                   TMDMFSPYYDLARQLFPCAKIVLDRFHIVQHLSRAMSRVRVQIMNQLDRKSHEYKAIKR
FT                   YWKLIQQDSRKLSDKHFYRPTFRMHLTNKEILDKLLSYSQDLKHHYQLYQLLLFHFQNK
FT                   EPEKFFGLIEDNLKQVHPLFQTVFKTFLKDKEKIVNALQLPYSNAKLEATNNLIKLIKR
FT                   NAFGFRNFENFKKRIFIALNIKKERTKFVLSRA"
FT   gene            complement(40982..41500)
FT                   /gene="IS1167"
FT                   /locus_tag="spr0042"
FT   CDS_pept        complement(40982..41500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IS1167"
FT                   /locus_tag="spr0042"
FT                   /product="Transposase (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98846"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM8"
FT                   /protein_id="AAK98846.1"
FT                   /translation="MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYDAPSCPE
FT                   CGNQLKKYDFQKPSKIPYLETTGMPTRILLRKRRFKCYHCSKMMVAETSIVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLSISTSTVIRKLNDFHFKHDFSRLPEIMSWEVETVRG
FT                   VTVSIGRWR"
FT   repeat_region   41732..41882
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            41902..44055
FT                   /gene="comA"
FT                   /locus_tag="spr0043"
FT   CDS_pept        41902..44055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="spr0043"
FT                   /product="Transport ATP-binding protein ComA"
FT                   /note="Competence induced protein ComA, with ComB is
FT                   responsible for secretion of CSP"
FT                   /db_xref="EnsemblGenomes-Gn:spr0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98847"
FT                   /db_xref="GOA:P59653"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59653"
FT                   /protein_id="AAK98847.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPHKEQKNGLLSFIPILVK
FT                   QRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYILQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGGVNLNQIDKKALRQYINYLPQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLIALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            44068..45417
FT                   /gene="comB"
FT                   /locus_tag="spr0044"
FT   CDS_pept        44068..45417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="spr0044"
FT                   /product="Transport protein ComB"
FT                   /note="Competence induced protein ComB, with ComA is
FT                   responsible for secretion of CSP"
FT                   /db_xref="EnsemblGenomes-Gn:spr0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98848"
FT                   /db_xref="GOA:P59654"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59654"
FT                   /protein_id="AAK98848.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAIETGTSLAGQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELSLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEGTLLAQL
FT                   YPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            45545..46294
FT                   /gene="purC"
FT                   /locus_tag="spr0045"
FT   CDS_pept        45545..46294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="spr0045"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthetase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98849"
FT                   /db_xref="GOA:Q8DRM7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRM7"
FT                   /protein_id="AAK98849.1"
FT                   /translation="MVKCAQVIRKANFKMSKQLIYSGKAKDIYTTEDENLIISTYKDQA
FT                   TAFNGVKKEQIAGKGVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEV
FT                   VLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIADDQQIAY
FT                   LKEEARRINELLKVWFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHM
FT                   DKDVFRRGLGELTDVYEIVWEKLQELK"
FT   gene            46493..50221
FT                   /gene="purL"
FT                   /locus_tag="spr0046"
FT   CDS_pept        46493..50221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="spr0046"
FT                   /product="Phosphoribosylformylglycinamide synthetase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98850"
FT                   /db_xref="GOA:Q8DRM6"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM6"
FT                   /protein_id="AAK98850.1"
FT                   /translation="MMDKRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDV
FT                   FDLAEDLFAPAEKHIFSEQGTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEA
FT                   LLLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSES
FT                   DKTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTY
FT                   WSDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFG
FT                   RYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAAT
FT                   CIGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQ
FT                   IGLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVG
FT                   GATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVA
FT                   IGELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDTFVAECNKENIDA
FT                   VVVATVTEKPNLVMHWNGETIVDLERRFLDINGVRVVVDAKVVDKDVKLPEERQTSAET
FT                   LESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGV
FT                   THTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWSKARFSYQEYFERMDKQ
FT                   AERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVL
FT                   SPEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEASQADHKVTSASAVKYGGVVESL
FT                   ALATFGNYIGAEVTLPELKTALTAQLGGFVFTSPEEIAGVEKIGQTKADFTLTVNGVKL
FT                   DGHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTN
FT                   SEYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPD
FT                   GSAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEDANNTSPT
FT                   LFYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDN
FT                   GQIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPG
FT                   NKDQHLFASAVKHFTGK"
FT   gene            50314..51756
FT                   /gene="purF"
FT                   /locus_tag="spr0047"
FT   CDS_pept        50314..51756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="spr0047"
FT                   /product="Amidophosphoribosyl transferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:spr0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98851"
FT                   /db_xref="GOA:Q8DRM5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM5"
FT                   /protein_id="AAK98851.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGTGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAVCSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEEAGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSMTYLSIDGLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            51793..52815
FT                   /gene="purM"
FT                   /locus_tag="spr0048"
FT   CDS_pept        51793..52815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="spr0048"
FT                   /product="Phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98852"
FT                   /db_xref="GOA:Q8DRM4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRM4"
FT                   /protein_id="AAK98852.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLVSSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            52812..53357
FT                   /gene="purN"
FT                   /locus_tag="spr0049"
FT   CDS_pept        52812..53357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="spr0049"
FT                   /product="5'-phosphoribosylglycinamide transformylase 1"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98853"
FT                   /db_xref="GOA:Q8DRM3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM3"
FT                   /protein_id="AAK98853.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKTDYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            53441..53950
FT                   /gene="vanZ"
FT                   /locus_tag="spr0050"
FT   CDS_pept        53441..53950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanZ"
FT                   /locus_tag="spr0050"
FT                   /product="Teicoplanin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98854"
FT                   /db_xref="GOA:Q8DRM2"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRM2"
FT                   /protein_id="AAK98854.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            53954..55522
FT                   /gene="purH"
FT                   /locus_tag="spr0051"
FT   CDS_pept        53954..55522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="spr0051"
FT                   /product="Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:spr0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98855"
FT                   /db_xref="GOA:Q8DRM1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRM1"
FT                   /protein_id="AAK98855.1"
FT                   /translation="MIKKENIMTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVA
FT                   LDNAGVETIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAANENQIELIDL
FT                   VVVNLYPFKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYTVVLDE
FT                   LSANGETTYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQAMRYG
FT                   ENPQQDADFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALK
FT                   HMNPCGIGQADDIETAWDYAYESDPVSIFGGIAVLNREVDAATAEKMHGVFLEIIIAPS
FT                   YTDEALAILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQV
FT                   VTKRQPTETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAK
FT                   DRLDGAVLASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGV
FT                   RHFRH"
FT   gene            55644..56906
FT                   /gene="purD"
FT                   /locus_tag="spr0052"
FT   CDS_pept        55644..56906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="spr0052"
FT                   /product="Phosphoribosylglycinamide synthetase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98856"
FT                   /db_xref="GOA:Q8DRM0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRM0"
FT                   /protein_id="AAK98856.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVSTAAYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGIIKEGRPYLGVIYAGLILTADGPK
FT                   VIEFNSRFGDPETQIILPRLTSDFAQNITDILDGKEPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LSQQKIEGLFYRTDIGSKAIK"
FT   gene            57276..57797
FT                   /gene="purE"
FT                   /locus_tag="spr0053"
FT   CDS_pept        57276..57797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="spr0053"
FT                   /product="Phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:spr0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98857"
FT                   /db_xref="GOA:Q8DRL9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL9"
FT                   /protein_id="AAK98857.1"
FT                   /translation="MIVEKEEKGEEMKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEK
FT                   KVVSAHRTPDLMFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRAL
FT                   SGVDSLYSIVQMPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGK
FT                   IAEESSNELI"
FT   gene            57724..58875
FT                   /gene="purK"
FT                   /locus_tag="spr0054"
FT   CDS_pept        57724..58875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="spr0054"
FT                   /product="Phosphoribosyl glucinamide formyltransferase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:spr0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98858"
FT                   /db_xref="GOA:Q8DRL8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL8"
FT                   /protein_id="AAK98858.1"
FT                   /translation="MRMHLPTLLKNKEKSQRSRQMSSSKTIGIIGGGQLGQMMAISAIY
FT                   MGHKVIALDPAADCPASRVAEIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVI
FT                   KDGQLPQGTDLLRISQNRIFEKDFLSNKSQVTVAPYKVVTSSLDLADIDLSKNYVLKTA
FT                   TGGYDGHGQKVIRSEADLEAAYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQ
FT                   ENIHRNNILSKTIVPARISESLVDKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEI
FT                   APRPHNSGHYSIEACDFSQFDTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEQYVT
FT                   ENSSAHLHMYGKIEAKHNRKMGHVTLFSDVPDSVDELGEGIDF"
FT   gene            58885..59112
FT                   /locus_tag="spr0055"
FT   CDS_pept        58885..59112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98859"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC6"
FT                   /protein_id="AAK98859.1"
FT                   /translation="MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIEKEEFE"
FT   gene            59175..60473
FT                   /gene="purB"
FT                   /locus_tag="spr0056"
FT   CDS_pept        59175..60473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="spr0056"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98860"
FT                   /db_xref="GOA:Q8DRL7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL7"
FT                   /protein_id="AAK98860.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCNKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(60528..64466)
FT                   /gene="strH"
FT                   /locus_tag="spr0057"
FT   CDS_pept        complement(60528..64466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strH"
FT                   /locus_tag="spr0057"
FT                   /product="Beta-N-acetyl-hexosaminidase precursor"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:spr0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98861"
FT                   /db_xref="GOA:Q8DRL6"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="PDB:3RPM"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL6"
FT                   /protein_id="AAK98861.1"
FT                   /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQ
FT                   PTIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSS
FT                   TPSDKAEVVTPTSAEKETANKKEEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKA
FT                   EADKPETETGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLL
FT                   VGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYA
FT                   KDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKAL
FT                   IDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYAN
FT                   DLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKG
FT                   HQILNTNDAWCYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAW
FT                   ADTPSARYSPSHLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVAAVKE
FT                   AEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVI
FT                   SIDAGRKYFTLDQLKRIVDKASELGYSDVHLLLGNDGLRFLLNDMTITANGKTYASDDV
FT                   KKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKL
FT                   GIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATS
FT                   AQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISY
FT                   WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYVIGNHKQDEAYPLSKAVENSGKVPFNQ
FT                   LASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREE
FT                   LAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHS
FT                   GSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISV
FT                   LTENGKTTETVLDSQVTKEVINQVVEVGSPVTHKGDESGLAPTTEVKPRLDIQEEEIPF
FT                   TTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVE
FT                   VGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVTEKKLPET
FT                   GTHDSAELVVAGLMSTLAAYGLTKRKED"
FT   gene            complement(64781..65539)
FT                   /locus_tag="spr0058"
FT   CDS_pept        complement(64781..65539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0058"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98862"
FT                   /db_xref="GOA:Q8DRL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL5"
FT                   /protein_id="AAK98862.1"
FT                   /translation="MVKFSMEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTE
FT                   AELISMYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDD
FT                   KVTVLSIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPN
FT                   LEYYSSIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKL
FT                   ESTGQVLEYSETYKRSDYYKIKFISCDRDH"
FT   gene            65845..67632
FT                   /gene="bgaC"
FT                   /locus_tag="spr0059"
FT   CDS_pept        65845..67632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaC"
FT                   /locus_tag="spr0059"
FT                   /product="Beta-galactosidase 3"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:spr0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98863"
FT                   /db_xref="GOA:Q8DRL4"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL4"
FT                   /protein_id="AAK98863.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRIPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLNNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGA
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            67629..68105
FT                   /gene="PTS-EIIB"
FT                   /locus_tag="spr0060"
FT   CDS_pept        67629..68105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIIB"
FT                   /locus_tag="spr0060"
FT                   /product="Phosphotransferase system sugar-specific EIIB
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98864"
FT                   /db_xref="GOA:Q8DRL3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL3"
FT                   /protein_id="AAK98864.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            68133..69038
FT                   /gene="PTS-EIIC"
FT                   /locus_tag="spr0061"
FT   CDS_pept        68133..69038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIIC"
FT                   /locus_tag="spr0061"
FT                   /product="Phosphotransferase system sugar-specific EIIC
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98865"
FT                   /db_xref="GOA:Q8DRL2"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL2"
FT                   /protein_id="AAK98865.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAQKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            69010..69840
FT                   /gene="PTS-EIID"
FT                   /locus_tag="spr0062"
FT   CDS_pept        69010..69840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIID"
FT                   /locus_tag="spr0062"
FT                   /product="Phosphotransferase system sugar-specific EIID
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98866"
FT                   /db_xref="GOA:Q8DRL1"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL1"
FT                   /protein_id="AAK98866.1"
FT                   /translation="MGKSKMTNSNYKLTKEDFNQINKRRLFTFQLGWNYERMQASGYLY
FT                   MILPQLRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNG
FT                   IKTGLMGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQL
FT                   EFAYKEGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQ
FT                   DILNQIFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            69847..70251
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0063"
FT   CDS_pept        69847..70251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0063"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98867"
FT                   /db_xref="GOA:Q8DRL0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRL0"
FT                   /protein_id="AAK98867.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   repeat_region   70249..70421
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            70549..71715
FT                   /gene="agaS"
FT                   /locus_tag="spr0064"
FT   CDS_pept        70549..71715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="spr0064"
FT                   /product="Tagatose-6-phosphate ketose/aldose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98868"
FT                   /db_xref="GOA:Q8DRK9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK9"
FT                   /protein_id="AAK98868.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESVATVDLAKSLVDELYQVTITCATDGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTALLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            71831..72868
FT                   /gene="galM"
FT                   /locus_tag="spr0065"
FT   CDS_pept        71831..72868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="spr0065"
FT                   /product="Aldose-1-epimerase (mutarotase)"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98869"
FT                   /db_xref="GOA:Q8CWW1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWW1"
FT                   /protein_id="AAK98869.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHVYNGTLLKDIFAEEDEQIQLASGLDHSFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            73075..73929
FT                   /locus_tag="spr0066"
FT   CDS_pept        73075..73929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0066"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98870"
FT                   /db_xref="GOA:Q8DRK8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK8"
FT                   /protein_id="AAK98870.1"
FT                   /translation="MTYEYKSHIYLAETALNVKDLASQTAFYQQVIGLEILSQTETESI
FT                   LGLGGKVLVQLIQAQESGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSSQFYQKVLGLEDKFSVPSASWIAAGDYHHHLAVNEWRGKG
FT                   LASRKQGLPGLAYYVIEVAHKKELLTIAQRAQEVDAPIKWMTSSKLEITDSDGIVTRIR
FT                   LAR"
FT   gene            74079..74336
FT                   /locus_tag="spr0067"
FT   CDS_pept        74079..74336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0067"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98871"
FT                   /db_xref="GOA:Q8DRK7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK7"
FT                   /protein_id="AAK98871.1"
FT                   /translation="MTNSKYITCLKRSEGQLRGIQKMIEGDRDCADIVTQLTAVRSSVE
FT                   RVIEMIITENLTECINQPLDDSEAQKERLEKAIRYLIKRK"
FT   repeat_region   74552..74747
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            75311..76075
FT                   /locus_tag="spr0068"
FT   CDS_pept        75311..76075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0068"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98872"
FT                   /db_xref="GOA:Q8DRK6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK6"
FT                   /protein_id="AAK98872.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGANCVGEFVSATKTYPVYVINYKGEEVCLAQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPCRYMEMQPEAIAAIEEVLEDRG
FT                   IPYEEVMTWTTDGFYRETAEKVAYRKEEGCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLDQYDSRDWGSEAFNKALELSLASVHHL"
FT   repeat_region   76338..76427
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_BB"
FT   gene            76547..76705
FT                   /locus_tag="spr0069"
FT   CDS_pept        76547..76705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0069"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98873"
FT                   /db_xref="GOA:Q8CZC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC5"
FT                   /protein_id="AAK98873.1"
FT                   /translation="MTYSHIYQVLFLPKLSIKRWHFLGLVLVNFALSYLSHFELFMVQW
FT                   KHVIQII"
FT   gene            76686..78065
FT                   /gene="trkH"
FT                   /locus_tag="spr0070"
FT   CDS_pept        76686..78065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="spr0070"
FT                   /product="Trk transporter membrane-spanning protein-K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:spr0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98874"
FT                   /db_xref="GOA:Q8DRK5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK5"
FT                   /protein_id="AAK98874.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLVFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            78058..78744
FT                   /gene="trkA"
FT                   /locus_tag="spr0071"
FT   CDS_pept        78058..78744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="spr0071"
FT                   /product="Trk transporter NAD+ binding protein-K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:spr0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98875"
FT                   /db_xref="GOA:Q8DRK4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK4"
FT                   /protein_id="AAK98875.1"
FT                   /translation="MVKKGKSMSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAER
FT                   INQFEPVLARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTV
FT                   IAKVKSQTAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIP
FT                   QSWAGQSLSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDT
FT                   LVALNS"
FT   repeat_region   complement(78872..79021)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            79054..79593
FT                   /locus_tag="spr0072"
FT   CDS_pept        79054..79593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0072"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98876"
FT                   /db_xref="GOA:Q8DRK3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK3"
FT                   /protein_id="AAK98876.1"
FT                   /translation="MKLLSIAISSYNAAAYLHYCVESLVIGGEQVGILIINDGSQDQTQ
FT                   EIAECLASKYPNIVRAIYQENKCHGGAVNRGLAEASGRYFKVVDSDDWVDPRAYLKILE
FT                   TLQELESKGQEVDVFVTNFVYEKEGQSRKKSMSYDSVLPVRQIFGWDQVGNFSKGQYTM
FT                   MHSLIYRTDLLRASQF"
FT   gene            complement(79471..80040)
FT                   /locus_tag="spr0073"
FT   CDS_pept        complement(79471..80040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0073"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98877"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC4"
FT                   /protein_id="AAK98877.1"
FT                   /translation="MIDDIGQFAIWQDRMFGQTAQHGLTNSLKDFWIFLLNIGPQLAFF
FT                   CQMLRCSRSVEQGTGNHRREFNMIQQIFSHFGMTHLGQIKLVYQESIDLELLVNALNHH
FT                   LLIDRLVLTPNQITIEIDRQIVHGLDLLKGRKDKEIIDIKSMFRQLELASTQQICPINQ
FT                   RVHHGILAFGEISDLVPAKNLPNRQD"
FT   gene            79660..80070
FT                   /locus_tag="spr0074"
FT   CDS_pept        79660..80070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0074"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC3"
FT                   /protein_id="AAK98878.1"
FT                   /translation="MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLIDQLDL
FT                   SQVSHPKMREYLLNHIELTTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAIRK
FT                   TMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN"
FT   gene            80186..83671
FT                   /locus_tag="spr0075"
FT   CDS_pept        80186..83671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0075"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to cell wall-associated serine proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98879"
FT                   /db_xref="GOA:Q8DRK2"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK2"
FT                   /protein_id="AAK98879.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVV
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNS
FT                   SSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVEKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVA
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNG
FT                   DAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTA
FT                   GVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVA
FT                   LDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLIS
FT                   KETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGGGMLTRLLLKAS
FT                   DKAPWSDNGDAKNPALSPLGENVKTKGQYFYQLALDGNVAGKEKQALIDQFRANGTQTY
FT                   SATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVEKAVADNVKDSIDVPAAYLEK
FT                   AKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKT
FT                   KGQYFYQLALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKV
FT                   TIKINVKETSDTANGSLSPSNSGSGVTPMNHNHATGTTDSMPADTMTSSTNTMAGENMA
FT                   ASANKMSDTMMSEDKAMLPNTGETQTSMASIGFLGLALAGLLGGLGLKNKKEEN"
FT   gene            83838..84536
FT                   /gene="rr08"
FT                   /locus_tag="spr0076"
FT   CDS_pept        83838..84536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rr08"
FT                   /locus_tag="spr0076"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98880"
FT                   /db_xref="GOA:Q8DRK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK1"
FT                   /protein_id="AAK98880.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRCLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLVADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            84533..85585
FT                   /gene="hk08"
FT                   /locus_tag="spr0077"
FT   CDS_pept        84533..85585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hk08"
FT                   /locus_tag="spr0077"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98881"
FT                   /db_xref="GOA:Q8DRK0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRK0"
FT                   /protein_id="AAK98881.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            85780..86391
FT                   /gene="rpsD"
FT                   /locus_tag="spr0078"
FT   CDS_pept        85780..86391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="spr0078"
FT                   /product="30S Ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98882"
FT                   /db_xref="GOA:P66566"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66566"
FT                   /protein_id="AAK98882.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            86559..86735
FT                   /locus_tag="spr0079"
FT                   /note="transposase A"
FT   CDS_pept        86559..86735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0079"
FT                   /product="Degenerative transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98883"
FT                   /protein_id="AAK98883.1"
FT                   /translation="MWYNPFMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQV"
FT   repeat_region   86731..86837
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B1"
FT   gene            87044..87313
FT                   /locus_tag="spr0080"
FT   CDS_pept        87044..87313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0080"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98884"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC2"
FT                   /protein_id="AAK98884.1"
FT                   /translation="MRSLTGVSNPTTDSARLVLAEANKAFADDSLTEQGLRDILQTVKD
FT                   AIASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
FT   gene            87777..88736
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0081"
FT   CDS_pept        87777..88736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0081"
FT                   /product="ABC transporter membrane-spanning permease-sugar
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98885"
FT                   /db_xref="GOA:Q8DRJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ8"
FT                   /protein_id="AAK98885.1"
FT                   /translation="MDIKIKREEIMKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFG
FT                   NVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLV
FT                   VSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLG
FT                   LKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRI
FT                   RNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQT
FT                   ADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            88750..89673
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0082"
FT   CDS_pept        88750..89673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0082"
FT                   /product="ABC transporter membrane spanning permease-sugar
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98886"
FT                   /db_xref="GOA:Q8DRJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ7"
FT                   /protein_id="AAK98886.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   repeat_region   89725..89881
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            89862..91406
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0083"
FT   CDS_pept        89862..91406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0083"
FT                   /product="ABC transporter solute binding protein-sugar
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98887"
FT                   /db_xref="GOA:Q8DRJ6"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ6"
FT                   /protein_id="AAK98887.1"
FT                   /translation="MIFIEYKIITLFISLKIKKGVFIMKNWKKYAFASASVVALAAGLA
FT                   ACGNLTGNSKKAADSGDKPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGW
FT                   GDYGKKMSVITSSGENYDIAFADNYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKG
FT                   NTVNGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDV
FT                   VPFAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAG
FT                   YIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQT
FT                   TQVANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDG
FT                   YKGNTHMGGWNTGNNWILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEIS
FT                   AIANTMQQFDTAINTGTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            91678..92664
FT                   /locus_tag="spr0084"
FT   CDS_pept        91678..92664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0084"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98888"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67331"
FT                   /protein_id="AAK98888.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            92633..93646
FT                   /locus_tag="spr0085"
FT   CDS_pept        92633..93646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0085"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98889"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC1"
FT                   /protein_id="AAK98889.1"
FT                   /translation="MKAWIRQLLYKIKQSSGAVFLCFVLKNLKFVFVSFRKIRYTVCKR
FT                   FQRSPVMAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQPLNRLEYIE
FT                   CAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGTDIEGLDGF
FT                   DFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFEARVRAVQE
FT                   TDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQ
FT                   ITGDGSKPEDYEAIARLDYAKFLEVLPPSFYHQLDANQIEIQPILGQDFKTLAQEK"
FT   gene            complement(93718..94782)
FT                   /locus_tag="spr0086"
FT   CDS_pept        complement(93718..94782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0086"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98890"
FT                   /db_xref="GOA:Q8CZC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZC0"
FT                   /protein_id="AAK98890.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADLDTPIEKN
FT                   TQLEEEVSQAEVELESQQEEKIETPEDSEARTKIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   VSILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(94845..95807)
FT                   /locus_tag="spr0087"
FT   CDS_pept        complement(94845..95807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0087"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98891"
FT                   /db_xref="GOA:Q8CZB9"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB9"
FT                   /protein_id="AAK98891.1"
FT                   /translation="MFVWYNLFLKKEREVISMRKWTKGFLIFGVVTTVIGFILLFVGIQ
FT                   SDGIKSLLSMSKEPVYDSRTEKLTFGKEVENLEITLHQHTLTITDSFDDQIHISYHPSL
FT                   SAHHDLITNQNDRTLSLTDKKLSETPFLSSGIGGILHIASSYSSRFEEVILRLPKGRTL
FT                   KGINISANRGQTTIINASLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDS
FT                   QLESTENHFHAENIQVHGKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKP
FT                   ESRGTELSNPYKTEKTDVKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(95749..96342)
FT                   /locus_tag="spr0088"
FT   CDS_pept        complement(95749..96342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0088"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98892"
FT                   /db_xref="GOA:Q8CZB8"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB8"
FT                   /protein_id="AAK98892.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGIEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA"
FT   gene            complement(96329..96655)
FT                   /locus_tag="spr0089"
FT   CDS_pept        complement(96329..96655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0089"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98893"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ5"
FT                   /protein_id="AAK98893.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(96794..97960)
FT                   /locus_tag="spr0090"
FT   CDS_pept        complement(96794..97960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0090"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98894"
FT                   /db_xref="GOA:Q8DRJ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ4"
FT                   /protein_id="AAK98894.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVI
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
FT   gene            98018..99175
FT                   /locus_tag="spr0091"
FT   CDS_pept        98018..99175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0091"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative sugar transferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98895"
FT                   /db_xref="GOA:Q8DRJ3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ3"
FT                   /protein_id="AAK98895.1"
FT                   /translation="MSSKVSGFQDKNGKVLKIMIEWWKEKFRRVVVTQNVESLLVSIVI
FT                   SAYNEEKYLPGLIEDLKNQTYPKEDIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLY
FT                   NNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTESFVMNNVAIIQQGEFVCGGPRPTIV
FT                   EGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGR
FT                   TEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLS
FT                   LFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPF
FT                   LLFSIHFAYGLGTIVGLIRGFKWKKEYKGTIIYLDKISQINKNML"
FT   gene            99217..101067
FT                   /gene="capD"
FT                   /locus_tag="spr0092"
FT   CDS_pept        99217..101067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capD"
FT                   /locus_tag="spr0092"
FT                   /product="CapD protein, required for the biosynthesis of
FT                   type 1 capsular polysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:spr0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98896"
FT                   /db_xref="GOA:Q8DRJ2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ2"
FT                   /protein_id="AAK98896.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIREFRTLSGDELKQAIIAFANQTTHIE"
FT   repeat_region   101134..101420
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBBBC"
FT   gene            complement(101463..102095)
FT                   /gene="gph"
FT                   /locus_tag="spr0093"
FT   CDS_pept        complement(101463..102095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="spr0093"
FT                   /product="Phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98897"
FT                   /db_xref="GOA:Q8DRJ1"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ1"
FT                   /protein_id="AAK98897.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKNTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLVPQQAIIIGDT
FT                   KFDMLGARETGIQKLAVTWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(102117..102989)
FT                   /gene="sdaA"
FT                   /locus_tag="spr0094"
FT   CDS_pept        complement(102117..102989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="spr0094"
FT                   /product="L-serine dehydratase alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98898"
FT                   /db_xref="GOA:Q8DRJ0"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRJ0"
FT                   /protein_id="AAK98898.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(102998..103669)
FT                   /gene="sdaB"
FT                   /locus_tag="spr0095"
FT   CDS_pept        complement(102998..103669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaB"
FT                   /locus_tag="spr0095"
FT                   /product="L-serine dehydratase beta subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98899"
FT                   /db_xref="GOA:Q8DRI9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI9"
FT                   /protein_id="AAK98899.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            103911..104414
FT                   /locus_tag="spr0096"
FT   CDS_pept        103911..104414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0096"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98900"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB7"
FT                   /protein_id="AAK98900.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYGSWTAAKNFWLN
FT                   NGWY"
FT   gene            complement(104537..104785)
FT                   /locus_tag="spr0097"
FT   CDS_pept        complement(104537..104785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0097"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98901"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB6"
FT                   /protein_id="AAK98901.1"
FT                   /translation="MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGSPFWS"
FT   gene            105242..105490
FT                   /locus_tag="spr0098"
FT   CDS_pept        105242..105490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0098"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98902"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB5"
FT                   /protein_id="AAK98902.1"
FT                   /translation="MVCSILASTSVLAVWVDGGQWNYGVGWSGNFGYSDYLHSTRSHTA
FT                   TVKDGNKFSKDRAEAEAWARASIFKFPPTGMEYFYGF"
FT   gene            105545..107653
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0099"
FT   CDS_pept        105545..107653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0099"
FT                   /product="ABC transporter membrane-spanning permease-amino
FT                   acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98903"
FT                   /db_xref="GOA:Q8DRI8"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI8"
FT                   /protein_id="AAK98903.1"
FT                   /translation="MKKISHLCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLY
FT                   LKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFT
FT                   TDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKD
FT                   RIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEM
FT                   KRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHF
FT                   LLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGR
FT                   SLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKT
FT                   QAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTGIKKVILMP
FT                   ASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENL
FT                   SNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSS
FT                   IQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKL
FT                   VDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASRMEKRSLV
FT                   ELLKGGIL"
FT   gene            107650..108291
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0100"
FT   CDS_pept        107650..108291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0100"
FT                   /product="ABC transporter ATP-binding protein-amino acid
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98904"
FT                   /db_xref="GOA:Q8DRI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI7"
FT                   /protein_id="AAK98904.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
FT   gene            108506..109303
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0101"
FT   CDS_pept        108506..109303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0101"
FT                   /product="ABC transporter solute-binding protein-amino acid
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98905"
FT                   /db_xref="GOA:Q8DRI6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI6"
FT                   /protein_id="AAK98905.1"
FT                   /translation="MKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALNPDF
FT                   APFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISG
FT                   VSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKD
FT                   LLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDS
FT                   YAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            109269..110516
FT                   /gene="argG"
FT                   /locus_tag="spr0102"
FT   CDS_pept        109269..110516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="spr0102"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:spr0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98906"
FT                   /db_xref="GOA:Q8DRI5"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRI5"
FT                   /protein_id="AAK98906.1"
FT                   /translation="MRMPLKRPLKNRKKEKNMSKEKVILAYSGGLDTSVAITWLKKDYD
FT                   VVAVCMDVGEGKDLDFIHDKALKVGAVESYVIDVKDEFATDYVLVAHQSHAYYEQKYPL
FT                   VSALSRPLISKKLVEIAHQIGATTIAHGCTGKGNDQVRFEVSIAALDLNLKVIAPVREW
FT                   KWSREEEIYYAKENGVPVPADLDNPYSVDQNLWGRANECGILENPWNQAPEEAFGITTS
FT                   PEQAPDMPEYIEIEFSEGVPVSLNGEVLKLADLIQKLNEIAGKHGVGRIDHVENRLVGI
FT                   KSREIYECPGAVTLLTAHKEIEDLTLVREVAHFKPIIENELSNLIYNALWFSSATQALI
FT                   AYIKETQKVVNGTAKVKLYKGSAQVVARKSPSSLYDENLATYTSADTFDQDAAVGFIKL
FT                   WGLPTKVHSEVQKSAK"
FT   gene            110545..111936
FT                   /gene="argH"
FT                   /locus_tag="spr0103"
FT   CDS_pept        110545..111936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="spr0103"
FT                   /product="Arginine succinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98907"
FT                   /db_xref="GOA:Q8DRI4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRI4"
FT                   /protein_id="AAK98907.1"
FT                   /translation="MAKNTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHV
FT                   QMLGQTGILSLEESEKIQVGLKELLEELEAGQLDFDIANEDIHMNMEVLLTEKIGPLAG
FT                   KLHTARSRNDQVATDMHLYLKEQLGYVLDKLAHLKGVLLDLAENHVATIMPGYTHLQHA
FT                   QPISFAYHLMAYYNMFQRDSERFEFNQKHTDLCPLGAAALAGTTFPIDRQLSSDLLEFK
FT                   QPYTNSLDAVSDRDFILEFLSNASILMMHMSRFCEEMINWCSFEYQFITLSDTFTIGSS
FT                   IMPQKKNPDMAELIRGKTGRVYGHLFGLLTVMKSLPLAYNKDLQEDKEGMFDTVETILN
FT                   SLDVLAGMLSSLQVNKEKMQESTEKDFSNATELADYLAGKGLPFREAHEVVGRLVLDSI
FT                   KSAKNLQDWTLEELQTYHSLITEDIYVYLQPKTAVQRRNSLGGTGFDQVEYQIAVAKKA
FT                   NEAKK"
FT   gene            complement(112225..113124)
FT                   /locus_tag="spr0104"
FT   CDS_pept        complement(112225..113124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0104"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98908"
FT                   /db_xref="GOA:Q8CZB4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB4"
FT                   /protein_id="AAK98908.1"
FT                   /translation="MFVNFFHEKEKIMRYDFGKVYKEIRESKGLTQEEVCGGVLSRTSL
FT                   SKIESGKTTPKYENMEFLLRQINMSFEEFEYICQLYQPSQRTEIMQTYLNMRSIIGTSD
FT                   LVNLFQKCQDYLKTHHDLPIEEIRDMLEVVIYLRQHGAGELSKHAEQVVKKLWKKIEKQ
FT                   DTWYESDLKILNTILFSFPIEYLHLITGKILQRLEVYKNYQHLYDLRMTILLNLSTLYL
FT                   YNQDKNMCKQICYTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETS
FT                   MLSHLKKEVEIYYQAKER"
FT   gene            113542..113775
FT                   /locus_tag="spr0105"
FT                   /note="Transporter-truncation"
FT   CDS_pept        113542..113775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0105"
FT                   /product="Transporter, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98909"
FT                   /db_xref="GOA:Q8DRI3"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI3"
FT                   /protein_id="AAK98909.1"
FT                   /translation="MSISMLKKYPCTMQHDQSDCAAAVVSTVLLSYKKELSIMKIREII
FT                   GTDMYGTTVSGIVSGLNKLNFTVKAVRVALED"
FT   gene            113839..115773
FT                   /locus_tag="spr0106"
FT                   /note="Transporter-truncation"
FT   CDS_pept        113839..115773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0106"
FT                   /product="Transporter, truncation"
FT                   /note="Similar to competence factor transporting
FT                   ATP-binding/permease protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:spr0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98910"
FT                   /db_xref="GOA:Q8DRI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI2"
FT                   /protein_id="AAK98910.1"
FT                   /translation="MVLHSIKRNSKFYVADPASGIRKMSSDELGEIYQGITLFMVPNSD
FT                   FERGKLKGKGLLDLFGRLIFNQKGLISTVILASFVLSIIGILSSLFSKVIMDEVIPYAL
FT                   KNSLYMFLIVFGIVSFLQTLLSAFRQHVLLFLSRKIDIPVLMGYYDHIIHLPYSFFGSR
FT                   RVGDVLTRFQDAMTIKNVFTSVSISLVMDITLSVISAVVLWTINQSLFLILVFMVIVNI
FT                   ILIYCFKKPYKKINHEQMEANGLLNSQLIESIRNIDTIKSQHDEEQRLNKIEEKFVHTL
FT                   EIGYKEGVLQNIQSTISSMTSTMGGLLFMGVGALFIIDGKMTIGDLLVFQTLSQYFTEP
FT                   IQNLVGLQLTFQEVQVAVSRLQELMEVDREDIALDYSIRDFTLCDDIEFKDVTFAYGSR
FT                   PPVIKNFNLRIKQGEKIAFVGESGAGKSTLVRLLLRFINPNEGKICIGANDLSDLDYGK
FT                   LRKKISYIPQTIELFTGTIIDNLKIGNPSVTYEDMVRVCRIVGIHDTIQRLQNRYGSFV
FT                   EEGGQNFSGGEKQRLAIARALLSKADLYIFDEATSNLDSFSEQIIQDLIFNKIMDKTTI
FT                   VVAHRLSTILRCDKICFLENGTIVEYGTHEELMAKNGKYARMVGLQSVQVNQQIQSQAV
FT                   LDTEEVTYG"
FT   gene            115766..116233
FT                   /locus_tag="spr0107"
FT   CDS_pept        115766..116233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0107"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98911"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB3"
FT                   /protein_id="AAK98911.1"
FT                   /translation="MAKLEVKDNKKLVLKSVICKKLHDTKVEDVDQEINRFHQHLQLLK
FT                   AQIFGPLIVKSCGTTIHDDGLITTDFEFYIQAHNAQQYSNIYDVQDSISVPYCLYVRFE
FT                   DSPEYLQYAYSKLDLYVYENDIQTDGIVYTVYVNSSPEKMVVDIFIPIVSL"
FT   gene            116230..117582
FT                   /locus_tag="spr0108"
FT   CDS_pept        116230..117582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0108"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to ComB protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98912"
FT                   /db_xref="GOA:Q8DRI1"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI1"
FT                   /protein_id="AAK98912.1"
FT                   /translation="MKLYNKSELRYSRIFFDKRPPAFAFILIISTAIILSGALVGAAYI
FT                   PKNYIVKANGNSVITGTEFLSAISSGKVVTLHKSEGDMVNAGDVIISLSSGQEGLQASS
FT                   LNKQLVKLRAKEAIFQKFEQSLNEKYNRMSNSGEEQEYYGKVEYYLSQLNSENYNNGTQ
FT                   YSKIQDEYTKLNKITAERNQLDADLQTLQNELIQLQQQGDSPSLSDTTSADDKAKLETK
FT                   ILEITTKIEALKTNITSKNSEIDSQQSNIKDMNRTYNDPTSQAYNIYAQLVSELGTARS
FT                   NNNKSITELEANLGVATGQDKAHSILAPNEGTLHYLVPLKQGMSIQQGQTIAEVSGKEK
FT                   GYYVEAFVLASDISRVSKGAKVDVAITGVNSQKYGTLKGQVRQIDSGTISQETKEGNIS
FT                   LYKVMIELETLTLKHGSETVVLQKDMPVEVRIVYDKETYLDWILEMLSFKQ"
FT   gene            117728..118108
FT                   /locus_tag="spr0109"
FT   CDS_pept        117728..118108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0109"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98913"
FT                   /db_xref="GOA:Q8CZB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB2"
FT                   /protein_id="AAK98913.1"
FT                   /translation="MELVLPNNYVDLEQEEMMYLDGGGVGRNWWNSRGSFATVLDVGLA
FT                   IYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFS
FT                   LGGAIAYGADWADGSLDGYIFA"
FT   gene            complement(118611..118931)
FT                   /locus_tag="spr0110"
FT   CDS_pept        complement(118611..118931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0110"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB1"
FT                   /protein_id="AAK98914.1"
FT                   /translation="MQRLEVYKNYQHLYDLRMTILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICRDNAKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            119688..120059
FT                   /locus_tag="spr0111"
FT   CDS_pept        119688..120059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZB0"
FT                   /protein_id="AAK98915.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGGAIYIPRWAITGAITGAAYAALA
FT                   AAGGGGLQLVLASYGLRSALVAGIVKGLGVLGIHIGNAFANTVIRSIASAGIGAGADWI
FT                   FTNIIDGWDGRRDNQLRIG"
FT   gene            120067..120279
FT                   /locus_tag="spr0112"
FT   CDS_pept        120067..120279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0112"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98916"
FT                   /db_xref="GOA:Q8CZA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA9"
FT                   /protein_id="AAK98916.1"
FT                   /translation="MLIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYF
FT                   LPIEILIAISGANLLLSFLKKLQTK"
FT   gene            121084..122142
FT                   /locus_tag="spr0113"
FT   CDS_pept        121084..122142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0113"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98917"
FT                   /db_xref="GOA:Q8CZA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA8"
FT                   /protein_id="AAK98917.1"
FT                   /translation="MKDDQKYLLAGLYSLLVAIFYFPLIDSKGIFVSILMAVLLLYLIY
FT                   FIATVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREIALLLATIIVYFFTHRILPLSVFTFMFSYILLFVQSYL
FT                   GSNTAWIGNRRLIIDDEFEKILLSKSYVKEISSARYSEYLTCEYKNLTPIILIAIFENL
FT                   LDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALR
FT                   DLSKQYLNKNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCVPSQYDRFFYKDR
FT                   PYIFSRKSPIKG"
FT   gene            122441..123433
FT                   /locus_tag="spr0114"
FT   CDS_pept        122441..123433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0114"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98918"
FT                   /db_xref="GOA:Q8CZA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA7"
FT                   /protein_id="AAK98918.1"
FT                   /translation="MESRLMKNKRYFFDTILIILLLISTIFCVSPVFIKLDILGTPSHA
FT                   ILTFVLAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLM
FT                   GFSPGIAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLISFSIIIAL
FT                   VQKLYRIENQQLFLLKSKVLTILESKKNCEFNLQDYHEIWKLQSKSELPCVALSYISLI
FT                   KPYLSESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLKKIL
FT                   EVRPDFVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYMGIKHVSIRR"
FT   gene            123810..124184
FT                   /locus_tag="spr0115"
FT   CDS_pept        123810..124184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0115"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98919"
FT                   /db_xref="GOA:Q8CZA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA6"
FT                   /protein_id="AAK98919.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGFSILRWPVATAINIAFNGVLGG
FT                   GAISLVRNYIRNYGLGRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGDAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            124191..124373
FT                   /locus_tag="spr0116"
FT   CDS_pept        124191..124373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0116"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98920"
FT                   /db_xref="GOA:Q8CZA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA5"
FT                   /protein_id="AAK98920.1"
FT                   /translation="MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVF
FT                   LILIIAMIIYPKLRK"
FT   gene            124392..125294
FT                   /locus_tag="spr0117"
FT   CDS_pept        124392..125294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0117"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98921"
FT                   /db_xref="GOA:Q8CZA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA4"
FT                   /protein_id="AAK98921.1"
FT                   /translation="MIRKLIIFLLMLPLFVLWLELHVLVNNLLLNLESPLDFVISMSLA
FT                   FFVLILSKIVLDILYALKDLYKKEALITIFPFIFIRRKKVNVRFSPYFSFHRKSLSPDD
FT                   LRSRIIWSFILEIAIILVFILKIPFAIIMLTTIFFWTIMDINHLVFNKTEFLFNQSKWE
FT                   KEDSFESDLTNTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILKKIEDSH
FT                   NTLLCTGLVELLLYEMSISNNNNWSNKVDKIRIHLIRINQLDFFYYTSWLRQNFDFCMN
FT                   REYHKMKSRKLLLSNKKIV"
FT   gene            125317..125703
FT                   /locus_tag="spr0118"
FT   CDS_pept        125317..125703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0118"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98922"
FT                   /db_xref="GOA:Q8CZA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA3"
FT                   /protein_id="AAK98922.1"
FT                   /translation="MKQFQLRRRKQMELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGI
FT                   CVALAMSPGIFIALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLATAAGKIAYCIGYG
FT                   ALNRGCDISGNPYPWDGFISATVR"
FT   gene            125670..126428
FT                   /locus_tag="spr0119"
FT   CDS_pept        125670..126428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0119"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98923"
FT                   /db_xref="GOA:Q8CZA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA2"
FT                   /protein_id="AAK98923.1"
FT                   /translation="MGWIHICDSKMSNVDKIRKIHIIVCWMYIFLSFNPIISNTEYFLL
FT                   IFLAFIYSIVSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFI
FT                   TELIIFHLIGEDFATKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVD
FT                   NHVLTLIFLIKICVDTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKA
FT                   GYLFSVLLLFSNFSVPFIKEKEFELFKNSK"
FT   repeat_region   127282..127350
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B"
FT   gene            127503..127802
FT                   /locus_tag="spr0120"
FT   CDS_pept        127503..127802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0120"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98924"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA1"
FT                   /protein_id="AAK98924.1"
FT                   /translation="MGSSENCPVLFYFEKIWSLSLKLLDCILDYQERFNGKTCQVSTNY
FT                   KYLETFKVNFCLTDLHHLFDLYKITRDYASQTKPAIQAGVFILEDFRNILCTMM"
FT   gene            128356..130215
FT                   /gene="pspA"
FT                   /locus_tag="spr0121"
FT   CDS_pept        128356..130215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="spr0121"
FT                   /product="Surface protein pspA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98925"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRI0"
FT                   /protein_id="AAK98925.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVASQPTVVRAEESPVASQSKAEKD
FT                   YDAAKKDAKNAKKAVEDAQKALDDAKAAQKKYDEDQKKTEEKAALEKAASEEMDKAVAA
FT                   VQQAYLAYQQATDKAAKDAADKMIDEAKKREEEAKTKFNTVRAMVVPEPEQLAETKKKS
FT                   EEAKQKAPELTKKLEEAKAKLEEAEKKATEAKQKVDAEEVAPQAKIAELENQVHRLEQE
FT                   LKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAA
FT                   EENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNEPEKPAPAPETPAPEAPAEQPK
FT                   PAPAPQPAPAPKPEKPAEQPKPEKTDDQQAEEDYARRSEEEYNRLTQQQPPKAEKPAPA
FT                   PKTGWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNGAMATGWLQYNGSWYYLNANG
FT                   AMATGWAKVNGSWYYLNANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNAN
FT                   GAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWVKDGDTWYYLEA
FT                   SGAMKASQWFKVSDKWYYVNGLGALAVNTTVDGYKVNANGEWV"
FT   gene            130562..131737
FT                   /gene="trmU"
FT                   /locus_tag="spr0122"
FT   CDS_pept        130562..131737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="spr0122"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:spr0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98926"
FT                   /db_xref="GOA:Q8CWW0"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWW0"
FT                   /protein_id="AAK98926.1"
FT                   /translation="MKHTRPSIVNKRIDGRLTMSDNSKTRVVVGMSGGVDSSVTALLLK
FT                   EQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEY
FT                   FLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRG
FT                   VDNGKDQTYFLSQLSQEQLQKTMFPLGHLKKPEVRKLAEEAGLSTAKKKDSTGICFIGE
FT                   KNFKNFLSNYLPAQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVV
FT                   GKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTV
FT                   HVKGDKAEVIFAEPQRAITPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            131851..132333
FT                   /locus_tag="spr0123"
FT   CDS_pept        131851..132333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0123"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98927"
FT                   /db_xref="GOA:Q8DRH9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH9"
FT                   /protein_id="AAK98927.1"
FT                   /translation="MCRLRERTRMTQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKG
FT                   KYYTIGGAIQVNEKTEDAVVREVREELGVKAQAGQLAFVVENRFEVDGVSYHNIEFHYL
FT                   VDLLEDAPLTMQEDEKSQPCEWIDLDKLEDIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            132343..134256
FT                   /gene="gidA"
FT                   /locus_tag="spr0124"
FT   CDS_pept        132343..134256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="spr0124"
FT                   /product="Glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:spr0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98928"
FT                   /db_xref="GOA:Q8DRH8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRH8"
FT                   /protein_id="AAK98928.1"
FT                   /translation="MIYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKAVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEVPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEELDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   repeat_region   complement(134454..134633)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBBA"
FT   gene            complement(134636..136468)
FT                   /locus_tag="spr0125"
FT   CDS_pept        complement(134636..136468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0125"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:spr0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98929"
FT                   /db_xref="GOA:Q8DRH7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH7"
FT                   /protein_id="AAK98929.1"
FT                   /translation="MPAQNLRAVSLLANLSKKIAQSTISSISNSCLTNCSITKKKLAPS
FT                   KLRSSNMAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPEDDLLGIDY
FT                   VIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALALIRGKLEEH
FT                   GLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCTGDFKFDFT
FT                   PVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQGIEGRIIFA
FT                   SFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFIEPNEIKDY
FT                   PAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTTSVNKLINI
FT                   ISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQKVHAGLAVDT
FT                   GVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKDRRDLSEDG
FT                   VVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIALKNKDASVQ
FT                   SVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(136317..136550)
FT                   /locus_tag="spr0126"
FT   CDS_pept        complement(136317..136550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0126"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98930"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRH6"
FT                   /protein_id="AAK98930.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            complement(137368..137520)
FT                   /gene="orf51"
FT                   /locus_tag="spr0127"
FT   CDS_pept        complement(137368..137520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf51"
FT                   /locus_tag="spr0127"
FT                   /product="orf51"
FT                   /note="Induced during competence"
FT                   /db_xref="EnsemblGenomes-Gn:spr0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98931"
FT                   /db_xref="GOA:Q8DRH5"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH5"
FT                   /protein_id="AAK98931.1"
FT                   /translation="MMKNLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(137522..137707)
FT                   /locus_tag="spr0128"
FT   CDS_pept        complement(137522..137707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0128"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98932"
FT                   /db_xref="GOA:Q8CZA0"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZA0"
FT                   /protein_id="AAK98932.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            137885..138568
FT                   /locus_tag="spr0129"
FT   CDS_pept        137885..138568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0129"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98933"
FT                   /db_xref="GOA:Q8DRH4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH4"
FT                   /protein_id="AAK98933.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTLNIELVGMSSLLALVPYQQ
FT                   EGLFIPLMDARRNNVYAGFYENAKPVMAEAHLPFERVIELIKGASQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            138565..139002
FT                   /gene="rimI"
FT                   /locus_tag="spr0130"
FT   CDS_pept        138565..139002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="spr0130"
FT                   /product="Ribosomal protein alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:spr0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98934"
FT                   /db_xref="GOA:Q8DRH3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH3"
FT                   /protein_id="AAK98934.1"
FT                   /translation="MIEIKRIQQQPDLAQDIYAVMAAVYPVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLTVQETLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            138992..140002
FT                   /gene="gcp"
FT                   /locus_tag="spr0131"
FT   CDS_pept        138992..140002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="spr0131"
FT                   /product="Secreted metalloendopeptidase Gcp"
FT                   /EC_number="3.4.24.57"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98935"
FT                   /db_xref="GOA:Q8DRH2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRH2"
FT                   /protein_id="AAK98935.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   HHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANKGLRER
FT                   LATEITDVNVIIPPLRLCGDNAGMIAYASVSEWNKENFANLDLNAKPSLAFDTME"
FT   gene            complement(140042..140428)
FT                   /locus_tag="spr0132"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(140042..140428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0132"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98936"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH1"
FT                   /protein_id="AAK98936.1"
FT                   /translation="MHLTHREVRDKLLSYSEGLQVYYELYQLLLFHFQEKNADHFFGLI
FT                   EQELPTVHPLFQTVFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKRKAFGFRNFN
FT                   NFKKRILMTLNIKKESTNFVLSRL"
FT   gene            complement(140419..140970)
FT                   /locus_tag="spr0133"
FT                   /note="IS1167-truncation"
FT   CDS_pept        complement(140419..140970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0133"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98937"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRH0"
FT                   /protein_id="AAK98937.1"
FT                   /translation="MAVSTSTVIRKLREFKFETDWTKLPKVMSWDEYSFKKSKMSFIAQ
FT                   DFESKSILAILDGRTHAVIRNHFQRYQREVRELVEVITMDMYSPYYRLAKQLFPKAKIV
FT                   LDRFHIVQHLSRAMNRVRIQIMNQFDRKSLEYRALKRFWNPRFFVSRLGLNQSTGLIYY
FT                   ARIASSSVRNDSISPRFECT"
FT   gene            complement(142041..142307)
FT                   /locus_tag="spr0134"
FT                   /note="transposase A"
FT   CDS_pept        complement(142041..142307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0134"
FT                   /product="Degenerative transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG9"
FT                   /protein_id="AAK98938.1"
FT                   /translation="MTEIAAEFNCPPTTIHYALKAMGYSLKKSRTYCEQDPEKVNRFLK
FT                   ELNHLSYLTPIYIYETGVETYFYLEYDRALSRQLVSLEEDIII"
FT   gene            142595..143809
FT                   /gene="epsG"
FT                   /locus_tag="spr0135"
FT   CDS_pept        142595..143809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsG"
FT                   /locus_tag="spr0135"
FT                   /product="Glycosyltransferase involved exopolysaccharide
FT                   (EPS) synthesis"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98939"
FT                   /db_xref="GOA:Q8DRG8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG8"
FT                   /protein_id="AAK98939.1"
FT                   /translation="MVTMQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDP
FT                   HIIGLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNIL
FT                   KLLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWT
FT                   YSMGDAFICVSETMKKRLESIIKNKKIVAINNGINVSNSDLDVVGVQDFKKEFCIPNNK
FT                   KIICYVGRLDPEKRPDRFLEFAEKLFLVREDVIFIMAGNGSMWAALKEKICHLKCRDNF
FT                   RLLGEIYPATIVYQISDLLYIPSDTEGIPMCVLESMSQGTSVLASNVGGLSEIIEHRVD
FT                   GFLFEKEDVEGVCACANFLLNDSEYLKYIGENSKSKIRKHFSVQKMFVETMRVYDELLE
FT                   KSSHG"
FT   gene            143802..144755
FT                   /locus_tag="spr0136"
FT   CDS_pept        143802..144755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0136"
FT                   /product="Glycosyl transferase, family 2"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98940"
FT                   /db_xref="GOA:Q8DRG7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG7"
FT                   /protein_id="AAK98940.1"
FT                   /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDD
FT                   NYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYM
FT                   PDRILKLMACFKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTS
FT                   FWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENGITGV
FT                   TQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAR
FT                   EEKIFNEFLFLKYMLLYNFSFFYCIYDNYVQLKFRK"
FT   gene            144765..146381
FT                   /gene="ABC-NP"
FT                   /locus_tag="spr0137"
FT   CDS_pept        144765..146381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NP"
FT                   /locus_tag="spr0137"
FT                   /product="ABC transporter ATP-binding/membrane spanning
FT                   permease-possible multidrug resistance"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98941"
FT                   /db_xref="GOA:Q8DRG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG6"
FT                   /protein_id="AAK98941.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPKEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            147164..147919
FT                   /locus_tag="spr0138"
FT   CDS_pept        147164..147919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0138"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98942"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ99"
FT                   /protein_id="AAK98942.1"
FT                   /translation="MVMSDNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSG
FT                   YPLSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNG
FT                   NFLYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEF
FT                   MRYKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKHYIDRISSILCYKSQILIIW
FT                   KSVEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            147932..149104
FT                   /gene="ugd"
FT                   /locus_tag="spr0139"
FT   CDS_pept        147932..149104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="spr0139"
FT                   /product="UDP-glucose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:spr0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98943"
FT                   /db_xref="GOA:Q8DRG5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG5"
FT                   /protein_id="AAK98943.1"
FT                   /translation="MNIAVIGLGHVGLAYALLFASKYKVVAYDIDSVKINNLKKGILPS
FT                   KNEELMKFFCENNLNITFFDTFSEIKNNIDYYIIALPTDYDEKIGSFNTYEIEQTVSKI
FT                   LRVKPNGKIILKSTVPIGFSNKLKRLFDTKNIIFVPEFLREGCSIYDNLYPSRIVVGDE
FT                   TVEGRKIAELFLSISTHSTANIKNVMLVSPTEAEAIKLFSNTFLALRVAFFNELDSFAE
FT                   RRSLNAEVVIKGVCLDPRIGNFYNNPSFGFGGYCLPKDTKQLKKEFIEINAPVIEAIDI
FT                   SNTNRKQFIVKQILERKPKIVGIYKLGMKYNSDNYKESAILSIINELLIVGIKILVYEP
FT                   NLNVSIDNVIFEKNFELFTKQSDLIVANRWDRGLEAYKDKVYTRGIWIRD"
FT   gene            149499..150362
FT                   /gene="mutR"
FT                   /locus_tag="spr0140"
FT   CDS_pept        149499..150362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="spr0140"
FT                   /product="Positive transcriptional regulator of mutA"
FT                   /db_xref="EnsemblGenomes-Gn:spr0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98944"
FT                   /db_xref="GOA:Q8DRG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG4"
FT                   /protein_id="AAK98944.1"
FT                   /translation="MIEKMELGEFYKELRLARKLKQTDVACEGLTASQLSKFELGQSML
FT                   SADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALEQLLEEVDQ
FT                   EQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELE
FT                   RMLRPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFELRFQQ
FT                   YKELID"
FT   gene            150653..150886
FT                   /locus_tag="spr0141"
FT   CDS_pept        150653..150886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ98"
FT                   /protein_id="AAK98945.1"
FT                   /translation="MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGI
FT                   YPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR"
FT   gene            150908..151585
FT                   /locus_tag="spr0142"
FT   CDS_pept        150908..151585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0142"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98946"
FT                   /db_xref="GOA:Q8CZ97"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ97"
FT                   /protein_id="AAK98946.1"
FT                   /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQ
FT                   VLLVLILGTIATIAFVKSEHWKECGRFQFRWSYLGVFLLSFFLLFVWANLTTYIFPRTQ
FT                   NGSTVVEVATSLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVNRYYLDVLVSA
FT                   AIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLV
FT                   FGY"
FT   gene            151597..152262
FT                   /locus_tag="spr0143"
FT   CDS_pept        151597..152262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0143"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98947"
FT                   /db_xref="GOA:Q8CZ96"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ96"
FT                   /protein_id="AAK98947.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVAGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVAWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEDMIYRGLVMTALEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            152331..153560
FT                   /locus_tag="spr0144"
FT   CDS_pept        152331..153560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0144"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98948"
FT                   /db_xref="GOA:Q8DRG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG3"
FT                   /protein_id="AAK98948.1"
FT                   /translation="MMKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLA
FT                   ILLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLL
FT                   VAFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGV
FT                   LLGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTINYQEGLSVKSFCQHLLQSSK
FT                   LIWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALI
FT                   VGSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRL
FT                   QELVFKQIPEESMGAVQSSISAITVVLPSLFTISLVTIATSFGTLAVSFVLLLFLLVAF
FT                   VMLLNIRESI"
FT   repeat_region   153654..153760
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B2"
FT   gene            153770..154366
FT                   /locus_tag="spr0145"
FT   CDS_pept        153770..154366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0145"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98949"
FT                   /db_xref="GOA:Q8CZ95"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ95"
FT                   /protein_id="AAK98949.1"
FT                   /translation="MLWLDSFQSTYTLRNSLQTTSASPCRSTVTDFVSSIHNLKTVVQA
FT                   PVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGELAHTDK
FT                   VNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFALILSSVVTGKVGSLPQIKWLD
FT                   FLAVFPTAWVAFRYRNLVGTVLFGVVLIAILRLVF"
FT   repeat_region   153858..153891
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_B"
FT   gene            154470..155300
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0146"
FT   CDS_pept        154470..155300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0146"
FT                   /product="ABC transporter substrate-binding protein-amino
FT                   acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98950"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="PDB:4EQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG2"
FT                   /protein_id="AAK98950.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            155454..156308
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0147"
FT   CDS_pept        155454..156308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0147"
FT                   /product="ABC transporter solute-binding protein-unknown
FT                   substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98951"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG1"
FT                   /protein_id="AAK98951.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIGDTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQ
FT                   PVW"
FT   gene            156408..157781
FT                   /gene="dapE"
FT                   /locus_tag="spr0148"
FT   CDS_pept        156408..157781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="spr0148"
FT                   /product="Succinyl-diaminopimelic descuccinlyase
FT                   (ArgE/DapE/Acy1 family protein)"
FT                   /EC_number="3.5.1.18"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98952"
FT                   /db_xref="GOA:Q8DRG0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRG0"
FT                   /protein_id="AAK98952.1"
FT                   /translation="MFFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            157774..158835
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0149"
FT   CDS_pept        157774..158835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0149"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98953"
FT                   /db_xref="GOA:Q8DRF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRF9"
FT                   /protein_id="AAK98953.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSNPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            158837..159529
FT                   /gene="ABC-MSD"
FT                   /locus_tag="spr0150"
FT   CDS_pept        158837..159529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSD"
FT                   /locus_tag="spr0150"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-unknown substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98954"
FT                   /db_xref="GOA:Q8DRF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF8"
FT                   /protein_id="AAK98954.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIVIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(159559..160128)
FT                   /locus_tag="spr0151"
FT   CDS_pept        complement(159559..160128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98955"
FT                   /db_xref="GOA:Q8CZ94"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ94"
FT                   /protein_id="AAK98955.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADGVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            160263..160877
FT                   /locus_tag="spr0152"
FT   CDS_pept        160263..160877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0152"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98956"
FT                   /db_xref="GOA:Q8DRF7"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF7"
FT                   /protein_id="AAK98956.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKVLLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            161830..162525
FT                   /gene="hk07"
FT                   /locus_tag="spr0153"
FT   CDS_pept        161830..162525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hk07"
FT                   /locus_tag="spr0153"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98957"
FT                   /db_xref="GOA:Q8DRF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF6"
FT                   /protein_id="AAK98957.1"
FT                   /translation="MLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRM
FT                   YAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGF
FT                   KIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGM
FT                   SAEKLANIREKLSQKYFEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIESAEQAGV
FT                   QYRITIQDE"
FT   gene            162537..163823
FT                   /gene="rr07"
FT                   /locus_tag="spr0154"
FT   CDS_pept        162537..163823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rr07"
FT                   /locus_tag="spr0154"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98958"
FT                   /db_xref="GOA:Q8DRF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF5"
FT                   /protein_id="AAK98958.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATASHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQAWQIFISDQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRIPITKQLFIQFVMDVFHLFEH
FT                   LKADDMTDIVKTIHAIQSFDELVSYIKETLISFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            163827..164408
FT                   /locus_tag="spr0155"
FT   CDS_pept        163827..164408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0155"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98959"
FT                   /db_xref="GOA:Q8CZ93"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ93"
FT                   /protein_id="AAK98959.1"
FT                   /translation="MYSFTKGAIILSGGSIMKKKPIYLWVLLILSALISVPSLFGIVSP
FT                   LPSKEALRAAQKQVAGVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFL
FT                   VRKNLQYANYTYVGYVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIV
FT                   INVLFLALVFYKMWRQQKALAEEEETEELT"
FT   gene            164354..164956
FT                   /locus_tag="spr0156"
FT   CDS_pept        164354..164956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0156"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to NrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98960"
FT                   /db_xref="GOA:Q8DRF4"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRF4"
FT                   /protein_id="AAK98960.1"
FT                   /translation="MATTESLGRRRGNRRAYLSIDKKELSRYNLGSCFLIIDKIMEVHM
FT                   KTISLVYISLSGNTESFVTRLKDYLLSQYKRIEVQKIHIKDLVKEGKNFYEMDHPYVAF
FT                   LPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYS
FT                   QRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   repeat_region   complement(164956..165068)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CA"
FT   gene            complement(165249..166511)
FT                   /locus_tag="spr0157"
FT   CDS_pept        complement(165249..166511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0157"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98961"
FT                   /db_xref="GOA:Q8DRF3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF3"
FT                   /protein_id="AAK98961.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKPYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   repeat_region   166648..166754
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(166821..167279)
FT                   /locus_tag="spr0158"
FT   CDS_pept        complement(166821..167279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0158"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98962"
FT                   /db_xref="GOA:Q8CZ92"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ92"
FT                   /protein_id="AAK98962.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(167276..167797)
FT                   /locus_tag="spr0159"
FT   CDS_pept        complement(167276..167797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0159"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to autolysin response regulator in Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:spr0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98963"
FT                   /db_xref="GOA:Q8DRF2"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF2"
FT                   /protein_id="AAK98963.1"
FT                   /translation="MKRFLKSINKGVQEVRLILYEKQGEKFMKVELQISETYEEEKLIV
FT                   QAPQPTDKVQKVIEFAENLDQREKIKGKIDDQVYLVEIGKIQRFYIENRKVLAETASQT
FT                   YSIDLRLYQVLKLLPSNFIQISQSEIINIDSISHLKLTPNGLVEIFLKNESFTYSSRRY
FT                   LKTIKEKLEL"
FT   repeat_region   167773..167925
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            168072..170021
FT                   /gene="hexB"
FT                   /locus_tag="spr0160"
FT   CDS_pept        168072..170021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hexB"
FT                   /locus_tag="spr0160"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98964"
FT                   /db_xref="GOA:P0A3R2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3R2"
FT                   /protein_id="AAK98964.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVEQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   repeat_region   170144..170286
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            complement(170346..170813)
FT                   /gene="ribE"
FT                   /locus_tag="spr0161"
FT   CDS_pept        complement(170346..170813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="spr0161"
FT                   /product="Riboflavin synthase beta chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98965"
FT                   /db_xref="GOA:P66041"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66041"
FT                   /protein_id="AAK98965.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(170814..172019)
FT                   /gene="ribA"
FT                   /locus_tag="spr0162"
FT   CDS_pept        complement(170814..172019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="spr0162"
FT                   /product="Riboflavin biosynthesis; GTP-cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:spr0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98966"
FT                   /db_xref="GOA:Q8DRF1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF1"
FT                   /protein_id="AAK98966.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLRKYHIGAQMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(172039..172674)
FT                   /gene="ribC"
FT                   /locus_tag="spr0163"
FT   CDS_pept        complement(172039..172674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="spr0163"
FT                   /product="Riboflavin synthase alpha-chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98967"
FT                   /db_xref="GOA:Q8DRF0"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRF0"
FT                   /protein_id="AAK98967.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWHQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(172659..173759)
FT                   /gene="ribD"
FT                   /locus_tag="spr0164"
FT   CDS_pept        complement(172659..173759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="spr0164"
FT                   /product="Riboflavin biosynthese; a deaminase"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:spr0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98968"
FT                   /db_xref="GOA:Q8DRE9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE9"
FT                   /protein_id="AAK98968.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHYVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   gene            174163..174756
FT                   /gene="ruvA"
FT                   /locus_tag="spr0165"
FT   CDS_pept        174163..174756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="spr0165"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98969"
FT                   /db_xref="GOA:Q8DRE8"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRE8"
FT                   /protein_id="AAK98969.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            174766..175329
FT                   /gene="tag"
FT                   /locus_tag="spr0166"
FT   CDS_pept        174766..175329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="spr0166"
FT                   /product="3-Methyladenine DNA glycosylase I, constitutive"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:spr0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98970"
FT                   /db_xref="GOA:Q8CWV9"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWV9"
FT                   /protein_id="AAK98970.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKIFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            175326..176003
FT                   /locus_tag="spr0167"
FT   CDS_pept        175326..176003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0167"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98971"
FT                   /db_xref="GOA:Q8DRE7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE7"
FT                   /protein_id="AAK98971.1"
FT                   /translation="MMSNKNKGILIFAILYTVLFVFDGVKLLASLMPSAIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLSGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   repeat_region   complement(175991..176089)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(176158..177189)
FT                   /locus_tag="spr0168"
FT   CDS_pept        complement(176158..177189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0168"
FT                   /product="Conserved hypothetical protein"
FT                   /note="MccF-like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:spr0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98972"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE6"
FT                   /protein_id="AAK98972.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKSKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVIRFD
FT                   YNK"
FT   repeat_region   complement(177273..177389)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CA"
FT   gene            complement(177444..178148)
FT                   /locus_tag="spr0169"
FT   CDS_pept        complement(177444..178148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0169"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98973"
FT                   /db_xref="GOA:Q8CZ91"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ91"
FT                   /protein_id="AAK98973.1"
FT                   /translation="MVLRGVPMSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIF
FT                   EEVIPQILEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFI
FT                   TSLFALVSALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRP
FT                   PFWKSVLVILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNI
FT                   RSVSAGPTRYQE"
FT   gene            complement(178139..179083)
FT                   /gene="corA"
FT                   /locus_tag="spr0170"
FT   CDS_pept        complement(178139..179083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="spr0170"
FT                   /product="Magnesium and cobalt transporter"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98974"
FT                   /db_xref="GOA:Q8DRE5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE5"
FT                   /protein_id="AAK98974.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            179215..182046
FT                   /gene="uvrA"
FT                   /locus_tag="spr0171"
FT   CDS_pept        179215..182046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="spr0171"
FT                   /product="Excinuclease ABC-subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:spr0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98975"
FT                   /db_xref="GOA:P63385"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63385"
FT                   /protein_id="AAK98975.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLREGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVIGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            182039..183100
FT                   /gene="pepP"
FT                   /locus_tag="spr0172"
FT   CDS_pept        182039..183100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="spr0172"
FT                   /product="Aminopeptidase P"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98976"
FT                   /db_xref="GOA:Q8DRE4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE4"
FT                   /protein_id="AAK98976.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLDLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMVLTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            183232..183630
FT                   /gene="arsC"
FT                   /locus_tag="spr0173"
FT   CDS_pept        183232..183630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="spr0173"
FT                   /product="Arsenate reductase, putative"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98977"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE3"
FT                   /protein_id="AAK98977.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            183696..184265
FT                   /locus_tag="spr0174"
FT   CDS_pept        183696..184265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0174"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ90"
FT                   /protein_id="AAK98978.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPESDDGSQQTQTITYKDKTFLSLTIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            184352..184618
FT                   /locus_tag="spr0175"
FT   CDS_pept        184352..184618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0175"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98979"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CZ89"
FT                   /protein_id="AAK98979.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            184622..185041
FT                   /locus_tag="spr0176"
FT   CDS_pept        184622..185041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0176"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98980"
FT                   /db_xref="GOA:Q8DRE2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRE2"
FT                   /protein_id="AAK98980.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRV
FT                   KELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAE
FT                   RMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            185057..185362
FT                   /locus_tag="spr0177"
FT   CDS_pept        185057..185362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0177"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98981"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRE1"
FT                   /protein_id="AAK98981.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            185813..187069
FT                   /gene="folC"
FT                   /locus_tag="spr0178"
FT   CDS_pept        185813..187069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="spr0178"
FT                   /product="Dihydrofolate:folylpolyglutamate synthetase"
FT                   /EC_number="6.3.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:spr0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98982"
FT                   /db_xref="GOA:Q8DRE0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRE0"
FT                   /protein_id="AAK98982.1"
FT                   /translation="MCMFEVKEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHVT
FT                   GTNGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLADQVKE
FT                   MEKTLLQTPDQLSFFELLTLVAFLYFRGQEVDLVLLEVGIGGLLDTTNVVTGELAVITS
FT                   IGLDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVNLYQAGQ
FT                   DFSVLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMGEGKEAVDEQAVRKAL
FT                   EQTHWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGSLKRKDYQGM
FT                   LGYLTENLPQVELKMTGFDYQGSLDETDVTGYHVIPSYREFISSFEERADAQDLLFVTG
FT                   SLYFISEVRGYLLDREQIN"
FT   gene            187066..187584
FT                   /locus_tag="spr0179"
FT   CDS_pept        187066..187584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0179"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98983"
FT                   /db_xref="InterPro:IPR020961"
FT                   /db_xref="InterPro:IPR027279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ88"
FT                   /protein_id="AAK98983.1"
FT                   /translation="MTPFFELVILGELLVRENFSKLVAERKFIMKLKRFTLSLASLASF
FT                   SLLVACSQRAQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDR
FT                   ITLVVTGTTGTWTELESDGDQKVKQVTFDSANQRMIIGDDVKIYTVNGNQIVVDDMDRD
FT                   PSDQIVLTK"
FT   gene            187730..189262
FT                   /gene="cls"
FT                   /locus_tag="spr0180"
FT   CDS_pept        187730..189262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="spr0180"
FT                   /product="Cardiolipin synthase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98984"
FT                   /db_xref="GOA:Q8DRD9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD9"
FT                   /protein_id="AAK98984.1"
FT                   /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITV
FT                   LILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLG
FT                   SMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWKKMV
FT                   EDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAH
FT                   RLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGY
FT                   WKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKP
FT                   IFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDK
FT                   KFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYEN
FT                   AVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            189340..189483
FT                   /gene="orf47"
FT                   /locus_tag="spr0181"
FT   CDS_pept        189340..189483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf47"
FT                   /locus_tag="spr0181"
FT                   /product="orf47"
FT                   /note="Induced during competence"
FT                   /db_xref="EnsemblGenomes-Gn:spr0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD8"
FT                   /protein_id="AAK98985.1"
FT                   /translation="MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNPR
FT                   TF"
FT   gene            189502..191058
FT                   /locus_tag="spr0182"
FT   CDS_pept        189502..191058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0182"
FT                   /product="Hypothetical protein"
FT                   /note="Competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98986"
FT                   /db_xref="GOA:Q8CZ87"
FT                   /db_xref="InterPro:IPR016978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ87"
FT                   /protein_id="AAK98986.1"
FT                   /translation="MNRRNDMSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKI
FT                   LLWSTLVTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYV
FT                   SQGGFFFAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATL
FT                   LALPFLFAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFN
FT                   LGHRRFVHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKI
FT                   LENMFFYGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHA
FT                   SYLMVVFPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLS
FT                   VPFLMKFVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPL
FT                   HYTATEENRNKLLNDLKEKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKI
FT                   K"
FT   gene            191172..193385
FT                   /gene="nrdD"
FT                   /locus_tag="spr0183"
FT   CDS_pept        191172..193385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="spr0183"
FT                   /product="Ribonucleotide reductase, class III, anaerobic"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98987"
FT                   /db_xref="GOA:Q8DRD7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD7"
FT                   /protein_id="AAK98987.1"
FT                   /translation="MRMIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHTAADKVM
FT                   DVTPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRT
FT                   QRDFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLP
FT                   KHVANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATA
FT                   QISQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKQEDYAWKKAQ
FT                   KDIYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHR
FT                   TAIFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPM
FT                   GCRSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDA
FT                   LVYRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATV
FT                   FFGNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDK
FT                   FGSIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNP
FT                   KALEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVK
FT                   RTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            193581..194087
FT                   /locus_tag="spr0184"
FT   CDS_pept        193581..194087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0184"
FT                   /product="Hypothetical protein"
FT                   /note="Similar to histone acetyltransferase HPA2 and
FT                   related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:spr0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98988"
FT                   /db_xref="GOA:Q8CZ86"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ86"
FT                   /protein_id="AAK98988.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLE
FT                   SNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            194080..194670
FT                   /gene="nrdG"
FT                   /locus_tag="spr0185"
FT   CDS_pept        194080..194670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="spr0185"
FT                   /product="NrdD activating enzyme, generating glycyl
FT                   radical"
FT                   /db_xref="EnsemblGenomes-Gn:spr0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98989"
FT                   /db_xref="GOA:Q8DRD6"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD6"
FT                   /protein_id="AAK98989.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            194667..195284
FT                   /locus_tag="spr0186"
FT   CDS_pept        194667..195284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0186"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98990"
FT                   /db_xref="GOA:Q8CZ85"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ85"
FT                   /protein_id="AAK98990.1"
FT                   /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIE
FT                   EPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
FT   gene            195551..195859
FT                   /gene="rpsJ"
FT                   /locus_tag="spr0187"
FT   CDS_pept        195551..195859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="spr0187"
FT                   /product="30S Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:spr0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98991"
FT                   /db_xref="GOA:P66340"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66340"
FT                   /protein_id="AAK98991.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            196076..196702
FT                   /gene="rplC"
FT                   /locus_tag="spr0188"
FT   CDS_pept        196076..196702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="spr0188"
FT                   /product="50S Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98992"
FT                   /db_xref="GOA:Q8CWV8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV8"
FT                   /protein_id="AAK98992.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            196727..197350
FT                   /gene="rplD"
FT                   /locus_tag="spr0189"
FT   CDS_pept        196727..197350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="spr0189"
FT                   /product="50S Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98993"
FT                   /db_xref="GOA:Q8CWV7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV7"
FT                   /protein_id="AAK98993.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            197350..197646
FT                   /gene="rplW"
FT                   /locus_tag="spr0190"
FT   CDS_pept        197350..197646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="spr0190"
FT                   /product="50S Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:spr0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98994"
FT                   /db_xref="GOA:Q8CWV6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV6"
FT                   /protein_id="AAK98994.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            197664..198497
FT                   /gene="rplB"
FT                   /locus_tag="spr0191"
FT   CDS_pept        197664..198497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="spr0191"
FT                   /product="50S Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98995"
FT                   /db_xref="GOA:Q8CWV5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV5"
FT                   /protein_id="AAK98995.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            198601..198882
FT                   /gene="rpsS"
FT                   /locus_tag="spr0192"
FT   CDS_pept        198601..198882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="spr0192"
FT                   /product="30S Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:spr0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98996"
FT                   /db_xref="GOA:P0A4B6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B6"
FT                   /protein_id="AAK98996.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            complement(198743..199198)
FT                   /locus_tag="spr0193"
FT   CDS_pept        complement(198743..199198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0193"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98997"
FT                   /db_xref="GOA:Q8CZ84"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ84"
FT                   /protein_id="AAK98997.1"
FT                   /translation="MLIGEAEPFARGRKRFIVGPSFANASDTTKLALSKPKLFSALATA
FT                   EFKTFKMISAALFGVNVKIAIASATLLPRMLSRTRRDLRGETRTVRAIALAEVISAIYV
FT                   LLIFYVFSCRLQRDLCKYELVQIHQVCGLPCLLGCKQVRVYVRHKLQ"
FT   gene            198894..199238
FT                   /gene="rplV"
FT                   /locus_tag="spr0194"
FT   CDS_pept        198894..199238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="spr0194"
FT                   /product="50S Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:spr0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98998"
FT                   /db_xref="GOA:P61183"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61183"
FT                   /protein_id="AAK98998.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            199251..199904
FT                   /gene="rpsC"
FT                   /locus_tag="spr0195"
FT   CDS_pept        199251..199904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="spr0195"
FT                   /product="30S Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK98999"
FT                   /db_xref="GOA:P0A4C4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4C4"
FT                   /protein_id="AAK98999.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            199908..200321
FT                   /gene="rplP"
FT                   /locus_tag="spr0196"
FT   CDS_pept        199908..200321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="spr0196"
FT                   /product="50S Ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:spr0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99000"
FT                   /db_xref="GOA:P0A476"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A476"
FT                   /protein_id="AAK99000.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            200331..200537
FT                   /gene="rpmC"
FT                   /locus_tag="spr0197"
FT   CDS_pept        200331..200537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="spr0197"
FT                   /product="50S Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:spr0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99001"
FT                   /db_xref="GOA:P0A484"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A484"
FT                   /protein_id="AAK99001.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            200562..200822
FT                   /gene="rpsQ"
FT                   /locus_tag="spr0198"
FT   CDS_pept        200562..200822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="spr0198"
FT                   /product="30S Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:spr0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99002"
FT                   /db_xref="GOA:P0A4B4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4B4"
FT                   /protein_id="AAK99002.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            200848..201216
FT                   /gene="rplN"
FT                   /locus_tag="spr0199"
FT   CDS_pept        200848..201216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="spr0199"
FT                   /product="50S Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:spr0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99003"
FT                   /db_xref="GOA:P0A474"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A474"
FT                   /protein_id="AAK99003.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            201294..201599
FT                   /gene="rplX"
FT                   /locus_tag="spr0200"
FT   CDS_pept        201294..201599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="spr0200"
FT                   /product="50S Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:spr0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99004"
FT                   /db_xref="GOA:P60630"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60630"
FT                   /protein_id="AAK99004.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            201623..202165
FT                   /gene="rplE"
FT                   /locus_tag="spr0201"
FT   CDS_pept        201623..202165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="spr0201"
FT                   /product="50S Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:spr0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99005"
FT                   /db_xref="GOA:Q8CWV4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV4"
FT                   /protein_id="AAK99005.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            202183..202452
FT                   /gene="rpsN"
FT                   /locus_tag="spr0202"
FT   CDS_pept        202183..202452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="spr0202"
FT                   /product="30S Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:spr0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99006"
FT                   /db_xref="GOA:P66420"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66420"
FT                   /protein_id="AAK99006.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            202737..203135
FT                   /gene="rpsH"
FT                   /locus_tag="spr0203"
FT   CDS_pept        202737..203135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="spr0203"
FT                   /product="30S Ribosomal protein S8 (S8)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99007"
FT                   /db_xref="GOA:P66633"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66633"
FT                   /protein_id="AAK99007.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            203327..203863
FT                   /gene="rplF"
FT                   /locus_tag="spr0204"
FT   CDS_pept        203327..203863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="spr0204"
FT                   /product="50S Ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99008"
FT                   /db_xref="GOA:Q8CWV3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV3"
FT                   /protein_id="AAK99008.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            203947..204303
FT                   /gene="rplR"
FT                   /locus_tag="spr0205"
FT   CDS_pept        203947..204303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="spr0205"
FT                   /product="50S Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:spr0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99009"
FT                   /db_xref="GOA:Q8CWV2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV2"
FT                   /protein_id="AAK99009.1"
FT                   /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            204321..204815
FT                   /gene="rpsE"
FT                   /locus_tag="spr0206"
FT   CDS_pept        204321..204815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="spr0206"
FT                   /product="30S Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:spr0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99010"
FT                   /db_xref="GOA:P66582"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66582"
FT                   /protein_id="AAK99010.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            204829..205011
FT                   /gene="rpmD"
FT                   /locus_tag="spr0207"
FT   CDS_pept        204829..205011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="spr0207"
FT                   /product="50S Ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:spr0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99011"
FT                   /db_xref="GOA:Q8CWV1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV1"
FT                   /protein_id="AAK99011.1"
FT                   /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MITAVSHLVTVEEVN"
FT   gene            205156..205596
FT                   /gene="rplO"
FT                   /locus_tag="spr0208"
FT   CDS_pept        205156..205596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="spr0208"
FT                   /product="50S Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:spr0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99012"
FT                   /db_xref="GOA:Q8CWV0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWV0"
FT                   /protein_id="AAK99012.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            205609..206919
FT                   /gene="secY"
FT                   /locus_tag="spr0209"
FT   CDS_pept        205609..206919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="spr0209"
FT                   /product="Multispanning membrane protein, translocator of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:spr0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99013"
FT                   /db_xref="GOA:Q8DRD5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD5"
FT                   /protein_id="AAK99013.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            207070..207708
FT                   /gene="adk"
FT                   /locus_tag="spr0210"
FT   CDS_pept        207070..207708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="spr0210"
FT                   /product="Adenylate kinase (ATP-AMP transphosphorylase)"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99014"
FT                   /db_xref="GOA:Q8DRD4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRD4"
FT                   /protein_id="AAK99014.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            207771..208043
FT                   /gene="infA"
FT                   /locus_tag="spr0211"
FT   CDS_pept        207771..208043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="spr0211"
FT                   /product="Translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99015"
FT                   /db_xref="GOA:P65122"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65122"
FT                   /protein_id="AAK99015.1"
FT                   /translation="MLSLCLEASNRNLWRCFCVAKDDVIEVEGKVVDTMPNAMFTVELE
FT                   NGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            208068..208184
FT                   /gene="rpmJ"
FT                   /locus_tag="spr0212"
FT   CDS_pept        208068..208184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="spr0212"
FT                   /product="50S Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:spr0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99016"
FT                   /db_xref="GOA:P0A496"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A496"
FT                   /protein_id="AAK99016.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   gene            208202..208567
FT                   /gene="rpsM"
FT                   /locus_tag="spr0213"
FT   CDS_pept        208202..208567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="spr0213"
FT                   /product="30S Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99017"
FT                   /db_xref="GOA:P66393"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66393"
FT                   /protein_id="AAK99017.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            208585..208968
FT                   /gene="rpsK"
FT                   /locus_tag="spr0214"
FT   CDS_pept        208585..208968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="spr0214"
FT                   /product="30S Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:spr0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99018"
FT                   /db_xref="GOA:P66360"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66360"
FT                   /protein_id="AAK99018.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            209011..209946
FT                   /gene="rpoA"
FT                   /locus_tag="spr0215"
FT   CDS_pept        209011..209946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="spr0215"
FT                   /product="RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99019"
FT                   /db_xref="GOA:P66709"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66709"
FT                   /protein_id="AAK99019.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            209958..210344
FT                   /gene="rplQ"
FT                   /locus_tag="spr0216"
FT   CDS_pept        209958..210344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="spr0216"
FT                   /product="50S Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:spr0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99020"
FT                   /db_xref="GOA:Q8CWU8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWU8"
FT                   /protein_id="AAK99020.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            210516..210875
FT                   /locus_tag="spr0217"
FT   CDS_pept        210516..210875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0217"
FT                   /product="Conserved hypothetical protein"
FT                   /note="ACT domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99021"
FT                   /db_xref="GOA:P67383"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67383"
FT                   /protein_id="AAK99021.1"
FT                   /translation="MSIFVRIMLYYLKRILFNVKVSYFKKNWSLLMKAIITVVGKDKSG
FT                   IVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVK
FT                   INIQSAAIFEAMYNI"
FT   gene            210885..212222
FT                   /locus_tag="spr0218"
FT   CDS_pept        210885..212222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0218"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99022"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRD2"
FT                   /protein_id="AAK99022.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPNINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGREGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            212409..213158
FT                   /gene="gpmB"
FT                   /locus_tag="spr0219"
FT   CDS_pept        212409..213158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="spr0219"
FT                   /product="Phosphoglycerate mutase 2 paralog"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99023"
FT                   /db_xref="GOA:Q8DRD1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD1"
FT                   /protein_id="AAK99023.1"
FT                   /translation="MGGFYFIIHDIIEANGGRKMVKVRLYLVRHGKTMFNTIGRAQGWS
FT                   DTPLTAEGERGIQELGIGLRESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMD
FT                   KRIREWCFGSFDGAYDGDLFMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEK
FT                   LSGRIKEGFEMIAKEMEDQGGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYE
FT                   DGQFRVEVVGDRSYRELGREKMEEGSI"
FT   gene            complement(213261..214295)
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0220"
FT   CDS_pept        complement(213261..214295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0220"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99024"
FT                   /db_xref="GOA:Q8DRD0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRD0"
FT                   /protein_id="AAK99024.1"
FT                   /translation="MLVFMRAFSDFGTPMLIGEGYRTFPVLIYTQFISEVGGNSAFAIM
FT                   AIIIALAIFLIQKHIANRYSFSMNLLHPIEPKKTTKGKMAAIYATVYGIIFISVLPQIY
FT                   LIYTSFLKTSGMVFFKGYSPNSYKLAFNRMGSAIFNTIRIPLIALVLVVLFATFISYLA
FT                   VRKRNLFTNLIDSLSMVPYIVPGTVLGIAFISSFNTGLFGSGFLMITGTAFILIMSLSA
FT                   RKLPYTIRSSVASLQQIAPSIEEAAESLGSSRLNIFAKITTPMMLSDIISGAILSWVTL
FT                   ISELSTSILLYNVKTRTMTVAIYTEVLRGNYGVAAALSTILTVLTVGSLLLFMKISKSN
FT                   SITL"
FT   gene            complement(214280..214906)
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0221"
FT   CDS_pept        complement(214280..214906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0221"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99025"
FT                   /db_xref="GOA:Q8DRC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC9"
FT                   /protein_id="AAK99025.1"
FT                   /translation="MERKKLNIWTASSFFLFLTYLVFLVYPIITVLKQALIHEGQFSLA
FT                   NFVTFFSKAYYSETLVNSFRVSITATVTSLVVGTLLAYLFSMYDFQGKKFLQILIIIAS
FT                   MSAPFVGAYSWVLLLGRNGVITKFLTNALHLPAIDIYGFKGIVLVFTLQLFPLVFLYVA
FT                   GTMNSIDNSLLEAAESMGSFGFKPIVTVVLPLLVPTLLAAPCLYL"
FT   gene            complement(214896..215987)
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0222"
FT   CDS_pept        complement(214896..215987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0222"
FT                   /product="ABC transporter ATP-binding protein-iron
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99026"
FT                   /db_xref="GOA:Q8DRC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC8"
FT                   /protein_id="AAK99026.1"
FT                   /translation="MSEIEIINAKKIYHDVPVIENLNITIPKGSLFTLLGASGCGKTTL
FT                   LRMIAGFNSIKDGEFYFDDTKINNMEPSKRNIGLVFQNYAIFPHLTVRDNVAFGLMQKK
FT                   VPKEELIQQTNKYLELMQIAQYADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEPLSN
FT                   LEAKLRLDMRQTIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRPKELY
FT                   HKPANEFVATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMPALDQVEEQAIHVSIRPE
FT                   EFIKDESGDIEGTIRDSVYLGLNTDYFIETGFASKIQVSEESTFEEELQKGNRIRLRIN
FT                   TQKLNIFSADGSQNLIKGVNHGT"
FT   gene            complement(216000..216368)
FT                   /locus_tag="spr0223"
FT                   /note="ABC-SBP-truncation"
FT   CDS_pept        complement(216000..216368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0223"
FT                   /product="ABC transporter solute-binding protein-iron
FT                   transport, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC7"
FT                   /protein_id="AAK99027.1"
FT                   /translation="MTVGLSYEDSAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKSKN
FT                   MENAKKFIDFIISQEVQDTLGTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNK
FT                   SDIVKKYNEVFTDIQSKQ"
FT   repeat_region   216419..216525
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(216513..216707)
FT                   /locus_tag="spr0224"
FT                   /note="ABC-SBP-truncation"
FT   CDS_pept        complement(216513..216707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0224"
FT                   /product="ABC transporter substrate-binding protein-iron
FT                   transport, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC6"
FT                   /protein_id="AAK99028.1"
FT                   /translation="MNIEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKD
FT                   DKAWSYVKDLFTLIDGIVK"
FT   repeat_region   217198..217296
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B1"
FT   gene            complement(217339..217536)
FT                   /locus_tag="spr0225"
FT   CDS_pept        complement(217339..217536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0225"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99029"
FT                   /db_xref="GOA:Q8CZ83"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ83"
FT                   /protein_id="AAK99029.1"
FT                   /translation="MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKV
FT                   FKKYLHISPKKLKSLGRIVK"
FT   gene            complement(217611..218387)
FT                   /gene="pflE"
FT                   /locus_tag="spr0226"
FT   CDS_pept        complement(217611..218387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflE"
FT                   /locus_tag="spr0226"
FT                   /product="Pyruvate formate-lyase 3"
FT                   /EC_number="1.97.1.4"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99030"
FT                   /db_xref="GOA:Q8DRC5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC5"
FT                   /protein_id="AAK99030.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGINALHPEDLIDYQKVFLNHHINCYF"
FT   gene            218461..219255
FT                   /gene="deoR"
FT                   /locus_tag="spr0227"
FT   CDS_pept        218461..219255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR"
FT                   /locus_tag="spr0227"
FT                   /product="DEOR-type transcriptional regulator"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99031"
FT                   /db_xref="GOA:Q8DRC4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC4"
FT                   /protein_id="AAK99031.1"
FT                   /translation="MLFFAFYFGRIKRRCKMKRLEQIIKLVSEYEKIDVNTLSEKLNVS
FT                   KVTIRKDLDKLESKGLLHREHGYAVLNSGDDLNVRLSINYEIKRKIVQEAVKLVSDNET
FT                   IMIESGSTCALLAEEICKQKRNVTIVTNSFFIANFVRAYDSCRIIVLGGEFQKDSQVTV
FT                   GPLLKEMIQTFHVHQAFVGTDGYDKEMGFTGKDLMRSEVVQYISAASDKVIVLTDSSKF
FT                   DKRGTVRRFALSQVYEVITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            219268..220248
FT                   /locus_tag="spr0228"
FT   CDS_pept        219268..220248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0228"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Resembles sorbitol operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99032"
FT                   /db_xref="GOA:Q8DRC3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC3"
FT                   /protein_id="AAK99032.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NAGIVKIEIENFDTNMFKLENYVKEKYGLESLEIIPNEFDDNPTILSERISQVAAGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            220443..220763
FT                   /gene="PTS-EIIA"
FT                   /locus_tag="spr0229"
FT   CDS_pept        220443..220763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIIA"
FT                   /locus_tag="spr0229"
FT                   /product="Phosphotransferase system sugar-specific EIIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99033"
FT                   /db_xref="GOA:Q8DRC2"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC2"
FT                   /protein_id="AAK99033.1"
FT                   /translation="MEMIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            220809..221117
FT                   /gene="PTS-EIIB"
FT                   /locus_tag="spr0230"
FT   CDS_pept        220809..221117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIIB"
FT                   /locus_tag="spr0230"
FT                   /product="Phosphotransferase system sugar-specific EIIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99034"
FT                   /db_xref="GOA:Q8DRC1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC1"
FT                   /protein_id="AAK99034.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            221110..222432
FT                   /gene="PTS-EIIC"
FT                   /locus_tag="spr0231"
FT   CDS_pept        221110..222432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EIIC"
FT                   /locus_tag="spr0231"
FT                   /product="Phosphotransferase system sugar-specific EIIC
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99035"
FT                   /db_xref="GOA:Q8DRC0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRC0"
FT                   /protein_id="AAK99035.1"
FT                   /translation="MGKKRRFIMAKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTV
FT                   VGSLFLIMGQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNS
FT                   GVEALPAGVLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIY
FT                   TFFIKRKIVIKMPEQVPQAIAKQFEAMIPAFVIFLLSMIVYILAKSLTNGGTFIEMIYS
FT                   AIQVPLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASG
FT                   NLSLENGAHIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQALGKVAAFPAIFNV
FT                   NEPVVFGFPIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGF
FT                   LVGGWQGVVTQLLVLVISTVVYFPFFKIQDRLAYQNEIKQS"
FT   gene            222574..225021
FT                   /gene="pflF"
FT                   /locus_tag="spr0232"
FT   CDS_pept        222574..225021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflF"
FT                   /locus_tag="spr0232"
FT                   /product="Formate acetyltransferase 3"
FT                   /EC_number="2.3.1.54"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99036"
FT                   /db_xref="GOA:Q8DRB9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB9"
FT                   /protein_id="AAK99036.1"
FT                   /translation="MLTMVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERA
FT                   VLATRAYERYKEQPNVLKRAYMLKEILENMSIYIEEESMIAGNQASSNKDAPIFPEYTL
FT                   EFVLNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETG
FT                   FFGMEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIF
FT                   IVIDAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWF
FT                   IQCILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVR
FT                   SQSHTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGL
FT                   DARFMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWG
FT                   YRCTGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLT
FT                   RMSVIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSD
FT                   SLAAIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVT
FT                   AAYDIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAE
FT                   GCSPSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTF
FT                   FNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTE
FT                   HTL"
FT   gene            225040..225708
FT                   /gene="talC"
FT                   /locus_tag="spr0233"
FT   CDS_pept        225040..225708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talC"
FT                   /locus_tag="spr0233"
FT                   /product="Transaldolase C"
FT                   /EC_number="2.2.1.2"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99037"
FT                   /db_xref="GOA:Q8DRB8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB8"
FT                   /protein_id="AAK99037.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEAGADYLAPYYNRMENLNIDSNSVIRQLVLAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
FT                   "
FT   gene            225726..226814
FT                   /gene="gldA"
FT                   /locus_tag="spr0234"
FT   CDS_pept        225726..226814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="spr0234"
FT                   /product="Glycerol dehydrogenase, NAD+ dependent"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99038"
FT                   /db_xref="GOA:Q8DRB7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB7"
FT                   /protein_id="AAK99038.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   repeat_region   complement(226873..226979)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B2"
FT   gene            227269..229770
FT                   /gene="leuS"
FT                   /locus_tag="spr0235"
FT   CDS_pept        227269..229770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="spr0235"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99039"
FT                   /db_xref="GOA:Q8DRB6"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRB6"
FT                   /protein_id="AAK99039.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   VGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVA
FT                   DYKHQASLKSDLVRTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAC
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVEKRDGSFFHIETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKAYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHLAEELWQTVAETGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVISVPNKLVNIVVK"
FT   gene            229964..230659
FT                   /locus_tag="spr0236"
FT   CDS_pept        229964..230659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0236"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to acetyltransferases, including
FT                   N-acetylases of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:spr0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99040"
FT                   /db_xref="GOA:Q8DRB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB5"
FT                   /protein_id="AAK99040.1"
FT                   /translation="MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEAFSVEKHAE
FT                   DLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLP
FT                   SRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            230671..231087
FT                   /locus_tag="spr0237"
FT   CDS_pept        230671..231087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0237"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to histone acetyltransferase HPA2 and
FT                   related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:spr0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99041"
FT                   /db_xref="GOA:Q8DRB4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB4"
FT                   /protein_id="AAK99041.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEQALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVLVQDLIVLPIYQRQGIGSALMKEALEDYKDAYQVQLV
FT                   TEETERTLGFYRSMGFEILSTYNCIGMTWMNRKK"
FT   gene            232128..233126
FT                   /gene="ruvB"
FT                   /locus_tag="spr0238"
FT   CDS_pept        232128..233126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="spr0238"
FT                   /product="Branch migration of Holliday structures"
FT                   /db_xref="EnsemblGenomes-Gn:spr0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99042"
FT                   /db_xref="GOA:Q8CWU7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWU7"
FT                   /protein_id="AAK99042.1"
FT                   /translation="MSRILDNEIMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            233107..233679
FT                   /locus_tag="spr0239"
FT   CDS_pept        233107..233679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0239"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99043"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ82"
FT                   /protein_id="AAK99043.1"
FT                   /translation="MNTVKNKQEILEAFRENPDMMAILTIIRDLGLKDSWLAAGSVRNF
FT                   IWNLLSDKSPFDHETDIDVIFFDPDFSYEETLLLKKKLREDFPQYQWELKNQVYMHQHS
FT                   PHTASYTSSRDAMSKYPERCTAVGLRLNEESDFELYVPYGLEDILNFQVRPTPHFLENE
FT                   DRMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            233892..234668
FT                   /gene="uppS"
FT                   /locus_tag="spr0240"
FT   CDS_pept        233892..234668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="spr0240"
FT                   /product="Undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:spr0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99044"
FT                   /db_xref="GOA:Q8DRB3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="PDB:4Q9M"
FT                   /db_xref="PDB:4Q9O"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRB3"
FT                   /protein_id="AAK99044.1"
FT                   /translation="MNRNKIMFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQ
FT                   PRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNY
FT                   VPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL
FT                   KLISQDVLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGA
FT                   YSELYFTDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            234677..235480
FT                   /gene="cdsA"
FT                   /locus_tag="spr0241"
FT   CDS_pept        234677..235480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="spr0241"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:spr0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99045"
FT                   /db_xref="GOA:Q8DRB2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRB2"
FT                   /protein_id="AAK99045.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIVAMLAMHEL
FT                   LKIRGLATMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            235502..236761
FT                   /gene="eep"
FT                   /locus_tag="spr0242"
FT   CDS_pept        235502..236761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eep"
FT                   /locus_tag="spr0242"
FT                   /product="Determinant for enhanced expression of pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:spr0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99046"
FT                   /db_xref="GOA:Q8DRB1"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRB1"
FT                   /protein_id="AAK99046.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            236774..238627
FT                   /gene="proS"
FT                   /locus_tag="spr0243"
FT   CDS_pept        236774..238627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="spr0243"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:spr0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99047"
FT                   /db_xref="GOA:Q8DRB0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRB0"
FT                   /protein_id="AAK99047.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVVSFDEIPVEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTAEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            238727..240106
FT                   /gene="bglA"
FT                   /locus_tag="spr0244"
FT   CDS_pept        238727..240106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="spr0244"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:spr0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99048"
FT                   /db_xref="GOA:Q8DRA9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA9"
FT                   /protein_id="AAK99048.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNG
FT                   F"
FT   gene            240298..242106
FT                   /gene="glmS"
FT                   /locus_tag="spr0245"
FT   CDS_pept        240298..242106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="spr0245"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:spr0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99049"
FT                   /db_xref="GOA:Q8DRA8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRA8"
FT                   /protein_id="AAK99049.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEDGLSVLEAFKKALHIIRGSYAFALIDS
FT                   ENPDVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNSRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDDAGQVVIDP
FT                   AIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            242225..243274
FT                   /locus_tag="spr0246"
FT   CDS_pept        242225..243274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0246"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:spr0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99050"
FT                   /db_xref="GOA:Q8DRA7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA7"
FT                   /protein_id="AAK99050.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRSEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(243374..247144)
FT                   /gene="pulA"
FT                   /locus_tag="spr0247"
FT   CDS_pept        complement(243374..247144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulA"
FT                   /locus_tag="spr0247"
FT                   /product="Alkaline amylopullulanase"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99051"
FT                   /db_xref="GOA:Q8DRA6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011838"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR040806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA6"
FT                   /protein_id="AAK99051.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAADSGKNESDISSPRNANASLEKTEEKPATEPTTS
FT                   TSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEKPSENWPNGALSFKDA
FT                   KKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVPKMNEAWLDQDYKVFS
FT                   YEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTDFTATGKYGRYIDIPL
FT                   NEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDDDESIYTNPYYVHDIR
FT                   MTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTITDVAIDEAGKKVTYSG
FT                   DFSDTKHPYTVSYNSDQFTTKTSWHLKDETYSYDGKLGADLKEEGKQVDLTLWSPSADK
FT                   VSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFTGYYYQYQIERQGKTV
FT                   LALDPYAKSLAAWNSDDAKIDDAHKVAKAAFVDPAKLGPQDLTYGKIHNFKTREDAVIY
FT                   EAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQLLPVLSYYFVNELKNH
FT                   ERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFKNLINEIHKRGMGAIL
FT                   DVVYNHTAKVDIFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHHMTKRLLVDSIKYLVD
FT                   TYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTYAGDENMPTKAADQDW
FT                   MKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKNLIAQPTNFEADSPGD
FT                   VIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLMVLTAQGTPFIHSGQE
FT                   YGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHDSYDSSDAVNKFDWTK
FT                   ATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHLITVPGQNGVEKEDVV
FT                   IGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADENQAGSVGIANPKGLE
FT                   WTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQDPAPEARPDSTKPDAK
FT                   VADAENKPSQATADSQAEQPAQEAQASSVKEAVQNESVENSSKKNIPATPDRQAELPNT
FT                   GIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            247561..247974
FT                   /gene="rpsL"
FT                   /locus_tag="spr0248"
FT   CDS_pept        247561..247974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="spr0248"
FT                   /product="30S Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:spr0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99052"
FT                   /db_xref="GOA:P0A4A8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4A8"
FT                   /protein_id="AAK99052.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            247994..248464
FT                   /gene="rpsG"
FT                   /locus_tag="spr0249"
FT   CDS_pept        247994..248464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="spr0249"
FT                   /product="30S Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:spr0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99053"
FT                   /db_xref="GOA:Q8CWU6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWU6"
FT                   /protein_id="AAK99053.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            248889..250970
FT                   /gene="fusA"
FT                   /locus_tag="spr0250"
FT   CDS_pept        248889..250970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="spr0250"
FT                   /product="Elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:spr0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99054"
FT                   /db_xref="GOA:P64023"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64023"
FT                   /protein_id="AAK99054.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEEIRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            251074..255465
FT                   /gene="polC"
FT                   /locus_tag="spr0251"
FT   CDS_pept        251074..255465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="spr0251"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:spr0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99055"
FT                   /db_xref="GOA:Q8DRA5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DRA5"
FT                   /protein_id="AAK99055.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPVFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   IEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVSRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFEPVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            255567..255830
FT                   /locus_tag="spr0252"
FT   CDS_pept        255567..255830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0252"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99056"
FT                   /db_xref="GOA:Q8CZ81"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ81"
FT                   /protein_id="AAK99056.1"
FT                   /translation="MSKMSMSIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQVLTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            255823..256101
FT                   /locus_tag="spr0253"
FT   CDS_pept        255823..256101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0253"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99057"
FT                   /db_xref="GOA:Q8DRA4"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA4"
FT                   /protein_id="AAK99057.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            256296..257537
FT                   /gene="pepS"
FT                   /locus_tag="spr0254"
FT   CDS_pept        256296..257537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepS"
FT                   /locus_tag="spr0254"
FT                   /product="Aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99058"
FT                   /db_xref="GOA:Q8DRA3"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA3"
FT                   /protein_id="AAK99058.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDLLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEGFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVIFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSLVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            257547..257777
FT                   /locus_tag="spr0255"
FT   CDS_pept        257547..257777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0255"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99059"
FT                   /db_xref="GOA:Q8DRA2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA2"
FT                   /protein_id="AAK99059.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAVLGAMIVLAIFWRRGS"
FT   repeat_region   complement(257791..258030)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBBBA"
FT   gene            258090..258812
FT                   /gene="rsuA"
FT                   /locus_tag="spr0256"
FT   CDS_pept        258090..258812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="spr0256"
FT                   /product="Ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:spr0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99060"
FT                   /db_xref="GOA:Q8DRA1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA1"
FT                   /protein_id="AAK99060.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKFQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   NTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVETFAEGIPLKDFTCQPA
FT                   RLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   repeat_region   complement(258822..258925)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CA"
FT   gene            258893..259057
FT                   /locus_tag="spr0257"
FT   CDS_pept        258893..259057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0257"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ80"
FT                   /protein_id="AAK99061.1"
FT                   /translation="MTWFEEIFEEYKFEKGEGQCPRLLCFLVASFVKRVIIDCRIKGGI
FT                   YERDSRIIY"
FT   gene            259029..260363
FT                   /gene="pepC"
FT                   /locus_tag="spr0258"
FT   CDS_pept        259029..260363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="spr0258"
FT                   /product="Aminopeptidase C"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99062"
FT                   /db_xref="GOA:Q8DRA0"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DRA0"
FT                   /protein_id="AAK99062.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALERRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(260419..261330)
FT                   /gene="manN"
FT                   /locus_tag="spr0259"
FT   CDS_pept        complement(260419..261330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="spr0259"
FT                   /product="Phosphotransferase system, mannose-specific EIID"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99063"
FT                   /db_xref="GOA:Q8DR99"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR99"
FT                   /protein_id="AAK99063.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(261354..262157)
FT                   /gene="manM"
FT                   /locus_tag="spr0260"
FT   CDS_pept        complement(261354..262157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="spr0260"
FT                   /product="Phosphotransferase system, mannose-specific EIIC"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99064"
FT                   /db_xref="GOA:Q8DR98"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR98"
FT                   /protein_id="AAK99064.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(262185..263183)
FT                   /gene="manL"
FT                   /locus_tag="spr0261"
FT   CDS_pept        complement(262185..263183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="spr0261"
FT                   /product="Phosphotransferase system, mannose-specific
FT                   EIIAB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99065"
FT                   /db_xref="GOA:Q8DR97"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR97"
FT                   /protein_id="AAK99065.1"
FT                   /translation="MTIMSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGP
FT                   DDLYAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLI
FT                   QAYTERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGT
FT                   VIGDGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPG
FT                   NVKANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTG
FT                   KTLVNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(263358..264377)
FT                   /gene="adhP"
FT                   /locus_tag="spr0262"
FT   CDS_pept        complement(263358..264377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="spr0262"
FT                   /product="Alcohol dehydrogenase, propanol-preferring"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99066"
FT                   /db_xref="GOA:Q8DR96"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR96"
FT                   /protein_id="AAK99066.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   repeat_region   264594..264706
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            complement(264716..265528)
FT                   /locus_tag="spr0263"
FT   CDS_pept        complement(264716..265528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0263"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99067"
FT                   /db_xref="GOA:Q8DR95"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR95"
FT                   /protein_id="AAK99067.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKKTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKNPNCILLQTRASDKYA
FT                   LAKDMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            265664..267136
FT                   /locus_tag="spr0264"
FT   CDS_pept        265664..267136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0264"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99068"
FT                   /db_xref="GOA:Q8DR94"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR94"
FT                   /protein_id="AAK99068.1"
FT                   /translation="MINDIILLLFVKIKRRLMMDKLFKLKENGTDVRTEVLAGLTTFFA
FT                   MSYILFVNPQILSQTGMPAQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTF
FT                   TVVFGLGYSWQEALAMVFICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYV
FT                   GIKNAGLLKFTIDPGNYTVVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAIT
FT                   IFFVIKGIKGGIILSILTTTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSE
FT                   GLGALVSDTARLPETLMAILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKA
FT                   LYSDLIGTTVGAIAGTSNVTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIV
FT                   PTAATAPILIIVGIMMLGSLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYT
FT                   LTKLVKGQVKDVHVMIWILDALFILNYISMAL"
FT   gene            267187..267897
FT                   /locus_tag="spr0265"
FT   CDS_pept        267187..267897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0265"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99069"
FT                   /db_xref="GOA:Q8DR93"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR93"
FT                   /protein_id="AAK99069.1"
FT                   /translation="MMKEKNMWKELLNRAGWILVFLLAVLLYQVPLVVTSILTLKEVAL
FT                   LQSGLIVAGLSIVVLALFIMGARKTKLASFNFSFFRAKDLARLGLSYLVIVGSNILGSI
FT                   LLQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIIPKKIFRGKENL
FT                   GFVVGTIVFALLHQPSNLPSLLIYGGMSTVLSWTAYKTQRLEMSILLHMIVNGIAFCLL
FT                   ALVVIMSRTLGISV"
FT   gene            268022..268966
FT                   /gene="sulA"
FT                   /locus_tag="spr0266"
FT   CDS_pept        268022..268966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulA"
FT                   /locus_tag="spr0266"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:spr0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99070"
FT                   /db_xref="GOA:P59655"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="PDB:2VEF"
FT                   /db_xref="PDB:2VEG"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59655"
FT                   /protein_id="AAK99070.1"
FT                   /translation="MSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAE
FT                   GASMLDIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAA
FT                   GADLVNDITGLMGDEKMPHVVAEARAQVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEE
FT                   ELADFETLPIEELMEAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDK
FT                   LHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVV
FT                   RVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            268968..270290
FT                   /gene="sulB"
FT                   /locus_tag="spr0267"
FT   CDS_pept        268968..270290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulB"
FT                   /locus_tag="spr0267"
FT                   /product="Dihydrofolate synthetase"
FT                   /EC_number="6.3.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:spr0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99071"
FT                   /db_xref="GOA:Q8DR92"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR92"
FT                   /protein_id="AAK99071.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQS
FT                   LLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLFDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALAVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALEDMLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQ
FT                   NVTDKKEEKQTVRIVTGSLYFLSQVRVYLMERKNENGYTKD"
FT   gene            270271..270825
FT                   /gene="sulC"
FT                   /locus_tag="spr0268"
FT   CDS_pept        270271..270825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulC"
FT                   /locus_tag="spr0268"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:spr0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99072"
FT                   /db_xref="GOA:P59656"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59656"
FT                   /protein_id="AAK99072.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            270868..271680
FT                   /gene="sulD"
FT                   /locus_tag="spr0269"
FT   CDS_pept        270868..271680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="spr0269"
FT                   /product="Aldolase-pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:spr0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99073"
FT                   /db_xref="GOA:P59657"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="PDB:2CG8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59657"
FT                   /protein_id="AAK99073.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFIVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(271725..272096)
FT                   /locus_tag="spr0270"
FT   CDS_pept        complement(271725..272096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0270"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99074"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ79"
FT                   /protein_id="AAK99074.1"
FT                   /translation="MIFNPICCMIRKKKGDRDMAFTNTHMRSASFGIVTSLPDDIIDSF
FT                   WYIIDHFLKNVFELEEELEFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVL
FT                   VLDMDGRETILLPEENDLF"
FT   gene            272399..272845
FT                   /gene="rplM"
FT                   /locus_tag="spr0271"
FT   CDS_pept        272399..272845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="spr0271"
FT                   /product="50S Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99075"
FT                   /db_xref="GOA:Q8CWU5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWU5"
FT                   /protein_id="AAK99075.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            272865..273257
FT                   /gene="rpsI"
FT                   /locus_tag="spr0272"
FT   CDS_pept        272865..273257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="spr0272"
FT                   /product="30S Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99076"
FT                   /db_xref="GOA:Q8CWU4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWU4"
FT                   /protein_id="AAK99076.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   repeat_region   complement(273503..273606)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            273609..273815
FT                   /locus_tag="spr0273"
FT                   /note="transposase B"
FT   CDS_pept        273609..273815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0273"
FT                   /product="Degenerate transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99077"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR91"
FT                   /protein_id="AAK99077.1"
FT                   /translation="MDNARFHRMGKLELLCEEFGYKLLPLPPYSPEYNPIEKTWAHIKK
FT                   HLKKVLPSCNTFYEALLSCSCFN"
FT   gene            273803..273895
FT                   /locus_tag="spr0274"
FT                   /note="bglB-truncation"
FT   CDS_pept        273803..273895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0274"
FT                   /product="Phospho-beta-glucosidase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99078"
FT                   /protein_id="AAK99078.1"
FT                   /translation="MFQLTINRYKKKSFYWYKEVIESNGETLDN"
FT   gene            273944..274309
FT                   /locus_tag="spr0275"
FT   CDS_pept        273944..274309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0275"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99079"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ78"
FT                   /protein_id="AAK99079.1"
FT                   /translation="MKDDFGGYKMTLTIHVYYKGDGDSAIKFAREMLDSGLVEEIRNQK
FT                   GNLKYEYFLPIEKEGTILLIDQWINQEALDEHHQSKTMQKILDLRKKYHLQMQVERYIE
FT                   DDSGMPESDKSFIDTGN"
FT   gene            274499..275935
FT                   /gene="bglA"
FT                   /locus_tag="spr0276"
FT   CDS_pept        274499..275935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="spr0276"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:spr0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99080"
FT                   /db_xref="GOA:Q8DR89"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR89"
FT                   /protein_id="AAK99080.1"
FT                   /translation="MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR
FT                   EITLGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNE
FT                   EGLQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKR
FT                   YKDKVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAV
FT                   KIGHEINPDFQIGCMIAMCPIYPVTCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFK
FT                   YWERKGISVDFTDQDKEDLLGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNN
FT                   YVKASEWEWQIDPEGLRYALNWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYL
FT                   GAHIREMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRS
FT                   PKKSFGWYKEVISSNGESVE"
FT   gene            275987..276226
FT                   /locus_tag="spr0277"
FT   CDS_pept        275987..276226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0277"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99081"
FT                   /db_xref="GOA:Q8DR88"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR88"
FT                   /protein_id="AAK99081.1"
FT                   /translation="MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALW
FT                   LAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK"
FT   gene            276329..276670
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0278"
FT   CDS_pept        276329..276670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0278"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99082"
FT                   /db_xref="GOA:Q8DR87"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR87"
FT                   /protein_id="AAK99082.1"
FT                   /translation="MDLRKGENIMAKALIICAAGMSSSLMAQKTTEFLKGKGKDIVVDA
FT                   ISATEGGKAIAAAAFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQIPPQAYIPIPMGIEK
FT                   MANLILENI"
FT   gene            276788..278767
FT                   /gene="bglG"
FT                   /locus_tag="spr0279"
FT   CDS_pept        276788..278767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG"
FT                   /locus_tag="spr0279"
FT                   /product="Transcription antiterminator BglG family"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99083"
FT                   /db_xref="GOA:Q8DR86"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR86"
FT                   /protein_id="AAK99083.1"
FT                   /translation="MNVLNIKEKDILQFLIKNKERFVTSKELAEYLSCSDRTVRNVLKL
FT                   IEKTMIIQGVRLISKQGQGYQIFFENQGAYQEFRQTYELAEDYTKTAVSKGDDRLVFIL
FT                   NKLLFEQVPVLFDDLADELYVSRSTLSHDFKKIRVMLSEYNLSIESRANKGVYVSGEER
FT                   DKRRFIINYFLENQFFKTIHCYVKFNFFDQTVPLEEFARIVLDECQEANLKLSDFVLQN
FT                   LVVHIALSVIRLKSGFEIKNIDCQMTDDAIERKVAQRILSKVREVTNQEFPVQEIDYIT
FT                   LHLLAKSQQCQKNQKNISEEVLKKSLLKTFQNLGLDDMYNFSSDFQLIEGLITHLMTLQ
FT                   VRLESRITLNNPLVDEIKQNYSDIFFMTREILANMDKFLEWSISDDEIAYVSLHFLAAM
FT                   ERSKESTKFNILAICATGFGAAQMLRNRLETEFGNRVEVVDVIGYYELNQEKLKGIDFI
FT                   VSAVDLSNLYFQIPVFKVSVFLKSDEMEMIRKAMDQMQVSSHIQSSKISKFENNNFRQY
FT                   FSKENFLICTKYDKENLLEKMVEGLSVGESNEFEQSLLYGIKQREELSSVVFSEKIAVP
FT                   HPIQPFGTEGKVSIAICKDSLLWDNQSSHVQLVFLLSPSIYGNEGLATVTKKIVSLTEN
FT                   DELQNQLISCNNFEDFINIFEKIK"
FT   gene            278777..279091
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0280"
FT   CDS_pept        278777..279091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0280"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99084"
FT                   /db_xref="GOA:Q8DR85"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR85"
FT                   /protein_id="AAK99084.1"
FT                   /translation="MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQ
FT                   SNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
FT                   "
FT   gene            279110..279616
FT                   /locus_tag="spr0281"
FT   CDS_pept        279110..279616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99085"
FT                   /db_xref="GOA:Q8CZ77"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ77"
FT                   /protein_id="AAK99085.1"
FT                   /translation="MDRKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLL
FT                   NQFISPSLIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLT
FT                   WTSWFTNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKAYQQFVQLEK
FT                   NSLRL"
FT   gene            279696..281042
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0282"
FT   CDS_pept        279696..281042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0282"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Related to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:spr0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99086"
FT                   /db_xref="GOA:Q8DR84"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR84"
FT                   /protein_id="AAK99086.1"
FT                   /translation="MDQQNGLFGFLENHVMEPMGKLAQFKVVRAITAAGMAAVPFTIVG
FT                   SMFLVFSILPQAFSFWPIVADIFSASFGKFTSLYMVANYATMGSLSLYFVLSLAYELTK
FT                   IYAEEEELNMNPLNGSLLALMAFVMTVPQIIFDGGMMKAVTSLKEGAVIADGWAMGNGV
FT                   ARFGTTGIFTAIIMAIVTVLIYRMCVKNNWVIKMPEAVPEGVSRGFTALIPGFVVAFVV
FT                   IFINGLLVAMGTDIFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAF
FT                   VSPIALANMAENAAGGHFAVAGEFSNMFVIAGGSGATLGLCLYIAFASKSEQLKAIGRA
FT                   SVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFIKPIIAQVPWP
FT                   TPVGIGAFLGTADLRAVLVALVCAFAAFLVYLPFIRVYDQKLVKEEQGI"
FT   gene            281424..281600
FT                   /locus_tag="spr0283"
FT   CDS_pept        281424..281600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0283"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ76"
FT                   /protein_id="AAK99087.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            282002..284215
FT                   /gene="xylS"
FT                   /locus_tag="spr0284"
FT   CDS_pept        282002..284215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylS"
FT                   /locus_tag="spr0284"
FT                   /product="Alpha-xylosidase"
FT                   /EC_number="3.2.1.-"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99088"
FT                   /db_xref="GOA:Q8DR83"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR83"
FT                   /protein_id="AAK99088.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSQTGSFEDRTTQLIYNRDFGQI
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(284437..284913)
FT                   /gene="basA"
FT                   /locus_tag="spr0285"
FT   CDS_pept        complement(284437..284913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basA"
FT                   /locus_tag="spr0285"
FT                   /product="Gluthatione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99089"
FT                   /db_xref="GOA:Q8DR82"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR82"
FT                   /protein_id="AAK99089.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINTFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDHKSGPLGKRIEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            285103..288339
FT                   /gene="hysA"
FT                   /locus_tag="spr0286"
FT   CDS_pept        285103..288339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hysA"
FT                   /locus_tag="spr0286"
FT                   /product="Hyaluronate lyase precursor
FT                   (hyaluronidase/hyase)"
FT                   /EC_number="4.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99090"
FT                   /db_xref="GOA:Q8CWU3"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="PDB:1N7Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWU3"
FT                   /protein_id="AAK99090.1"
FT                   /translation="MILQYVYWSVYMQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETT
FT                   TNTIQQSQKEVQYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSSADAS
FT                   TRVIEAKDGAITISSPEKLRAAVHRMVPIEAKKKYKLRFKIKTDNKVGIAKVRIIEESG
FT                   KDKRLWNSATTSGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQ
FT                   PSEDSQTDKQLEEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIV
FT                   SKDGKEVKKIPLKILASVKDTYTDRLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVAD
FT                   SLSSISSQADRIYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVR
FT                   DSMEWMHKHVYNSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFV
FT                   PDPEHFRKTTDNPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGE
FT                   GFYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFA
FT                   PLLVNGELMDMSRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQ
FT                   SDSYYDVFKNLKTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAMYNAEKGFGFG
FT                   LSLFSSRTLNYEHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETD
FT                   AKRADSDTGKVLPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSN
FT                   IQNTSTDTAATTIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESSDSKKNI
FT                   GYFFFKKSSISMSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNV
FT                   DRATFNQMIKELESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYT
FT                   IRKEGDEYKIAYYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNL
FT                   PQTGEGQSILASLGFLLLGAFYLFRRGKNN"
FT   repeat_region   complement(289173..289279)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(289483..290112)
FT                   /gene="kdgA"
FT                   /locus_tag="spr0287"
FT   CDS_pept        complement(289483..290112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgA"
FT                   /locus_tag="spr0287"
FT                   /product="2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:spr0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99091"
FT                   /db_xref="GOA:Q8DR81"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR81"
FT                   /protein_id="AAK99091.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSALSPAYISAVKAPIPQVSVMVTGG
FT                   VDLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYVTLR"
FT   gene            complement(290122..291123)
FT                   /gene="kdgK"
FT                   /locus_tag="spr0288"
FT   CDS_pept        complement(290122..291123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="spr0288"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:spr0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99092"
FT                   /db_xref="GOA:Q8DR80"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR80"
FT                   /protein_id="AAK99092.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITVAIGQEVRAILLLLLKEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEERFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSATSIENLLANAQDIIR"
FT   gene            complement(291154..291795)
FT                   /locus_tag="spr0289"
FT   CDS_pept        complement(291154..291795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0289"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99093"
FT                   /db_xref="GOA:Q8CZ75"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ75"
FT                   /protein_id="AAK99093.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKDYQLFNYGMRGEEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(291814..292629)
FT                   /gene="gno"
FT                   /locus_tag="spr0290"
FT   CDS_pept        complement(291814..292629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gno"
FT                   /locus_tag="spr0290"
FT                   /product="5-keto-D-gluconate 5-reductase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99094"
FT                   /db_xref="GOA:Q8DR79"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR79"
FT                   /protein_id="AAK99094.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            292900..293334
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0291"
FT   CDS_pept        292900..293334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0291"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99095"
FT                   /db_xref="GOA:Q8DR78"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR78"
FT                   /protein_id="AAK99095.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            293346..294536
FT                   /gene="ugl"
FT                   /locus_tag="spr0292"
FT   CDS_pept        293346..294536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugl"
FT                   /locus_tag="spr0292"
FT                   /product="Unsaturated glucuronyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99096"
FT                   /db_xref="GOA:Q8DR77"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR77"
FT                   /protein_id="AAK99096.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELDHHDLGFLYTPSCMAEYKINGDGEAREATLKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            294547..295038
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0293"
FT   CDS_pept        294547..295038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0293"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99097"
FT                   /db_xref="GOA:Q8DR76"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR76"
FT                   /protein_id="AAK99097.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKEIN
FT                   IGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            295053..295832
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0294"
FT   CDS_pept        295053..295832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0294"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99098"
FT                   /db_xref="GOA:Q8DR75"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR75"
FT                   /protein_id="AAK99098.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            295819..296637
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0295"
FT   CDS_pept        295819..296637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0295"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99099"
FT                   /db_xref="GOA:Q8DR74"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR74"
FT                   /protein_id="AAK99099.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPTKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            296637..296930
FT                   /locus_tag="spr0296"
FT   CDS_pept        296637..296930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0296"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99100"
FT                   /db_xref="GOA:Q8DR73"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR73"
FT                   /protein_id="AAK99100.1"
FT                   /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLAS
FT                   LTSGDEVLLLSGIHGKIISIQDDLVSLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            296952..298853
FT                   /locus_tag="spr0297"
FT   CDS_pept        296952..298853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0297"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99101"
FT                   /db_xref="GOA:Q8CZ74"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ74"
FT                   /protein_id="AAK99101.1"
FT                   /translation="MKEERRQFFERVDGNQCRDYILSHCSKDYEKVKSSLERLIDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWSYMLNRQEYLLQFMIGYLVEGDKGYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSYYRAKYTLSNWGILQTIPMLAIYHFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYQELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEMLSLSAVVLNKEDLLNGLDVKVDLLSILFLGREKVKRLQEFERRAWQP
FT                   KSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGMHYIEGAYWSA
FT                   EPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALTQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVYQTDDREV
FT                   ENALAFEVKNDETDKLILLLSEDIRVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            298847..299914
FT                   /gene="regR"
FT                   /locus_tag="spr0298"
FT   CDS_pept        298847..299914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="spr0298"
FT                   /product="Transcription regulator, member of GalR family"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99102"
FT                   /db_xref="GOA:Q8DR72"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR72"
FT                   /protein_id="AAK99102.1"
FT                   /translation="MLEIGILNSEYVIISISRRCFRLEKKLTIKDIAEMAQTSKTTVSF
FT                   YLNGKYEKMSQETREKIEKVIHETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIV
FT                   KGIEDIASQNGYQVMIGNSNYSQESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEK
FT                   KKKMVFFDSQLYEHRTSWVKTNNYDAVYDMTQSCIEKGYEYFLLITADTSRLSTRIERA
FT                   SGFVDALTDANMRHASLTIEDKHTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTV
FT                   IKELNYNLPQVGLIGFDNTEWTCFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEER
FT                   QQVLDCSVNWKESTF"
FT   gene            complement(300143..300406)
FT                   /locus_tag="spr0299"
FT   CDS_pept        complement(300143..300406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0299"
FT                   /product="Hypothetical protein, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99103"
FT                   /db_xref="GOA:Q8CZ73"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ73"
FT                   /protein_id="AAK99103.1"
FT                   /translation="MSTHFVLQELKKTRIRRYLMKSLARLLIIHVFISIFLFFALISGA
FT                   VSHTVLLLLLLFLPALNKGLEKNGYLSSTQPSSFSSYPFHNF"
FT   gene            complement(300360..300602)
FT                   /locus_tag="spr0300"
FT   CDS_pept        complement(300360..300602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0300"
FT                   /product="Hypothetical protein, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99104"
FT                   /db_xref="GOA:Q8CZ72"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ72"
FT                   /protein_id="AAK99104.1"
FT                   /translation="MKKEKKQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSLL
FT                   NTKHIFKTILGAFFFGVMIHIVDSLRIARAKKDQD"
FT   gene            complement(300618..300812)
FT                   /gene="yorfE"
FT                   /locus_tag="spr0301"
FT   CDS_pept        complement(300618..300812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yorfE"
FT                   /locus_tag="spr0301"
FT                   /product="Transcription regulator"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99105"
FT                   /db_xref="GOA:Q8DR71"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR71"
FT                   /protein_id="AAK99105.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWEEDF"
FT   gene            300978..301928
FT                   /gene="yllC"
FT                   /locus_tag="spr0302"
FT   CDS_pept        300978..301928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yllC"
FT                   /locus_tag="spr0302"
FT                   /product="YllC protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99106"
FT                   /db_xref="GOA:P59658"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59658"
FT                   /protein_id="AAK99106.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPEGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVVRKIHK"
FT   gene            301940..302257
FT                   /gene="ftsL"
FT                   /locus_tag="spr0303"
FT   CDS_pept        301940..302257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="spr0303"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99107"
FT                   /db_xref="GOA:Q8DR70"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR70"
FT                   /protein_id="AAK99107.1"
FT                   /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            302261..304513
FT                   /gene="pbpX"
FT                   /locus_tag="spr0304"
FT   CDS_pept        302261..304513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="spr0304"
FT                   /product="Penicillin-binding protein 2X"
FT                   /EC_number="2.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99108"
FT                   /db_xref="GOA:P59676"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="PDB:1PYY"
FT                   /db_xref="PDB:5OAU"
FT                   /db_xref="PDB:5OIZ"
FT                   /db_xref="PDB:5OJ0"
FT                   /db_xref="PDB:5OJ1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59676"
FT                   /protein_id="AAK99108.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANM
FT                   MSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRLGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQ
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMK
FT                   VMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRMMTFSQGFAHSSNVG
FT                   MTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQ
FT                   TQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVL
FT                   VGTDPVYGTMYNHSTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVGLTDYIFSAVSMS
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAMKDSLNLQTTAKALEQVSQQSP
FT                   YPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAE
FT                   EVPDMYGWTKETAETLAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLGD"
FT   gene            304515..305495
FT                   /gene="mraY"
FT                   /locus_tag="spr0305"
FT   CDS_pept        304515..305495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="spr0305"
FT                   /product="Undecaprenyl-phosphate-UDP-MurNAc-pentapeptide
FT                   phospho-MurNAc-pentapeptide transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99109"
FT                   /db_xref="GOA:Q8DR69"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR69"
FT                   /protein_id="AAK99109.1"
FT                   /translation="MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLITSVLVAFFFALFSSQFSNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDILSVFGYPVHLGFFYIFFALFWLVGFSNA
FT                   VNLTDGVDGLASISVVISLFAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   repeat_region   305595..305645
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            305635..305820
FT                   /locus_tag="spr0306"
FT   CDS_pept        305635..305820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0306"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99110"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ71"
FT                   /protein_id="AAK99110.1"
FT                   /translation="MLEIDLTVLNDLSCSYFILLYSFEVVDKAKLMWFEEIFEEIKNIG
FT                   QLKSKYLTFSDQCSIL"
FT   gene            306052..308157
FT                   /gene="clpL"
FT                   /locus_tag="spr0307"
FT   CDS_pept        306052..308157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="spr0307"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:spr0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99111"
FT                   /db_xref="GOA:Q8DR68"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR68"
FT                   /protein_id="AAK99111.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   YYRATGQLPGNAESDVQMQQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   ASEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIVSIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEVVARAICRNRAGFDEGNRPIGNFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMEDGV
FT                   LVIREKV"
FT   gene            complement(308453..308935)
FT                   /gene="luxS"
FT                   /locus_tag="spr0308"
FT   CDS_pept        complement(308453..308935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="spr0308"
FT                   /product="Autoinducer-2 production protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99112"
FT                   /db_xref="GOA:P65335"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65335"
FT                   /protein_id="AAK99112.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(309030..310514)
FT                   /locus_tag="spr0309"
FT   CDS_pept        complement(309030..310514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0309"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99113"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CZ70"
FT                   /protein_id="AAK99113.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPIWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIVTGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            310667..312274
FT                   /gene="dexB"
FT                   /locus_tag="spr0310"
FT   CDS_pept        310667..312274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="spr0310"
FT                   /product="Alpha, 1-6-glucosidase"
FT                   /EC_number="3.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:spr0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99114"
FT                   /db_xref="GOA:Q8DR67"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR67"
FT                   /protein_id="AAK99114.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNEDGVGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENPNSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMDFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLIRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGNVKSVLIENTLAQE
FT                   VFEKQILVPWDAFCVELL"
FT   gene            312433..312606
FT                   /locus_tag="spr0311"
FT   CDS_pept        312433..312606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ69"
FT                   /protein_id="AAK99115.1"
FT                   /translation="MNIKKRVLSAGLTFASALLLAACGQSGSDTKTYSSTFSGNPTTFN
FT                   YLLDYYADNIVN"
FT   gene            complement(312599..312760)
FT                   /locus_tag="spr0312"
FT                   /note="transposase B"
FT   CDS_pept        complement(312599..312760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0312"
FT                   /product="Degenerate transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99116"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR66"
FT                   /protein_id="AAK99116.1"
FT                   /translation="MRKVWHKLLPLLPYSPEYNPIEKTWAHIKKHLKKVLPSCNTFYEA
FT                   LLSCSCFN"
FT   gene            complement(313115..313462)
FT                   /locus_tag="spr0313"
FT                   /note="transposase A"
FT   CDS_pept        complement(313115..313462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0313"
FT                   /product="Transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99117"
FT                   /db_xref="GOA:Q8DR65"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR65"
FT                   /protein_id="AAK99117.1"
FT                   /translation="MWYNLFMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTNNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKEPHLL"
FT   repeat_region   313478..313576
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            313695..314657
FT                   /gene="cps2A"
FT                   /locus_tag="spr0314"
FT   CDS_pept        313695..314657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2A"
FT                   /locus_tag="spr0314"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:spr0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99118"
FT                   /db_xref="GOA:Q8CWU2"
FT                   /db_xref="InterPro:IPR004190"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWU2"
FT                   /protein_id="AAK99118.1"
FT                   /translation="MSRRFKKSRSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFR
FT                   YLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSLSVAVLADSEIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLTVNQ
FT                   SSSYLAAYKSLIAGETKAIVLNSVFENIIELEYPDYASKIKKIYTKGFTKKVEAPKTSK
FT                   NQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGNNQK
FT                   DKLTHAGIYGVDSSIHTFSESRWTFPIYIISNICLLYNT"
FT   gene            314551..315585
FT                   /gene="cps2H"
FT                   /locus_tag="spr0315"
FT   CDS_pept        314551..315585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2H"
FT                   /locus_tag="spr0315"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:spr0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99119"
FT                   /db_xref="GOA:Q8CWU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWU1"
FT                   /protein_id="AAK99119.1"
FT                   /translation="MRAFMELIRPFTPSQSLDGHSLFILFPIFVYYIIPKNINGVIRIL
FT                   SIFKSFIGFTAIFGLYEYMQHFNLMVNFVKIDAVKWIQTMNLNSVYYPSSIFLHYTYFA
FT                   YVLLLAFILVIVIPYKNRVLNLVYKTLIAISIFLPQSRIVWIAFGVILILSFILNRQGI
FT                   LTYRKLSVIVLILIIVVSLCLYFDVFAFISNYISLRFSSLYRYGLADGSLGQRIGTLRN
FT                   WENYLDSDTIKAIIGSGFGGVNSYLSTYSFFNGYTTADSTVTSFLIDTGVIGLFIFLLS
FT                   MFQILVIVVKGKGIFRELALYTIVASSIVSLTIDFWANYVILHIFYVVIICAFIGMRLT
FT                   KQEK"
FT   gene            315715..316872
FT                   /gene="cps2I"
FT                   /locus_tag="spr0316"
FT   CDS_pept        315715..316872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2I"
FT                   /locus_tag="spr0316"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:spr0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99120"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWU0"
FT                   /protein_id="AAK99120.1"
FT                   /translation="MTKSILYFLSTSDISSGATRSLLRLVSIVEDSDFRVIIILPEHGN
FT                   VEDELVNKGIKYYVVKQYIWNYWIKYLSHTKNIFYYLKLPLKYLLNRISFHKINRIIKK
FT                   EKVDIIHMNTLTSFLGAQAAIKQRKILIWHIREFMEEDLGIEFCNRKKAIDLINKSTCV
FT                   ISISDSISKNFSNEVLAYKKVIHNGLSIDDYFIDKVAFQNQKINILSSGRITPGKGQVD
FT                   LVRAIANLPERYKQMFKVDIIGIVESEEYFKEIKEVISNYKLDGIEFHGFQSDPTDFFR
FT                   KCDIVCVCSKKEAFGRITVEGMLSGALVIGTNSGGTKEIISTGETGYLYEPGDYMQLSE
FT                   ILKTIINNRSSILEIALRGQEKATLRFSDKNNAMQIMQLYKELEN"
FT   gene            316869..318278
FT                   /gene="cps2J"
FT                   /locus_tag="spr0317"
FT   CDS_pept        316869..318278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2J"
FT                   /locus_tag="spr0317"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:spr0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99121"
FT                   /db_xref="GOA:Q8CWT9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT9"
FT                   /protein_id="AAK99121.1"
FT                   /translation="MSRRYNYLLKNIGLLTLSNFGSKILVFLMVPLYTSVLSTSDYGTY
FT                   DLFNTTISLLIPIISINISEGVLRFALDEKNDSSIVYSIGWNIIIKGFLVVVLGIIFNN
FT                   IFNIFPLLKENSITFLLLYLSTIVYQFLSSFIRGIDKVSILSIAAILNTISILGFNILF
FT                   LIIIPLGLVGYFWSNILGLVLPSLYLIYKISQYNIKYTSLQNKKLQQRLVSYSIPLILN
FT                   SLGWWINNAIDRYVVIAFCGVAVNGIYSVGYKIPSILNIFANIFNQAWILSSVKSYRDE
FT                   DSEYFFSQVYNKYNMIMVLISGLLISCSKILAKFLYMNEFYDAWKFVPFLLIANVFGAI
FT                   SGFAGGIFSAVKDSKIYSQSTLVGAIVNIIFTFVFVYYYGAIGAAIATMISYFVVWIIR
FT                   VHTMRKYIKLKIFIRRDVFSYVLLIFQSIVLWLENSYILYPIQVVLFLLLVMLFYKEIK
FT                   SIIGELKKFLT"
FT   gene            318314..319552
FT                   /gene="cps2K"
FT                   /locus_tag="spr0318"
FT   CDS_pept        318314..319552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2K"
FT                   /locus_tag="spr0318"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:spr0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99122"
FT                   /db_xref="GOA:Q8CWT8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT8"
FT                   /protein_id="AAK99122.1"
FT                   /translation="MKIAVAGTGYVGLSIAVLLSQQHQVMAVDIIPEKVELINQRKSPI
FT                   QDDYIEKYLAKKDLNLVATLDAKEAYQDADFVVIAAPTNYDPKKNFFDTSAVESVIETA
FT                   LKYNPDAIMVIKSTVPVGYTESARKKFQTENILFSPEFLRESKALYDNLYPSRIILGTD
FT                   KNNERLVSAAETFARLLQEGALKENIDTLYMGFTEAEAVKLFANTYLALRVSYFNELDT
FT                   YSEMKGLDTQAIIDGVGLDPRIGSHYNNPSFGYGGYCLPKDTKQLLANYEDIPEELIGA
FT                   IVRSNSTRKDFIADQVLKMVDYYDYSAHNIFDERVEKDIIIGIYRLTMKSNSDNFRQSS
FT                   IQGIMKRIKAKGVRVVIYEPTLESGSTFFGSSVINDLEEFKRLSNAIVANRYDNSLEDV
FT                   KEKVYTRDIFERD"
FT   gene            319581..320186
FT                   /gene="cps2P"
FT                   /locus_tag="spr0319"
FT   CDS_pept        319581..320186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2P"
FT                   /locus_tag="spr0319"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:spr0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99123"
FT                   /db_xref="GOA:Q8CWT7"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT7"
FT                   /protein_id="AAK99123.1"
FT                   /translation="MLEAVHTEKQWERSATELPPFIIKRLPVRLTFDNNYFNDRYQVIP
FT                   IGGYNVIIENILKDVEVGLGVDCFDYREELEASANKVAFTGMIDQYFDYKHGELEYRSL
FT                   RFKHEVLDEENHQGNAVVNYTDREIPYTRIIEHKKFEYGLQPKTVITHEYPADWKRGDE
FT                   PYYPINDEKNNAIFSKYHEEASQNDKVIFCGRLADYKY"
FT   gene            320264..321133
FT                   /gene="cps2L"
FT                   /locus_tag="spr0320"
FT   CDS_pept        320264..321133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2L"
FT                   /locus_tag="spr0320"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:spr0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99124"
FT                   /db_xref="GOA:Q8CWT6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT6"
FT                   /protein_id="AAK99124.1"
FT                   /translation="MKGIILAGGSGTRLYPLTRATSKQLMPVYDKPMIYYPLSTLMLAG
FT                   IKDILIISTPQDLPRFKDLLLDGSEFGIRLSYAEQPSPDGLAQAFLIGEDFIGDDSVAL
FT                   ILGDNIYHGPGLSKMLQKTVSKEKGATVFGYQVKDPERFGVVEFDENMNAISIEEKPEC
FT                   PRSNYAVTGLYFYDNDVVEIAKSIKPSARGELEITDVNKAYLDRGNLSVEVMGRGFAWL
FT                   DTGTHESLLEASQYIETVQRMQNVQVANLEEIAYRMGYISREDVLELAQPLKKNEYGQY
FT                   LLRLIGEV"
FT   gene            321134..321727
FT                   /gene="cps2M"
FT                   /locus_tag="spr0321"
FT   CDS_pept        321134..321727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps2M"
FT                   /locus_tag="spr0321"
FT                   /product="The type 2 capsule locus of Streptococcus
FT                   pneumoniae"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99125"
FT                   /db_xref="GOA:Q8CWT5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT5"
FT                   /protein_id="AAK99125.1"
FT                   /translation="MTDNFFGKILAVRKIDAIPGMLEFDIPVHGDNRGWFKENFQKEKM
FT                   EPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGET
FT                   FGNTYQTIIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPS
FT                   LGIEWENIAEAEVSEADKHHPLLKDVKPLKKEDL"
FT   gene            321740..322789
FT                   /gene="cpsN"
FT                   /locus_tag="spr0322"
FT   CDS_pept        321740..322789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsN"
FT                   /locus_tag="spr0322"
FT                   /product="dTDP-glucose-4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:spr0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99126"
FT                   /db_xref="GOA:Q8DR64"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR64"
FT                   /protein_id="AAK99126.1"
FT                   /translation="MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGNR
FT                   ANIEEILGNRVELVVGDIADAELVDKLAAQADAIVHYAAESHNDNSLNDPSPFIHTNFI
FT                   GTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSPYSS
FT                   TKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLYGEGK
FT                   NVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQAADAYDHV
FT                   TDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKAEKEAVEANY
FT                   AKTQEIITV"
FT   gene            322855..323706
FT                   /gene="cpsO"
FT                   /locus_tag="spr0323"
FT   CDS_pept        322855..323706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsO"
FT                   /locus_tag="spr0323"
FT                   /product="dTDP-L-rhamnose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99127"
FT                   /db_xref="GOA:Q8DR63"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR63"
FT                   /protein_id="AAK99127.1"
FT                   /translation="MILITGANGQLGTELRYLLDERNEEYVAVDVAEMDITDAEMVEKV
FT                   FEEVKPTLVYHCAAYTAVDAAEDEGKELDFAINVTGTKNVAKASEKHGATLVYISTDYV
FT                   FDGKKPVGQEWEVDDRPDPQTEYGRTKRMGEELVEKHVSNFYIIRTAWVFGNYGKNFVF
FT                   TMQNLAKTHKTLTVVNDQYGRPTWTRTLAEFMTYLAENRKEFGYYHLSNDATEDTTWYD
FT                   FAVEILKDTDVEVKPVDSSQFPAKAKRPLNSTMSLAKAKATGFVIPTWQDALQEFYKQE
FT                   VR"
FT   gene            323782..324228
FT                   /locus_tag="spr0324"
FT                   /note="transposase G-truncation"
FT   CDS_pept        323782..324228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0324"
FT                   /product="Transposase, uncharacterized, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99128"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR62"
FT                   /protein_id="AAK99128.1"
FT                   /translation="MLLVLVSLAHSFGSVSIIAHTIHQKFNLKVPNYRQEEDWARMGLP
FT                   ITRKEISNWHIKASQYYLESLYNLLREKLLEQPLLHADETSYRVLESDSHLTYYWTFLS
FT                   GKSEKQGITLYHHDQRRSGSVVQEFLGNYSAYAIAVQSLGARRR"
FT   gene            324231..324680
FT                   /locus_tag="spr0325"
FT   CDS_pept        324231..324680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0325"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99129"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ68"
FT                   /protein_id="AAK99129.1"
FT                   /translation="MVNYEPLEAYRQLEEAELVGCWAHVRRKFFEAPPKQADKSSLGAK
FT                   GLAYCDQLFALERDWEALLADERLQKRQEELQPLMEDFFAWCRRQSVLSGSKLGRAIEY
FT                   SLKYKETFKTILKDGHLVLSNNLAERAIKSLVMGRSKRVQWTLLA"
FT   gene            324751..324909
FT                   /locus_tag="spr0326"
FT   CDS_pept        324751..324909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0326"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99130"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ67"
FT                   /protein_id="AAK99130.1"
FT                   /translation="MSLLETAKRHQLNSEKYLSYLLECLPNEETLVNKEVLEAYLPWTK
FT                   VVQEKCK"
FT   gene            325111..327093
FT                   /gene="aliA"
FT                   /locus_tag="spr0327"
FT   CDS_pept        325111..327093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aliA"
FT                   /locus_tag="spr0327"
FT                   /product="ABC transporter substrate-binding
FT                   protein-oligopeptide transport"
FT                   /db_xref="EnsemblGenomes-Gn:spr0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99131"
FT                   /db_xref="GOA:Q8DR61"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR61"
FT                   /protein_id="AAK99131.1"
FT                   /translation="MKSSKLLALAGVTLLAATTLAACSGSGSSAKGEKTFSYIYETDPD
FT                   NLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKW
FT                   YTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKA
FT                   LDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLK
FT                   SIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSA
FT                   SFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQ
FT                   AIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWKD
FT                   VNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQRVQSMKQS
FT                   LEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDII
FT                   KPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETTDVAKRYDKYAAAQAWL
FT                   TDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQK
FT                   AQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            327393..332696
FT                   /locus_tag="spr0328"
FT   CDS_pept        327393..332696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0328"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99132"
FT                   /db_xref="GOA:Q8DR60"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="InterPro:IPR035364"
FT                   /db_xref="InterPro:IPR040502"
FT                   /db_xref="InterPro:IPR040575"
FT                   /db_xref="InterPro:IPR040633"
FT                   /db_xref="PDB:3ECQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR60"
FT                   /protein_id="AAK99132.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGATFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGHDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVEKKEQQGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKDDSEKGKSRFGVFLKFKDTKNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYDDERTVVSVKTDNQEGVKTEDTPAEKETGPEVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYSLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKLRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITE
FT                   DANADKKVDWQDGAIAYRSIMNNPQGWKKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKMYYFNTQ
FT                   AGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRNN
FT                   ATVDDTSYFQNMYAFFTTGSDVSNVTLTLSREAGDEATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKKTALVADDFASLTAPAQAQEGLANAFDGNLSSLW
FT                   HTSWGGGDVGKPATMVLKEATEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTAT
FT                   DWPDNNKPKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALAKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APTVEKPEFKLSSVASDQGKTPDYKQEIARPETPEQILPATGESQFDTALFLASVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(332863..335022)
FT                   /gene="pbpA"
FT                   /locus_tag="spr0329"
FT   CDS_pept        complement(332863..335022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="spr0329"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.3.2.-"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:spr0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99133"
FT                   /db_xref="GOA:Q8DR59"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="PDB:2C5W"
FT                   /db_xref="PDB:2C6W"
FT                   /db_xref="PDB:2V2F"
FT                   /db_xref="PDB:2ZC5"
FT                   /db_xref="PDB:2ZC6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR59"
FT                   /protein_id="AAK99133.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTI
FT                   RILGAFLRNLQSNSLQGGSALTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGK
FT                   VIAQLGARHQSSNVSFGINQAVETNRDWGSTMKPITDYAPALEYGVYESTATIVHDEPY
FT                   NYPGTNTPVYNWDRGYFGNITLQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPS
FT                   IHYSNAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSN
FT                   VGTRAMKETTAYMMTDMMKTVLSYGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQ
FT                   FVAPDELFAGYTRKYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN
FT                   IPEGLYRNGEFVFKNGARSTWSSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(335019..335615)
FT                   /gene="recU"
FT                   /locus_tag="spr0330"
FT   CDS_pept        complement(335019..335615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="spr0330"
FT                   /product="Recombination protein U"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99134"
FT                   /db_xref="GOA:P0A456"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A456"
FT                   /protein_id="AAK99134.1"
FT                   /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMP
FT                   LEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            335681..336208
FT                   /locus_tag="spr0331"
FT   CDS_pept        335681..336208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0331"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99135"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR58"
FT                   /protein_id="AAK99135.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGSLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   QLNELAENFSEN"
FT   gene            336266..336607
FT                   /locus_tag="spr0332"
FT   CDS_pept        336266..336607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0332"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99136"
FT                   /db_xref="GOA:Q8DR57"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="PDB:6GQA"
FT                   /db_xref="PDB:6GQN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR57"
FT                   /protein_id="AAK99136.1"
FT                   /translation="MERDMASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYET
FT                   YAALVKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFG
FT                   KQILDNSDF"
FT   gene            336620..337023
FT                   /gene="rnpB"
FT                   /locus_tag="sprs02"
FT   ncRNA           336620..337023
FT                   /gene="rnpB"
FT                   /locus_tag="sprs02"
FT                   /product="Ribonuclease P-RNA component"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            337078..338250
FT                   /locus_tag="spr0333"
FT   CDS_pept        337078..338250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0333"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99137"
FT                   /db_xref="GOA:Q8DR56"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR56"
FT                   /protein_id="AAK99137.1"
FT                   /translation="MQDCNMKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQ
FT                   GDVRAIIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAK
FT                   CVKSKLHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMID
FT                   TTGSSLFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIAR
FT                   KMAPGLRRSFAFEEWNWISDRLIQEVRTEAAKKVERELELDIMGCDIDARMVEIAKANA
FT                   QAAGVAGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLK
FT                   TWSKFILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            338263..339657
FT                   /locus_tag="spr0334"
FT   CDS_pept        338263..339657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0334"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99138"
FT                   /db_xref="GOA:Q8DR55"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="InterPro:IPR040532"
FT                   /db_xref="InterPro:IPR041295"
FT                   /db_xref="PDB:2ND9"
FT                   /db_xref="PDB:2NDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR55"
FT                   /protein_id="AAK99138.1"
FT                   /translation="MSKKRRNRHKKEAQEPQFDFDEAKELTVGQAIRKNEEVEAGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTNSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            339733..341157
FT                   /gene="gnd"
FT                   /locus_tag="spr0335"
FT   CDS_pept        339733..341157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="spr0335"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:spr0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99139"
FT                   /db_xref="GOA:Q8DR54"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR54"
FT                   /protein_id="AAK99139.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVADVLEEISAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            341169..341858
FT                   /gene="csrR"
FT                   /locus_tag="spr0336"
FT   CDS_pept        341169..341858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrR"
FT                   /locus_tag="spr0336"
FT                   /product="Response regulator"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99140"
FT                   /db_xref="GOA:Q8DR53"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="PDB:5VFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR53"
FT                   /protein_id="AAK99140.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            341956..342972
FT                   /gene="cbpF"
FT                   /locus_tag="spr0337"
FT   CDS_pept        341956..342972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpF"
FT                   /locus_tag="spr0337"
FT                   /product="Choline-binding protein F"
FT                   /db_xref="EnsemblGenomes-Gn:spr0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99141"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="PDB:2V04"
FT                   /db_xref="PDB:2V05"
FT                   /db_xref="PDB:2VYU"
FT                   /db_xref="PDB:2X8M"
FT                   /db_xref="PDB:2X8O"
FT                   /db_xref="PDB:2X8P"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR52"
FT                   /protein_id="AAK99141.1"
FT                   /translation="MKLLKKMMQVLLAVFFFGLLATNTVFANTTGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDIGEMVVGWQYLEIPGTGYRDNLFDNQPVNEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYAVKTGWIYEDGN
FT                   WYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDASGKMLTDWQ
FT                   KVNGKWYYFGSSGSMATGWKYVRGKWYYLDNKNGDMKTGWQYLGNKWYYLRSSGAMVTG
FT                   WYQDGLTWYYLNAGNGDMKTGWFQVNGKWYYAYSSGALAVNTTVDGYSVNYNGEWVQ"
FT   gene            343094..343972
FT                   /gene="mvk"
FT                   /locus_tag="spr0338"
FT   CDS_pept        343094..343972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="spr0338"
FT                   /product="Mevalonate kinase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99142"
FT                   /db_xref="GOA:Q8DR51"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR51"
FT                   /protein_id="AAK99142.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLNITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEIAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSLEADSLVETALSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            343873..344907
FT                   /gene="mvd1"
FT                   /locus_tag="spr0339"
FT   CDS_pept        343873..344907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvd1"
FT                   /locus_tag="spr0339"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99143"
FT                   /db_xref="GOA:Q8DR50"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR50"
FT                   /protein_id="AAK99143.1"
FT                   /translation="MYHSLGNQFDTRTRTSRKIRRERSCSDMDREPVTVRSYANIAIIK
FT                   YWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVEHAKMSK
FT                   IIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAK
FT                   FASGSSSRSFYGPLGAWDKDSGEIYPVETDLKLAMIMLVLEDKKKPISSRDGMKLCVET
FT                   STTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATTKTASPAFSYLTDAS
FT                   YEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQ
FT                   DDCC"
FT   gene            344894..345901
FT                   /gene="mvaK2"
FT                   /locus_tag="spr0340"
FT   CDS_pept        344894..345901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="spr0340"
FT                   /product="Phosphomevalonate kinase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99144"
FT                   /db_xref="GOA:Q8DR49"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PDB:1K47"
FT                   /db_xref="PDB:3GON"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR49"
FT                   /protein_id="AAK99144.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS"
FT   gene            345885..346895
FT                   /gene="fni"
FT                   /locus_tag="spr0341"
FT   CDS_pept        345885..346895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="spr0341"
FT                   /product="Isopentenyl diphosphate isomerase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99145"
FT                   /db_xref="GOA:Q8DR48"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR48"
FT                   /protein_id="AAK99145.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAETCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEANDQMKKA"
FT   gene            346973..347671
FT                   /locus_tag="spr0342"
FT   CDS_pept        346973..347671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0342"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99146"
FT                   /db_xref="GOA:Q8DR47"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR47"
FT                   /protein_id="AAK99146.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKIV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            347668..348663
FT                   /gene="hk03"
FT                   /locus_tag="spr0343"
FT   CDS_pept        347668..348663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hk03"
FT                   /locus_tag="spr0343"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99147"
FT                   /db_xref="GOA:Q8DR46"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR46"
FT                   /protein_id="AAK99147.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSITCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVVDPDLDASFKSLS
FT                   GKLNLLTEALQKAENQSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQTQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFQLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            348677..349309
FT                   /gene="rr03"
FT                   /locus_tag="spr0344"
FT   CDS_pept        348677..349309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rr03"
FT                   /locus_tag="spr0344"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99148"
FT                   /db_xref="GOA:Q8DR45"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR45"
FT                   /protein_id="AAK99148.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            349310..349456
FT                   /locus_tag="spr0345"
FT                   /note="alkD-truncation"
FT   CDS_pept        349310..349456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0345"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99149"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR44"
FT                   /protein_id="AAK99149.1"
FT                   /translation="MSLADLLEELEAAKDSKKARPMEAYMRHQFSFLGIAVPERNKLYK
FT                   NIY"
FT   gene            349534..349788
FT                   /locus_tag="spr0346"
FT                   /note="alkD-truncation"
FT   CDS_pept        349534..349788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0346"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99150"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR43"
FT                   /protein_id="AAK99150.1"
FT                   /translation="MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVVGSLV
FT                   YEHPELEEIILILFENLFKPRQLYLQPQNSVLSNLRLAS"
FT   repeat_region   349700..349816
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            349807..350079
FT                   /locus_tag="spr0347"
FT                   /note="alkD-truncation"
FT   CDS_pept        349807..350079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0347"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99151"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR42"
FT                   /protein_id="AAK99151.1"
FT                   /translation="MSIKWSLSDNIWLRRVAIDHQLLRKEKTNTQLMEKILLHNLNQTE
FT                   FFINKAIGWILRDYSKTNPTWVTCFIDENKERMAELSIKEASKYL"
FT   gene            350229..350423
FT                   /locus_tag="spr0348"
FT   CDS_pept        350229..350423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0348"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99152"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRB9"
FT                   /protein_id="AAK99152.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   EKGPESNDSSLSEISPTYG"
FT   gene            350465..351121
FT                   /locus_tag="spr0349"
FT                   /note="cbpG-truncation"
FT   CDS_pept        350465..351121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0349"
FT                   /product="Choline binding protein G, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99153"
FT                   /db_xref="GOA:Q8DR41"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008353"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR41"
FT                   /protein_id="AAK99153.1"
FT                   /translation="MIKIDNTLQYPYSTSAMVLSKYYGVADGMNVEGRGSANFIKDNVL
FT                   ITAAHNYYRHDYGKEADDIYVLPAVSPSQELFGKIKVKEVRYLKEFRNLNSKDAREYDL
FT                   ALLILEKPIGAKLGTLGLPTSQKNLTGITVTITGYPSYNFKIHQMYTDKKQVLSDDGMF
FT                   LDYQVDTLEGSSGSTVYDASHRVVGVHTLGDGANQINSAVKLNERNLPFIYLFGS"
FT   gene            351246..351374
FT                   /gene="cbpG"
FT                   /locus_tag="spr0350"
FT   CDS_pept        351246..351374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpG"
FT                   /locus_tag="spr0350"
FT                   /product="Choline binding protein G"
FT                   /db_xref="EnsemblGenomes-Gn:spr0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99154"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR40"
FT                   /protein_id="AAK99154.1"
FT                   /translation="MLTDWQKVNGNWYYLNSNGAMVTGSQTIDGKVYNFASSGEWI"
FT   gene            351393..352277
FT                   /gene="pcpC"
FT                   /locus_tag="spr0351"
FT   CDS_pept        351393..352277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcpC"
FT                   /locus_tag="spr0351"
FT                   /product="Choline-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99155"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR39"
FT                   /protein_id="AAK99155.1"
FT                   /translation="MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYK
FT                   KGALKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEIALRPDWFYF
FT                   GQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSQAEKRVYYFEDQRSYHTLKTGWIYEE
FT                   GYWYYLQKDGGFDSRINRLTVGELARGWVKDYPLTYDEEKLKAAPWYYLDPATGWQNLG
FT                   NKWYYLRSSGAMATGWYQEGSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTV
FT                   GGYYLNYNGEWVK"
FT   gene            complement(352405..352590)
FT                   /locus_tag="spr0352"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(352405..352590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0352"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99156"
FT                   /db_xref="GOA:Q8DR38"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR38"
FT                   /protein_id="AAK99156.1"
FT                   /translation="MVESFFGILKSEMFYGYEKTFKSLNQLEQAIIDYIDYYNNKRIKV
FT                   KLKGLSPVQYRTKSFG"
FT   gene            complement(352538..352891)
FT                   /locus_tag="spr0353"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(352538..352891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0353"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99157"
FT                   /db_xref="GOA:Q8DR37"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR37"
FT                   /protein_id="AAK99157.1"
FT                   /translation="MIKVLNLQAKMRQKRKYSSHKGDVGKKAENLIQGQFEGSKTMEKC
FT                   YTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSTSPNLEQVQTMLEQAFTEKHYGGV
FT                   LLWDSEIGNVLWL"
FT   gene            complement(353009..353113)
FT                   /locus_tag="spr0354"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(353009..353113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0354"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99158"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR36"
FT                   /protein_id="AAK99158.1"
FT                   /translation="MTEFSLDLLLEAIKLARWTYYYHLKQLDKPDKDQ"
FT   gene            complement(353339..353614)
FT                   /locus_tag="spr0355"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(353339..353614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0355"
FT                   /product="Degenerate transposase (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR35"
FT                   /protein_id="AAK99159.1"
FT                   /translation="MYMNYTPKVRQKKSNFWGVFIMKLSYDDKVQIYELRKQGYSLEKL
FT                   SNKFGINNSNIRYMIKLIDRYGIEFVKKGKNRYYSPDLKQEMIHKV"
FT   gene            353760..355529
FT                   /gene="mtlA"
FT                   /locus_tag="spr0356"
FT   CDS_pept        353760..355529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="spr0356"
FT                   /product="Mannitol PTS EII"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99160"
FT                   /db_xref="GOA:Q8DR34"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR34"
FT                   /protein_id="AAK99160.1"
FT                   /translation="MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYL
FT                   PNEQLATVVGPMLTYLLPILIGYTGGYMIHGQRGAVVGSIATVGAITGSSVPMFIGAMV
FT                   MGPLGGWTIKKFDEKFQEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAV
FT                   GNGVEAIVNARLLPMANIIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEAN
FT                   PGPGLGILLAYAVFGKGSAKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGIS
FT                   GTFTFQLLDAGLKSPASPGSIIAIMATAPKGVWPHLNILLGVLVAAVVSFLIAALILHA
FT                   DKSTEDSLEAAQAATQAAKAQSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGAS
FT                   ILRDKVKKAGLELPVSNQAISNLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLAS
FT                   PRYDEIVASLTGASPIAEIEGDIPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCET
FT                   IRAIFRNKNIRIPVSTAKISELGEFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVT
FT                   TPEYDKMAARMYK"
FT   gene            355553..357508
FT                   /locus_tag="spr0357"
FT   CDS_pept        355553..357508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0357"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99161"
FT                   /db_xref="GOA:Q8DR33"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR33"
FT                   /protein_id="AAK99161.1"
FT                   /translation="MLLTKREEQLLKAFLHVGKLSMQDMTEILQVSSRTIYRTLSDLTD
FT                   SMEQYGIEITKHGKYYILTGELDDLPTELEVLVEYSPQERQELITYRLLTESGFVTNEA
FT                   LQECTKVSNVTIIQDISDIDKRLLDFDLKIERQKGYRISGDSVGKRRFLAILLTNCISV
FT                   ADFSTGNFGSFDILEADRTRLASQIVNKQLSGFPDMDARMKMFFAILLSLIGQEQNIEN
FT                   SPNTSKQALEISQKIFQTYSKQTAQFYSIQEIIYFASILDELIIKRQDNPLFTEKFDGE
FT                   FFYNISNLIDTVSMYTKIDFFKDKVLFNFLFHHIRLSLGVPILFQGENLPESVQILVER
FT                   NKFLYTVISLLVNDIFPKYLHTEYEYGMIALHFISSLGRSPEIYPVRVLLLTDERRVTR
FT                   DLLVSKIKSVAPFVELIDIQSLVDYHSIDLSQYDYILSTKPLSNQEIDVISSFPTVKEL
FT                   LELQERLQYVQAHRTIVARDAIAPEKSYDLQDYLISSSQLLSQFELVQLENNQSFEHTV
FT                   EQIIQYQKNVSDRDYLTRKLLSHFQNSPMAIPNTGLVLLHSQSSKVTTNSFTMFELKLP
FT                   ISALSMKREEEEVKRCLLMLMSKEASEEARDLMTAISQSIIENHLYTEIYKTGNQSIIY
FT                   QMLNTIFNEKIKKLEN"
FT   gene            357510..357947
FT                   /gene="mtlF"
FT                   /locus_tag="spr0358"
FT   CDS_pept        357510..357947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="spr0358"
FT                   /product="Mannitol-specific enzyme IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:spr0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99162"
FT                   /db_xref="GOA:Q8DR32"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR32"
FT                   /protein_id="AAK99162.1"
FT                   /translation="MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIER
FT                   DKELSVYMGNFIAIPHGTDAAKNDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIAGI
FT                   GNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE"
FT   gene            358009..359145
FT                   /gene="mtlD"
FT                   /locus_tag="spr0359"
FT   CDS_pept        358009..359145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="spr0359"
FT                   /product="Mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:spr0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99163"
FT                   /db_xref="GOA:Q8DR31"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR31"
FT                   /protein_id="AAK99163.1"
FT                   /translation="MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKG
FT                   KYEIEIAQKGQSRIEVTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELLAK
FT                   GIEARRVAGNTQVLDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRI
FT                   VPAQSHEDSLFVVVEPFNEWVVETKRLKNPDLRLKDVHYEEDLEPFIERKLFSVNSGHA
FT                   TSAYIGAHYGAKTILEALQNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIER
FT                   FENPFIVDEVSRVARTPIRKLGYNERFIRPIRELKELSLSYKNLLKTVGYAFDYRDVND
FT                   EESIRLGELLAKQLVKDVVIQVTGLDDQELIEQIVEYI"
FT   repeat_region   359204..359289
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_BB"
FT   gene            359316..359474
FT                   /locus_tag="spr0360"
FT   CDS_pept        359316..359474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0360"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ66"
FT                   /protein_id="AAK99164.1"
FT                   /translation="MSLIFVVIYKVKEAGQKVFKIGKRQPIGCSKILIGCPLLWKALLD
FT                   FLLRLSF"
FT   gene            359527..359640
FT                   /locus_tag="spr0361"
FT   CDS_pept        359527..359640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0361"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR30"
FT                   /protein_id="AAK99165.1"
FT                   /translation="MDSGKIVEKNNAHQFFSGPREERTKQFWNEFFRMRSI"
FT   repeat_region   complement(359636..359742)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            359944..361227
FT                   /gene="ropA"
FT                   /locus_tag="spr0362"
FT   CDS_pept        359944..361227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropA"
FT                   /locus_tag="spr0362"
FT                   /product="Trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99166"
FT                   /db_xref="GOA:Q8DR29"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR29"
FT                   /protein_id="AAK99166.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDQKFGEEALYQDAMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VITAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAENG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELAAAKE
FT                   ETYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(361275..363641)
FT                   /gene="recD"
FT                   /locus_tag="spr0363"
FT   CDS_pept        complement(361275..363641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="spr0363"
FT                   /product="Exonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:spr0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99167"
FT                   /db_xref="GOA:Q8DR28"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR28"
FT                   /protein_id="AAK99167.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLIRILEKGEQKRQDLETIQKHITTVEQELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDAEFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILP
FT                   ADFTQKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDSNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDRIPAMIGITDTDLKEIFGK"
FT   repeat_region   363689..363802
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            complement(363875..364489)
FT                   /gene="spi"
FT                   /locus_tag="spr0364"
FT   CDS_pept        complement(363875..364489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spi"
FT                   /locus_tag="spr0364"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:spr0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99168"
FT                   /db_xref="GOA:P59662"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59662"
FT                   /protein_id="AAK99168.1"
FT                   /translation="MNLFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLAD
FT                   GEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPY
FT                   LADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEY
FT                   LLLGDDRLVSSDSRHVGTFKAKDITGEAKFRFWPITRIGTF"
FT   gene            complement(364501..365373)
FT                   /gene="rnhB"
FT                   /locus_tag="spr0365"
FT   CDS_pept        complement(364501..365373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="spr0365"
FT                   /product="Ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:spr0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99169"
FT                   /db_xref="GOA:P59660"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59660"
FT                   /protein_id="AAK99169.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQETNRFSNPISLEEKAEGKYLA
FT                   VAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLNFCAKLHF
FT                   KNTEKAKNA"
FT   gene            365451..365762
FT                   /locus_tag="spr0366"
FT   CDS_pept        365451..365762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0366"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99170"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ65"
FT                   /protein_id="AAK99170.1"
FT                   /translation="MNFMANLNRFKFTFGKKSLTLTSEHDNLFMEEIAKVATEKYQAIK
FT                   EQMPSADDETIALLLAVNCLSTQLSREIEFDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            365759..366307
FT                   /locus_tag="spr0367"
FT   CDS_pept        365759..366307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0367"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99171"
FT                   /db_xref="GOA:Q8DR27"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR27"
FT                   /protein_id="AAK99171.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEDQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPITTSWLKQIWVTNLIG"
FT   gene            366411..368747
FT                   /gene="mutS2"
FT                   /locus_tag="spr0368"
FT   CDS_pept        366411..368747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="spr0368"
FT                   /product="DNA mismatch repair protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99172"
FT                   /db_xref="GOA:Q8DR26"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR26"
FT                   /protein_id="AAK99172.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASRELQS
FT                   FYANLENVSLEELAFWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVYFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKAVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            369089..370411
FT                   /gene="dagA"
FT                   /locus_tag="spr0369"
FT   CDS_pept        369089..370411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dagA"
FT                   /locus_tag="spr0369"
FT                   /product="D-alanine glycine permease"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99173"
FT                   /db_xref="GOA:Q8DR25"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR25"
FT                   /protein_id="AAK99173.1"
FT                   /translation="MLELLKSIDAFTWGPPLLILLVGTGVYLTMRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSITESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   VFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVMSPVVIAETKKYFDK"
FT   gene            370629..371177
FT                   /gene="mip"
FT                   /locus_tag="spr0370"
FT   CDS_pept        370629..371177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="spr0370"
FT                   /product="Macrophage infectivity potentiator protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99174"
FT                   /db_xref="GOA:Q8DR24"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR24"
FT                   /protein_id="AAK99174.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            371275..372186
FT                   /gene="shetA"
FT                   /locus_tag="spr0371"
FT   CDS_pept        371275..372186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shetA"
FT                   /locus_tag="spr0371"
FT                   /product="Exfoliative toxin A"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99175"
FT                   /db_xref="GOA:Q8DR23"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR23"
FT                   /protein_id="AAK99175.1"
FT                   /translation="MEVRMKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLW
FT                   IYFLILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFS
FT                   FLLDLTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGF
FT                   LLTFYLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMIL
FT                   ASQSFFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLTET
FT                   IICLTILFFVLGAYLIWLRKKV"
FT   gene            complement(372211..373548)
FT                   /gene="serS"
FT                   /locus_tag="spr0372"
FT   CDS_pept        complement(372211..373548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="spr0372"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:spr0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99176"
FT                   /db_xref="GOA:Q8DR22"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR22"
FT                   /protein_id="AAK99176.1"
FT                   /translation="MEPWPCHSNVLSGCFFHKGVLMLDIKRIRTDFEAVAEKLATRGVD
FT                   AAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEV
FT                   KALDAELAEIDAKLTEFTTTLPNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWD
FT                   LGEDLGILDWERGGKVTGARFLFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNH
FT                   DSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSF
FT                   RSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVV
FT                   ALSTGDMGFSATKTYDLEVWIPAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLL
FT                   HTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMGGAEVIKP"
FT   gene            complement(373698..374069)
FT                   /locus_tag="spr0373"
FT   CDS_pept        complement(373698..374069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0373"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99177"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR21"
FT                   /protein_id="AAK99177.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGRKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(374072..375436)
FT                   /gene="lysC"
FT                   /locus_tag="spr0374"
FT   CDS_pept        complement(374072..375436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="spr0374"
FT                   /product="Aspartate kinase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99178"
FT                   /db_xref="GOA:Q8DR20"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR20"
FT                   /protein_id="AAK99178.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   repeat_region   complement(375619..375730)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            375761..376546
FT                   /gene="phaB"
FT                   /locus_tag="spr0375"
FT   CDS_pept        375761..376546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="spr0375"
FT                   /product="Enoyl-CoA hydratase II"
FT                   /EC_number="4.2.1.17"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99179"
FT                   /db_xref="GOA:Q8DR19"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR19"
FT                   /protein_id="AAK99179.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFIGK"
FT   gene            376640..377074
FT                   /locus_tag="spr0376"
FT   CDS_pept        376640..377074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0376"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99180"
FT                   /db_xref="GOA:Q8DR18"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR18"
FT                   /protein_id="AAK99180.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            377074..378048
FT                   /gene="fabH"
FT                   /locus_tag="spr0377"
FT   CDS_pept        377074..378048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="spr0377"
FT                   /product="3-oxoacyl-acyl-carrier-protein synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:spr0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99181"
FT                   /db_xref="GOA:P0A3C6"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3C6"
FT                   /protein_id="AAK99181.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGEELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            378108..378332
FT                   /gene="acp"
FT                   /locus_tag="spr0378"
FT   CDS_pept        378108..378332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="spr0378"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99182"
FT                   /db_xref="GOA:P0A2W1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2W1"
FT                   /protein_id="AAK99182.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            378451..379425
FT                   /gene="fabK"
FT                   /locus_tag="spr0379"
FT   CDS_pept        378451..379425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="spr0379"
FT                   /product="Enoyl-acyl carrier protein(ACP) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99183"
FT                   /db_xref="GOA:Q8DR17"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR17"
FT                   /protein_id="AAK99183.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAVSI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVEGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGVVRND"
FT   gene            379418..380338
FT                   /gene="fabD"
FT                   /locus_tag="spr0380"
FT   CDS_pept        379418..380338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="spr0380"
FT                   /product="Malonyl acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:spr0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99184"
FT                   /db_xref="GOA:Q8DR16"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="PDB:3IM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR16"
FT                   /protein_id="AAK99184.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            380372..381103
FT                   /gene="fabG"
FT                   /locus_tag="spr0381"
FT   CDS_pept        380372..381103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="spr0381"
FT                   /product="3-ketoacyl-acyl carrier protein reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:spr0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99185"
FT                   /db_xref="GOA:Q8DR15"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR15"
FT                   /protein_id="AAK99185.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVIAIDGGLSM"
FT   gene            381116..382360
FT                   /gene="fabF"
FT                   /locus_tag="spr0382"
FT   CDS_pept        381116..382360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="spr0382"
FT                   /product="Beta ketoacyl-acyl carrier protein synthase"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:spr0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99186"
FT                   /db_xref="GOA:Q8DR14"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR14"
FT                   /protein_id="AAK99186.1"
FT                   /translation="MKRMKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFD
FT                   HSDFDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRF
FT                   GVIVASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSI
FT                   NTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRAS
FT                   IPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQG
FT                   AIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGH
FT                   LLGAAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGF
FT                   GGHNAVLAFKRWENR"
FT   gene            382363..382848
FT                   /gene="accB"
FT                   /locus_tag="spr0383"
FT   CDS_pept        382363..382848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="spr0383"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99187"
FT                   /db_xref="GOA:Q7CRB8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRB8"
FT                   /protein_id="AAK99187.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            382845..383267
FT                   /gene="fabZ"
FT                   /locus_tag="spr0384"
FT   CDS_pept        382845..383267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="spr0384"
FT                   /product="Hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99188"
FT                   /db_xref="GOA:P59202"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59202"
FT                   /protein_id="AAK99188.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
FT   gene            383279..384646
FT                   /gene="accC"
FT                   /locus_tag="spr0385"
FT   CDS_pept        383279..384646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="spr0385"
FT                   /product="Biotin carboxylase (a subunit of acetyl-CoA
FT                   carboxylase (ACC)"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:spr0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99189"
FT                   /db_xref="GOA:Q8CZE9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZE9"
FT                   /protein_id="AAK99189.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SRNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            384683..385549
FT                   /gene="accD"
FT                   /locus_tag="spr0386"
FT   CDS_pept        384683..385549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="spr0386"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99190"
FT                   /db_xref="GOA:Q7CRB7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CRB7"
FT                   /protein_id="AAK99190.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            385546..386313
FT                   /gene="accA"
FT                   /locus_tag="spr0387"
FT   CDS_pept        385546..386313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="spr0387"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99191"
FT                   /db_xref="GOA:Q8DR13"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR13"
FT                   /protein_id="AAK99191.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEVGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            386472..386657
FT                   /locus_tag="spr0388"
FT   CDS_pept        386472..386657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0388"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99192"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ64"
FT                   /protein_id="AAK99192.1"
FT                   /translation="MTGTETFTVISTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRTG"
FT   gene            386914..387126
FT                   /locus_tag="spr0389"
FT   CDS_pept        386914..387126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0389"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99193"
FT                   /db_xref="GOA:Q8CZ63"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ63"
FT                   /protein_id="AAK99193.1"
FT                   /translation="MVYQILGNFWARYAHLINHRNIHDEYFTVVLSNGQPTFLSTILSF
FT                   VLPVIIGPVFEETLDRGYFMNTFFP"
FT   gene            complement(387424..387864)
FT                   /gene="nusB"
FT                   /locus_tag="spr0390"
FT   CDS_pept        complement(387424..387864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="spr0390"
FT                   /product="Transcription termination protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99194"
FT                   /db_xref="GOA:P65583"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65583"
FT                   /protein_id="AAK99194.1"
FT                   /translation="MTRTSSMTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTH
FT                   DREDTDVQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEI
FT                   TSFDTPQLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(387839..388228)
FT                   /locus_tag="spr0391"
FT   CDS_pept        complement(387839..388228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0391"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99195"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR12"
FT                   /protein_id="AAK99195.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(388250..388810)
FT                   /gene="efp"
FT                   /locus_tag="spr0392"
FT   CDS_pept        complement(388250..388810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="spr0392"
FT                   /product="Elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:spr0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99196"
FT                   /db_xref="GOA:P64043"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64043"
FT                   /protein_id="AAK99196.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            complement(388939..390381)
FT                   /gene="gatB"
FT                   /locus_tag="spr0393"
FT   CDS_pept        complement(388939..390381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="spr0393"
FT                   /product="Glutamyl tRNA-Gln amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:spr0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99197"
FT                   /db_xref="GOA:Q8DR11"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR11"
FT                   /protein_id="AAK99197.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(390381..391847)
FT                   /gene="gatA"
FT                   /locus_tag="spr0394"
FT   CDS_pept        complement(390381..391847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="spr0394"
FT                   /product="Glu-tRNAGln amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:spr0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99198"
FT                   /db_xref="GOA:Q8DR10"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR10"
FT                   /protein_id="AAK99198.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGIDPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKH
FT                   SEETIYQVAAAFEATTGYHKQQPVIFGGDN"
FT   gene            complement(391847..392149)
FT                   /gene="gatC"
FT                   /locus_tag="spr0395"
FT   CDS_pept        complement(391847..392149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="spr0395"
FT                   /product="Glutamyl tRNA-Gln amidotransferase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:spr0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99199"
FT                   /db_xref="GOA:P59661"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59661"
FT                   /protein_id="AAK99199.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA"
FT   gene            392362..393906
FT                   /gene="prfC"
FT                   /locus_tag="spr0396"
FT   CDS_pept        392362..393906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="spr0396"
FT                   /product="Peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99200"
FT                   /db_xref="GOA:Q8DR09"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR09"
FT                   /protein_id="AAK99200.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVINAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMSPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            394175..394660
FT                   /locus_tag="spr0397"
FT   CDS_pept        394175..394660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0397"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99201"
FT                   /db_xref="GOA:Q8DR08"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR08"
FT                   /protein_id="AAK99201.1"
FT                   /translation="MKEEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPR
FT                   EWFQLMEKRLETLNSEIVNVQIDSSILKGYRLPFEGLSYAAFFRYFIPKYVSESRVLYL
FT                   DSDIVVRKSIDELWDLDLTAIPLAAVRDDFYTHNFNSGVLLINNGMWRAENVTQDLI"
FT   gene            394776..394964
FT                   /gene="rpmB"
FT                   /locus_tag="spr0398"
FT   CDS_pept        394776..394964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="spr0398"
FT                   /product="50S Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:spr0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99202"
FT                   /db_xref="GOA:P66156"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66156"
FT                   /protein_id="AAK99202.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            395121..395486
FT                   /gene="asp23"
FT                   /locus_tag="spr0399"
FT   CDS_pept        395121..395486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp23"
FT                   /locus_tag="spr0399"
FT                   /product="Alkaline shock protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99203"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR07"
FT                   /protein_id="AAK99203.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKDVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            395489..397156
FT                   /locus_tag="spr0400"
FT   CDS_pept        395489..397156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0400"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99204"
FT                   /db_xref="GOA:Q8DR06"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR06"
FT                   /protein_id="AAK99204.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDTVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALRDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            397357..399057
FT                   /gene="ilvB"
FT                   /locus_tag="spr0401"
FT   CDS_pept        397357..399057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="spr0401"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99205"
FT                   /db_xref="GOA:Q8DR05"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR05"
FT                   /protein_id="AAK99205.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSSEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSDGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            399026..399526
FT                   /gene="ilvN"
FT                   /locus_tag="spr0402"
FT   CDS_pept        399026..399526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="spr0402"
FT                   /product="Acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99206"
FT                   /db_xref="GOA:Q8DR04"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR04"
FT                   /protein_id="AAK99206.1"
FT                   /translation="MRCWGCSSMRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGA
FT                   TEDPNVSRITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPA
FT                   EKRAEILAIIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGF
FT                   TRD"
FT   gene            399592..400614
FT                   /gene="ilvC"
FT                   /locus_tag="spr0403"
FT   CDS_pept        399592..400614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="spr0403"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:spr0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99207"
FT                   /db_xref="GOA:Q8DR03"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DR03"
FT                   /protein_id="AAK99207.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            400691..400957
FT                   /locus_tag="spr0404"
FT   CDS_pept        400691..400957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0404"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99208"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ62"
FT                   /protein_id="AAK99208.1"
FT                   /translation="MYNVITPSVIVLADQNKADWSYDENTVINIYDDANFEDGRLHMTF
FT                   EQFFKLAQIAREEGLEIHSPFERAGATKSARYIAKWILRNKKH"
FT   gene            401195..401551
FT                   /locus_tag="spr0405"
FT   CDS_pept        401195..401551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0405"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99209"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ61"
FT                   /protein_id="AAK99209.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEVFGDE"
FT   gene            401601..402851
FT                   /gene="ilvA"
FT                   /locus_tag="spr0406"
FT   CDS_pept        401601..402851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="spr0406"
FT                   /product="Threonine desaminase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99210"
FT                   /db_xref="GOA:Q8DR02"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR02"
FT                   /protein_id="AAK99210.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIKTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   repeat_region   402922..403038
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            403586..403801
FT                   /locus_tag="spr0407"
FT   CDS_pept        403586..403801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0407"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ60"
FT                   /protein_id="AAK99211.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(403910..404650)
FT                   /gene="glnQ"
FT                   /locus_tag="spr0408"
FT   CDS_pept        complement(403910..404650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="spr0408"
FT                   /product="ABC transporter ATP-binding protein-glutamine"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99212"
FT                   /db_xref="GOA:Q8DR01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR01"
FT                   /protein_id="AAK99212.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(404650..405585)
FT                   /gene="glnH"
FT                   /locus_tag="spr0409"
FT   CDS_pept        complement(404650..405585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="spr0409"
FT                   /product="ABC transporter substrate binding
FT                   protein-glutamine transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99213"
FT                   /db_xref="GOA:Q8DR00"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DR00"
FT                   /protein_id="AAK99213.1"
FT                   /translation="MIQVEPGFKTGEEDTAIAIGLRKNDNRISQINASIETISKDDQVA
FT                   LMDRMIKEQPAEATTTEETSSSFFSQVAKILSENWQQLLRGAGITLLISIVGTIIGLII
FT                   GLAIGVFRTAPLSENKVIYGLQKLVGWVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGIN
FT                   LDRTLAAIFIVSINTGAYMTEIVRGGILAVDKGQFEAATALGMTHNQTMRKIVLPQVVR
FT                   NILPATGNEFVINIKDTSVLNVISVVELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFT
FT                   VTRILRFIERRMDMDTYTTGANQMQTEDLK"
FT   gene            406350..408242
FT                   /locus_tag="spr0410"
FT   CDS_pept        406350..408242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0410"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99214"
FT                   /db_xref="GOA:Q8CZ59"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ59"
FT                   /protein_id="AAK99214.1"
FT                   /translation="MMKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEF
FT                   RQKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKIQAAKNGAELADVTSEVTEEADG
FT                   YTVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDK
FT                   GAEKLFFHTGKLFRERTVEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKG
FT                   NRLEEFNKIEDSIVKEKDQSKQLLTWIFPSILSISLLLSICFYFIYRRKTAPSIKYAKN
FT                   HRLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSII
FT                   SEGDAVGLRLVKEDGLSSFEKDCLNLAFSGKKEETLSNLFADYKVSDSLYRRAKVSDEK
FT                   RIQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGLEKALQVGMGVLTILPL
FT                   FIGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLW
FT                   TSFENMLREIARLDKAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLY
FT                   VAYGWHSMFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(408239..408400)
FT                   /locus_tag="spr0411"
FT                   /note="transposase F"
FT   CDS_pept        complement(408239..408400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0411"
FT                   /product="Degenerate transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ9"
FT                   /protein_id="AAK99215.1"
FT                   /translation="MDFFKGFLPCSKIIAKSSIEIRNSLDKTIDFSYSLSFFYLPLYHT
FT                   FSVYGSSL"
FT   gene            complement(408542..409090)
FT                   /locus_tag="spr0412"
FT                   /note="transposase F"
FT   CDS_pept        complement(408542..409090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0412"
FT                   /product="Degenerate transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99216"
FT                   /db_xref="GOA:Q8DQZ8"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ8"
FT                   /protein_id="AAK99216.1"
FT                   /translation="MDKIVGKHSEYTYQLLTRYPNPQKRLEARFDKLIEIKRLTASKIQ
FT                   DILSVAPRSIGTTSPAREFEIIEIIKHYKRLIDKAETCVNDLMAEFNSAITTVTGIGGR
FT                   LGAVILAEIRNIHAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMIKRGSPHLRWALIQAA
FT                   KACARFSPAFKAYLKTKLE"
FT   gene            409666..410511
FT                   /gene="bacA"
FT                   /locus_tag="spr0413"
FT   CDS_pept        409666..410511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="spr0413"
FT                   /product="A lipid kinase; may confer bacitracin resistance
FT                   by phosphorylation of undecaprenol"
FT                   /db_xref="EnsemblGenomes-Gn:spr0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99217"
FT                   /db_xref="GOA:P60935"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60935"
FT                   /protein_id="AAK99217.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   repeat_region   410546..410654
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            complement(410657..411727)
FT                   /gene="dinP"
FT                   /locus_tag="spr0414"
FT   CDS_pept        complement(410657..411727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="spr0414"
FT                   /product="DNA-damage-inducible protein P"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99218"
FT                   /db_xref="GOA:Q8DQZ7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQZ7"
FT                   /protein_id="AAK99218.1"
FT                   /translation="MLGMLIFPLLNDLSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIG
FT                   SDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRA
FT                   IFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKF
FT                   LAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEV
FT                   PEVTLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIKKELTL
FT                   LSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQISQIALQLYEELS
FT                   EKERGVRLLGITMTGF"
FT   repeat_region   411734..411890
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            412113..414437
FT                   /gene="pfl"
FT                   /locus_tag="spr0415"
FT   CDS_pept        412113..414437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="spr0415"
FT                   /product="Pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:spr0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99219"
FT                   /db_xref="GOA:Q8DQZ6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ6"
FT                   /protein_id="AAK99219.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   repeat_region   414568..414674
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(414804..415151)
FT                   /locus_tag="spr0416"
FT   CDS_pept        complement(414804..415151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0416"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99220"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ58"
FT                   /protein_id="AAK99220.1"
FT                   /translation="MAQQSCCKANMNKQPPLSLCESLYSFENLTVLVVPIEYVLGMKMM
FT                   SIREQDLQDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVLLEGFSYAYGMDWLEKFF
FT                   KENQDKLREFY"
FT   gene            complement(415349..415633)
FT                   /locus_tag="spr0417"
FT   CDS_pept        complement(415349..415633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0417"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99221"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ5"
FT                   /protein_id="AAK99221.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            416025..416195
FT                   /locus_tag="spr0418"
FT   CDS_pept        416025..416195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0418"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99222"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ57"
FT                   /protein_id="AAK99222.1"
FT                   /translation="MLIINRFFSLFVLDWYRTELWINLLLSYPVPKYVGRKMKQLLRVS
FT                   VLEKNFVYTIL"
FT   gene            complement(416246..416416)
FT                   /locus_tag="spr0419"
FT   CDS_pept        complement(416246..416416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0419"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99223"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ56"
FT                   /protein_id="AAK99223.1"
FT                   /translation="MTKQVPKFTKDTAQLYTCKWLLYNKVTKMYDHTVVNHSVREYITD
FT                   SISTNTIEETG"
FT   gene            complement(417068..418291)
FT                   /gene="xylR"
FT                   /locus_tag="spr0420"
FT   CDS_pept        complement(417068..418291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="spr0420"
FT                   /product="Xylose repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99224"
FT                   /db_xref="GOA:Q8DQZ4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ4"
FT                   /protein_id="AAK99224.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSIITN
FT                   NPIWESFNLLNVIKDFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            418456..419781
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0421"
FT   CDS_pept        418456..419781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0421"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99225"
FT                   /db_xref="GOA:Q8DQZ3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ3"
FT                   /protein_id="AAK99225.1"
FT                   /translation="MMNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSL
FT                   FLILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSA
FT                   GIIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIY
FT                   RMFIQRGITIKMPSGVPDVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAGGLNGLLGA
FT                   IVGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAG
FT                   QTLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAI
FT                   LFTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATG
FT                   ASWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            419729..421669
FT                   /locus_tag="spr0422"
FT   CDS_pept        419729..421669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0422"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99226"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ55"
FT                   /protein_id="AAK99226.1"
FT                   /translation="MQINAILKKKKLLLEGNKMVIRVFDQQKNTYSSFALEELSYYMNR
FT                   VFKTNIELVEEKEADIFVGLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHE
FT                   FGVVYTRPGRRHDFVPELRFEDFLDKQLSIDETASYYHRGVCIEGADSFENILDFIDWL
FT                   PKIGMNSFFIQFENPYSFLKRWYEHEFNPYLNKEQFSNELVQELSDRLDKELQKRGLIH
FT                   HRVGHGWTGEVLGYSSKFGWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPD
FT                   VADKMVEIIKDYAKKRPDVNYLHIWLSDARNNICECENCRQELVSDQYIRILNQLDRAL
FT                   TSEGLDTKICFLLYHELLWAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTP
FT                   KPYMRNKIILPNSLEENLSYLFEWQKAFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRD
FT                   VSYLSNLHLNGYISCQELRAGFPHNFPNYVMGQMLWKKTRSYEELIEEYFSALYGENWQ
FT                   SVVEYLEKLSIYSSCDYFNAIGSRQNDVLANHYYIAYNLADNFLPIIEENISKLLNSQK
FT                   DEWKQLSYHREYVVKMAKALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVI
FT                   EVAKNYAGFHL"
FT   gene            421837..422181
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0423"
FT   CDS_pept        421837..422181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0423"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99227"
FT                   /db_xref="GOA:Q8DQZ2"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ2"
FT                   /protein_id="AAK99227.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEAYGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            422191..423603
FT                   /gene="lacG"
FT                   /locus_tag="spr0424"
FT   CDS_pept        422191..423603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG"
FT                   /locus_tag="spr0424"
FT                   /product="Phospho-beta-D-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:spr0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99228"
FT                   /db_xref="GOA:Q8DQZ1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR005928"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQZ1"
FT                   /protein_id="AAK99228.1"
FT                   /translation="MENLQVKALPKEFLLGTATAAYQVEGATRVDGKGINMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDIALAAEHGLQALRLSISWVRIFPDIDGDANVLAVHYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGKVGCIHAL
FT                   KPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAPLNTMFVMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   PGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            423672..425351
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0425"
FT   CDS_pept        423672..425351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0425"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99229"
FT                   /db_xref="GOA:Q8DQZ0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR041713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQZ0"
FT                   /protein_id="AAK99229.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIVWMRKVYMLTMGVLGIIVSGTVGKSLVGNVNRKMPHGKVIN
FT                   DISAMLAAICSYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK
FT                   RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIF
FT                   KGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSL
FT                   TPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVI
FT                   LNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWAFPGPLGLLIGTNFQPISFVL
FT                   LSLMLVVDILIYLPFCRAYDRQLLMKEDVASSNGIILEEDTSEIMPGEIDVIKSKELKV
FT                   LVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYR
FT                   EMKVDAERLGIQIVATRGMEYIHLTKNPSKSLQFVLEHYQAV"
FT   gene            complement(425479..426918)
FT                   /gene="trkH"
FT                   /locus_tag="spr0426"
FT   CDS_pept        complement(425479..426918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="spr0426"
FT                   /product="Trk transporter membrane-spanning protein-K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:spr0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99230"
FT                   /db_xref="GOA:Q8DQY9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY9"
FT                   /protein_id="AAK99230.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGNLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSLIDAFFE
FT                   ISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNQTVIDKDTQHKILKYFVI
FT                   YAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(426922..428271)
FT                   /gene="trkA"
FT                   /locus_tag="spr0427"
FT   CDS_pept        complement(426922..428271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="spr0427"
FT                   /product="Trk transporter NAD+ binding protein-K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:spr0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99231"
FT                   /db_xref="GOA:Q8DQY8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY8"
FT                   /protein_id="AAK99231.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVRDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            428433..429308
FT                   /locus_tag="spr0428"
FT   CDS_pept        428433..429308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0428"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99232"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY7"
FT                   /protein_id="AAK99232.1"
FT                   /translation="MIKDIQGDKMNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIH
FT                   HLTHDITPYNIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTP
FT                   DNGTLSFIKKHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEV
FT                   GPELSVDQIVELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFE
FT                   VTIYHADMLVYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSS
FT                   WTIEIKKIEG"
FT   gene            429323..429871
FT                   /locus_tag="spr0429"
FT   CDS_pept        429323..429871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0429"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99233"
FT                   /db_xref="GOA:Q8DQY6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQY6"
FT                   /protein_id="AAK99233.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   repeat_region   complement(429871..430021)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBBA"
FT   gene            430192..431874
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0430"
FT   CDS_pept        430192..431874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0430"
FT                   /product="ABC transporter ATP-binding protein-cobalt
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99234"
FT                   /db_xref="GOA:Q8DQY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQY5"
FT                   /protein_id="AAK99234.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGHTYGEFLIKGQAAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHCPVDRIVLIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLADLDNLSISKGQVQ
FT                   LRTELVKETPELQSLFRLEDVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   ALSSFIQTEGRYLWEGQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEQEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQQGHTIVMITHDMQLMLDYSDRALVMVDGELIADTDPASLLS
FT                   NPELLVKANLKETSIFNLAKKLDVDPLALTAFYKERREGCKLN"
FT   gene            431859..432689
FT                   /gene="ABC-MSD"
FT                   /locus_tag="spr0431"
FT   CDS_pept        431859..432689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSD"
FT                   /locus_tag="spr0431"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-unknown substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99235"
FT                   /db_xref="GOA:Q8DQY4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY4"
FT                   /protein_id="AAK99235.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRLLVL
FT                   IAIFSVFLLYLSEIHFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GAYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            432843..433385
FT                   /gene="cspR"
FT                   /locus_tag="spr0432"
FT   CDS_pept        432843..433385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="spr0432"
FT                   /product="rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99236"
FT                   /db_xref="GOA:Q8DQY3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY3"
FT                   /protein_id="AAK99236.1"
FT                   /translation="MWLFFCNGKRKQVMTNHIVLFEPQIPQNTGNIARTCAATNSPLHI
FT                   IKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFMSQMKGKLYLISKFAEKVYSDVDL
FT                   STNEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQ
FT                   NFAGLELVHTYEVDKLK"
FT   gene            433829..434407
FT                   /locus_tag="spr0433"
FT   CDS_pept        433829..434407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99237"
FT                   /db_xref="GOA:Q8DQY2"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY2"
FT                   /protein_id="AAK99237.1"
FT                   /translation="MEEPVMTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSI
FT                   LPVLVGLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWK
FT                   KERTTLRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLP
FT                   FNLIEGVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            434397..435047
FT                   /locus_tag="spr0434"
FT   CDS_pept        434397..435047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0434"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable phosphatidic acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99238"
FT                   /db_xref="GOA:Q8DQY1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQY1"
FT                   /protein_id="AAK99238.1"
FT                   /translation="MKDKQTFLMKGSFALLLFVILGYMVKFYPETLVNFDQSIQTAIRG
FT                   DLPDYLTILFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTF
FT                   KNIYQRPRPAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKNPVWRKIVQIVLG
FT                   LYLVSVLVSRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            435075..435464
FT                   /locus_tag="spr0435"
FT   CDS_pept        435075..435464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0435"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99239"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ54"
FT                   /protein_id="AAK99239.1"
FT                   /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETNQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            435469..435918
FT                   /locus_tag="spr0436"
FT   CDS_pept        435469..435918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0436"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99240"
FT                   /db_xref="GOA:Q8CZ53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ53"
FT                   /protein_id="AAK99240.1"
FT                   /translation="MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV"
FT   gene            436031..436633
FT                   /gene="rpoE"
FT                   /locus_tag="spr0437"
FT   CDS_pept        436031..436633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="spr0437"
FT                   /product="RNA polymerase (delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99241"
FT                   /db_xref="GOA:P66718"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66718"
FT                   /protein_id="AAK99241.1"
FT                   /translation="MRRNALELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVN
FT                   EIQNYLGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEEN
FT                   DDDEVAPKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVE
FT                   AYDAEINEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   repeat_region   complement(436760..436915)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            437023..438630
FT                   /gene="pyrG"
FT                   /locus_tag="spr0438"
FT   CDS_pept        437023..438630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="spr0438"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99242"
FT                   /db_xref="GOA:Q8DQY0"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQY0"
FT                   /protein_id="AAK99242.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   repeat_region   complement(438871..438969)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B1"
FT   repeat_region   complement(438989..439087)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(439189..440820)
FT                   /locus_tag="spr0439"
FT   CDS_pept        complement(439189..440820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0439"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99243"
FT                   /db_xref="GOA:Q8DQX9"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX9"
FT                   /protein_id="AAK99243.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNIIGTVFCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            441113..446092
FT                   /locus_tag="spr0440"
FT   CDS_pept        441113..446092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0440"
FT                   /product="Hypothetical protein"
FT                   /note="Similar to endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99244"
FT                   /db_xref="GOA:Q8CZ52"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="PDB:3GDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ52"
FT                   /protein_id="AAK99244.1"
FT                   /translation="MKNPFFERRCRYSIRKLSVGACSLMIGAVLFAGPALAEETAVPEN
FT                   SGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEAATTETA
FT                   EAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQ
FT                   PDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAINRGSVVLASRRTGHLVNEKASK
FT                   EAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLDSMVFWEGLVPTPDVIDAGHRNG
FT                   VPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIARKLVDMAKYYGYDGYFINQETTG
FT                   DLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMTYNYGRYHQDGLGEYNYQFMQPE
FT                   GDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDVFAGLELQQGGSYKTKVKWNDIL
FT                   DENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFTGYQGDPTGQKPGDKDWYGIANL
FT                   VADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWNYRSVSGVLPTWRWWQTSTGEKL
FT                   RAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKLEVTEKTKLRVAHKGGKGSKVYM
FT                   AFSTTPDYKFDDADAWKELTLSDNWTNEEFDLSSLAGKTIYAVKLFFEHEGAVKDYQFN
FT                   LGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQFKGNKDADFYEVYEKDGDSWKL
FT                   LTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGVRSEAATTTFDWGMTVKDTSLPK
FT                   PLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKSRT
FT                   VVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPI
FT                   TAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESVNIPMAKAAARSLGNNKVQVGFA
FT                   DVPAGATITVYDNPNSQTPLATLKSEVGGDLASAPLDLTNQSGLLYYRTQLPGKEISNV
FT                   LAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGGVLRVQYEGGTEDELIRLTHAGV
FT                   SVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDEASPKTILGIEVSQEPKKDYLVG
FT                   DSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQKTGRQTLTLRYQGHEVNFDVLV
FT                   SPKAALNDEYLKQKLAEVEAAKNKVVYNFASPEVKEAFLKAIEAAEQVLKDHETSTQDQ
FT                   VNDRLNKLTEAHKALNGQEKFTEEKTELDRLTGEAQELLAAKPNHPSGSALAPLLEKNK
FT                   ALVEKVDLSPEELATAKQSLKDLVALLKEDKSAVFSDSKTGVEVHFSNKEKTVIKGLKV
FT                   ERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSYASIVKIPIEKDKKVKKVFFLPE
FT                   GKGAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQPAKPAPQNKVLPKPTYQPASDQ
FT                   QKAPKLEVQEEKVAFHRQEHENTEMLVGEQRVIIQGRDGLLRHVFEVDEKGQRRLRSTE
FT                   VIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKSEEASKQLPNTGTADANEALIAG
FT                   LASLGLASLALTLRRKREDKD"
FT   gene            446182..447378
FT                   /gene="pgk"
FT                   /locus_tag="spr0441"
FT   CDS_pept        446182..447378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="spr0441"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99245"
FT                   /db_xref="GOA:Q8DQX8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQX8"
FT                   /protein_id="AAK99245.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEESDKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            447514..448041
FT                   /locus_tag="spr0442"
FT   CDS_pept        447514..448041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0442"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99246"
FT                   /db_xref="GOA:Q8CZ51"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ51"
FT                   /protein_id="AAK99246.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETILYVFVRVLETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            448118..448474
FT                   /gene="glnR"
FT                   /locus_tag="spr0443"
FT   CDS_pept        448118..448474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="spr0443"
FT                   /product="Transcriptional repressor of the glutamine
FT                   synthetase gene"
FT                   /db_xref="EnsemblGenomes-Gn:spr0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99247"
FT                   /db_xref="GOA:Q8DQX7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX7"
FT                   /protein_id="AAK99247.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            448511..449857
FT                   /gene="glnA"
FT                   /locus_tag="spr0444"
FT   CDS_pept        448511..449857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="spr0444"
FT                   /product="Glutamine synthetase type 1"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99248"
FT                   /db_xref="GOA:Q8DQX6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX6"
FT                   /protein_id="AAK99248.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   repeat_region   450208..450279
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B"
FT   gene            450637..451917
FT                   /gene="hsdS"
FT                   /locus_tag="spr0445"
FT   CDS_pept        450637..451917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="spr0445"
FT                   /product="type I restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:spr0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99249"
FT                   /db_xref="GOA:Q8DQX5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX5"
FT                   /protein_id="AAK99249.1"
FT                   /translation="MRIKSIYWNFGQNKPEKSFRYIDTSSIDRKKNIINYKNLQYLSPE
FT                   QAPSRARKLVSQNSVLFSTVRPYLKNIAVVRELKEYLIASTAFIVLDTLLNETYLKYYL
FT                   LSDNFINRVNNKSTGTSYPAINDYNFNLLLIALPPLSEQQRIVEAIESALEKVDEYAES
FT                   YNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIK
FT                   KKDLDISIVSQGDDNSYYGNKDETTSYPIYEIPEAWRYIKFASLVNFRIGKTPPRSEAT
FT                   FWGTEIPWVSISDMPISGYVTNTRESISKLALKSKKIDISPKGTLLMSFKLSIGKVAIL
FT                   DIPATHNEAIISIFPYANKENIIRDYLMIFLPLISTLGDSKDAIKGKTLNSTSISELLI
FT                   PISNHEEMKRIIFKVDLLFQKVSQLFE"
FT   gene            complement(451871..452470)
FT                   /gene="hsdS"
FT                   /locus_tag="spr0446"
FT   CDS_pept        complement(451871..452470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="spr0446"
FT                   /product="Type I restriction enzyme EcoKI specificity
FT                   protein (S protein)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99250"
FT                   /db_xref="GOA:Q8DQX4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX4"
FT                   /protein_id="AAK99250.1"
FT                   /translation="MVKLTTCYFCDYGSYYGNIPMNWVVIKIKDIFSMNTGLSYKKGDL
FT                   SINNKGVRIIRGGNIKPLEFSLLDNDYYIDTQFISSEQVYLKHNQLITPVATSLEHIGK
FT                   FARIDKDYDGVVAGGFIFQLTPFESSEIISKFLLFNLSSPLFYKQLKAITKLSGQALYN
FT                   IPKTTLSELLIPLAPFEEQELITQKVEKLFEKVNQL"
FT   gene            complement(452481..453278)
FT                   /gene="xerD"
FT                   /locus_tag="spr0447"
FT   CDS_pept        complement(452481..453278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="spr0447"
FT                   /product="Integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99251"
FT                   /db_xref="GOA:Q8DQX3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX3"
FT                   /protein_id="AAK99251.1"
FT                   /translation="MKDFELHLKKAGLAENTVRSYLYGVRFFLENYKLKMEDLFEYKGY
FT                   LLDNFKPKTVNLRLQGVNKYLAFIGHDDLKLKFVKVQQKPFLEDVISHADYLFLKRSLK
FT                   KDGILKWHFVVWFLGATGARVSELIKLKVEHVEIGYFDIYSKGGKIRRLYIPKKLRNSC
FT                   LSWLESENRRSGYLFLNKFNEPITARGVAQQLKNYADKYKMNPKVIYPHSFRHLFAKNF
FT                   LAKYNDIALLADLMGHESIETTRIYLRKTATEQQNIVDKIVNW"
FT   gene            complement(453335..454903)
FT                   /gene="hsdS"
FT                   /locus_tag="spr0448"
FT   CDS_pept        complement(453335..454903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="spr0448"
FT                   /product="Type I site-specific deoxyribonuclease chain S"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99252"
FT                   /db_xref="GOA:Q8DQX2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX2"
FT                   /protein_id="AAK99252.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRFSTLVEIVRGGS
FT                   PRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLTNSM
FT                   SFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVVKNLN
FT                   SDKVASILIPLPPLSEQQRIIEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQY
FT                   AMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYEEVP
FT                   CEIPESWEWVRLNDITSYIQRGKSPKYSNIPIYPVIAQKCNQWSGFSIDLARFIDPETV
FT                   HSYQKERLLRDGDLMWNSTGLGTLGRLAIYHENKNPYAWAVADSHVTVIRVLSGVINCH
FT                   FIYNFLSSPIVQSVIEEKASGSTKQKELLTKTIKEYLIPLPPLPEQSRIVDKIEQFFAH
FT                   IDALI"
FT   gene            complement(454903..456366)
FT                   /gene="hsdM"
FT                   /locus_tag="spr0449"
FT   CDS_pept        complement(454903..456366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="spr0449"
FT                   /product="EcoE type I restriction modification enzyme M
FT                   subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99253"
FT                   /db_xref="GOA:Q8DQX1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX1"
FT                   /protein_id="AAK99253.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(456379..458712)
FT                   /gene="hsdR"
FT                   /locus_tag="spr0450"
FT   CDS_pept        complement(456379..458712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="spr0450"
FT                   /product="EcoA type I restriction-modification enzyme R
FT                   subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99254"
FT                   /db_xref="GOA:Q8DQX0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQX0"
FT                   /protein_id="AAK99254.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFRPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKENSNWRKIIDYFSSATQIGMTATPKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDANGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQNNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGDPVKVLETGAKTVSGST
FT                   PGFVSEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            459085..459285
FT                   /locus_tag="spr0451"
FT   CDS_pept        459085..459285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99255"
FT                   /db_xref="GOA:Q8CZ50"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ50"
FT                   /protein_id="AAK99255.1"
FT                   /translation="MRMLPILLLFLALLPFFSKFVTGGSSFSWEVFLIFIIDWVLLIVF
FT                   AIQISYIFWRLSQKWKELSNK"
FT   gene            459320..459829
FT                   /locus_tag="spr0452"
FT   CDS_pept        459320..459829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0452"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99256"
FT                   /db_xref="GOA:Q8CZ49"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ49"
FT                   /protein_id="AAK99256.1"
FT                   /translation="MNSRVEFRIFTIVDLDKKEEYLHEMHLKGWRYRTSRFGLFYFEQG
FT                   QPDDVIYRIYDSRFLKEHKRELQDFRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKG
FT                   LKWEVMRSRLRSCIATFLGGLVVCMSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKR
FT                   KYRVDE"
FT   gene            459960..461027
FT                   /gene="hrcA"
FT                   /locus_tag="spr0453"
FT   CDS_pept        459960..461027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="spr0453"
FT                   /product="Heat inducible transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99257"
FT                   /db_xref="GOA:Q8DQW9"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQW9"
FT                   /protein_id="AAK99257.1"
FT                   /translation="MLIDQTERSDEMVTERQQDILNLIIDIFTKTHEPVGSKALQESIN
FT                   SSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKA
FT                   FDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLD
FT                   ESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTD
FT                   NVIDLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQKVALEIREGLREDQMQN
FT                   VRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQINVVNRVLTMKL
FT                   TDFYRYLSSNHYEVH"
FT   gene            461030..461578
FT                   /gene="grpE"
FT                   /locus_tag="spr0454"
FT   CDS_pept        461030..461578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="spr0454"
FT                   /product="Heat-shock protein (activation of DnaK)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99258"
FT                   /db_xref="GOA:Q8CWT4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWT4"
FT                   /protein_id="AAK99258.1"
FT                   /translation="MKSLKEANMAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANE
FT                   RADEFENKYLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLT
FT                   DDVKKGLAMVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPGDDEHPVDTIAQVFQ
FT                   KGYKLHDRILRPAMVVVYN"
FT   gene            462058..463881
FT                   /gene="dnaK"
FT                   /locus_tag="spr0455"
FT   CDS_pept        462058..463881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="spr0455"
FT                   /product="Class I heat-shock protein (molecular chaperone)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99259"
FT                   /db_xref="GOA:Q8CWT3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWT3"
FT                   /protein_id="AAK99259.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            464641..465759
FT                   /gene="dnaJ"
FT                   /locus_tag="spr0456"
FT   CDS_pept        464641..465759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="spr0456"
FT                   /product="Heat-shock protein (activation of DnaK)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99260"
FT                   /db_xref="GOA:Q8CWT2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWT2"
FT                   /protein_id="AAK99260.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGFNGAGGFGGFEDIFSSFFGGGGSSR
FT                   NPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPVTCGRCH
FT                   GAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHVKIPAGV
FT                   ETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQAALGDT
FT                   VDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTGLNDRQK
FT                   VALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE"
FT   repeat_region   465817..465861
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_B"
FT   gene            complement(466094..466381)
FT                   /locus_tag="spr0457"
FT   CDS_pept        complement(466094..466381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0457"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ48"
FT                   /protein_id="AAK99261.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(466391..466801)
FT                   /locus_tag="spr0458"
FT   CDS_pept        complement(466391..466801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0458"
FT                   /product="Conserved hypothetical protein"
FT                   /note="HIT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99262"
FT                   /db_xref="GOA:Q8DQW8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW8"
FT                   /protein_id="AAK99262.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            466869..467600
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0459"
FT   CDS_pept        466869..467600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0459"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99263"
FT                   /db_xref="GOA:Q8DQW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW7"
FT                   /protein_id="AAK99263.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLDQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRAKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            467597..468646
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0460"
FT   CDS_pept        467597..468646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-MSP"
FT                   /locus_tag="spr0460"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-unknown substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99264"
FT                   /db_xref="GOA:Q8DQW6"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW6"
FT                   /protein_id="AAK99264.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFRQKASKFFTETGLDW
FT                   DYVISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFAISLRLLLLSVLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLTSFVLLVELVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   repeat_region   468740..468843
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_AC"
FT   gene            complement(468814..469143)
FT                   /gene="blpT"
FT                   /locus_tag="spr0461"
FT   CDS_pept        complement(468814..469143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpT"
FT                   /locus_tag="spr0461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99265"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ47"
FT                   /protein_id="AAK99265.1"
FT                   /translation="MTDTDPIKRAHTLITDLNKAYQACKQASADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQISSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            469419..469757
FT                   /gene="blpS"
FT                   /locus_tag="spr0462"
FT   CDS_pept        469419..469757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpS"
FT                   /locus_tag="spr0462"
FT                   /product="Regulatory protein"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99266"
FT                   /db_xref="GOA:Q8DQW5"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012405"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW5"
FT                   /protein_id="AAK99266.1"
FT                   /translation="MKHMIIQTQKTVYKVNIDDIYYIQTHPTKAHTVQIVTEKASFNML
FT                   QNLSNLENQYGETLMRCHRNCLVNLDKVKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKEGE"
FT   gene            469762..470499
FT                   /gene="rr13"
FT                   /locus_tag="spr0463"
FT   CDS_pept        469762..470499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rr13"
FT                   /locus_tag="spr0463"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99267"
FT                   /db_xref="GOA:Q7CRB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRB6"
FT                   /protein_id="AAK99267.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKEHHITLSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIREQDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   SPRPHRVILYTKTDRLEFTASLEEVFKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            470513..471853
FT                   /gene="hk13"
FT                   /locus_tag="spr0464"
FT   CDS_pept        470513..471853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hk13"
FT                   /locus_tag="spr0464"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99268"
FT                   /db_xref="GOA:Q7CRB5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRB5"
FT                   /protein_id="AAK99268.1"
FT                   /translation="MNIAWILLYALVINGLEIVIFFKVDGIGLTFDRIFKAFLLKFLLG
FT                   IIFTTFQFLAVSKYLSYFIEPLFGIGLSFLLLRGLPKKILIFYGLFPMILVELFYRGVS
FT                   YFVLPFLGQGIVDGDGNPIFLLIMIFVCFIVLVFLKWLDYDFTRLRREFLDTGFQKSLT
FT                   KINWAMGAYYLVMQSLSYLEYEQGIQSTTVRHLILVFYLLFFMGGIKKLDTYLKEKLQE
FT                   ELNQEQTLRYRDMERYSRHIEELYKEIRSFRHDYTNLLTSLRLGIEEEDMEQIKEIYDS
FT                   VLRDSSQKLQDNKYDLGRLVNIRDRALKSLLAGKFIKAREKNIVFNVEVPEEIQVEGMS
FT                   LLDFLTIVSILCDNAIEASAEASQPHVSIAFLKNGAQETFIIENSIKEEGIDISEIFSF
FT                   GASSKGEERGVGLYTVMKIVESHPNTNLNTTCQNQVFRQVLTVIHAE"
FT   gene            complement(471895..472050)
FT                   /gene="ip"
FT                   /locus_tag="spr0465"
FT   CDS_pept        complement(471895..472050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ip"
FT                   /locus_tag="spr0465"
FT                   /product="Bacteriocin-like peptide, double glycine cleavage
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:spr0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99269"
FT                   /db_xref="GOA:Q7CRB4"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRB4"
FT                   /protein_id="AAK99269.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQITGGGWWEELLHETILSKFKITKAL
FT                   ELPIQL"
FT   gene            complement(472107..473114)
FT                   /locus_tag="spr0466"
FT   CDS_pept        complement(472107..473114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0466"
FT                   /product="Conserved hypothetical protein, truncation"
FT                   /note="blpB"
FT                   /db_xref="EnsemblGenomes-Gn:spr0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99270"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW4"
FT                   /protein_id="AAK99270.1"
FT                   /translation="MKQSLEKATDLFSGEDEFGYHNTFMNFTKQSHDIELGITKTNTEV
FT                   SNQANLANSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTSNPHQSILNRYLVAS
FT                   QGQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLAAKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLENNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPIITDTREVLITYYVASDYLPLLDKGQTVRLKLEKIGNHGITIIGQLQTIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTAKKTYFDYFKDKILTHSD"
FT   gene            complement(473133..473468)
FT                   /locus_tag="spr0467"
FT   CDS_pept        complement(473133..473468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0467"
FT                   /product="Conserved hypothetical protein, truncation"
FT                   /note="blpB"
FT                   /db_xref="EnsemblGenomes-Gn:spr0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99271"
FT                   /db_xref="GOA:Q8DQW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW3"
FT                   /protein_id="AAK99271.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVLIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEIAPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALET
FT                   QLQRFEK"
FT   gene            complement(473479..475104)
FT                   /locus_tag="spr0468"
FT   CDS_pept        complement(473479..475104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0468"
FT                   /product="Conserved hypothetical protein, truncation"
FT                   /note="blpA"
FT                   /db_xref="EnsemblGenomes-Gn:spr0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99272"
FT                   /db_xref="GOA:Q8DQW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW2"
FT                   /protein_id="AAK99272.1"
FT                   /translation="MVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYILQQV
FT                   MSFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSIIDALA
FT                   STILSLFLDVSILILVGGVLLAQNPNLFLLSLLSIPIYMFIIFSFMKPFEKMNHDVMQS
FT                   NSMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQTSLKQGT
FT                   KLVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQSAKVANNR
FT                   LNEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIKQGDKVSLV
FT                   GVSGSGKTTLAKMIVNFFKPYKGHISINHQDIKNIDKKVLRRHINYLPQQAYIFNGSIL
FT                   ENLTLGGNHMISQEDILKAYELAEIRQDIERMPMGYQTQLSDGAGLSGGQKQRIALARA
FT                   LLTKSPVLILDEATSGLDVLTEKKVIDNLISLTDKTILFVAHRLSIAERTNRVIVLDQG
FT                   KIIEVGSHQELMQAQGFYHHLFNK"
FT   gene            complement(475049..475642)
FT                   /locus_tag="spr0469"
FT   CDS_pept        complement(475049..475642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0469"
FT                   /product="Conserved hypothetical protein, truncation"
FT                   /note="blpA"
FT                   /db_xref="EnsemblGenomes-Gn:spr0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99273"
FT                   /db_xref="GOA:Q8DQW1"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW1"
FT                   /protein_id="AAK99273.1"
FT                   /translation="MPMTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAK
FT                   TNKEGTTALGIVKAADEMGFETRPVQAYKTLFDMSDVPYPFIVHVNKEGKFQHYYVVYQ
FT                   TKKDYLIIGDPDPSVKITKMSKERFFYEWTGVAIFLATKPSYQPHKDKKNGLLSKLPSS
FT                   DFQTKISHCLHCSLKLIGHYYQYRWFLLSPRNLG"
FT   gene            475926..476159
FT                   /locus_tag="spr0470"
FT   CDS_pept        475926..476159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0470"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99274"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ46"
FT                   /protein_id="AAK99274.1"
FT                   /translation="MNTKMMSQFSVMDNEMLVRTEDGDVSDIYRGYANQRSPFASYPSI
FT                   LKNSGPFPVSGYCLRGYHDRGYIGAGFHLCGI"
FT   gene            476175..476354
FT                   /locus_tag="spr0471"
FT   CDS_pept        476175..476354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ45"
FT                   /protein_id="AAK99275.1"
FT                   /translation="MREDFYEKVSTSIQNKCSLLLLIFRIWSFSADAYRPKLLAIFFPD
FT                   WQFRLDSKYLEFTI"
FT   gene            476191..476880
FT                   /gene="blpY"
FT                   /locus_tag="spr0472"
FT   CDS_pept        476191..476880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpY"
FT                   /locus_tag="spr0472"
FT                   /product="BlpY protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99276"
FT                   /db_xref="GOA:Q8DQW0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQW0"
FT                   /protein_id="AAK99276.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFGLSQLTLIVQNYWQFSSQIGNFVW
FT                   IQNILSLLFSGVMIWILVKTGHGYLFRIPRKKWLWYSILTVLVVVLHISFNVQTAKHVQ
FT                   STAEGWNVLIGYSGTNFAELGIYVTLFFLTPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFLSLPSLLDIFVFATFGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            476922..477155
FT                   /gene="blpZ"
FT                   /locus_tag="spr0473"
FT   CDS_pept        476922..477155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpZ"
FT                   /locus_tag="spr0473"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99277"
FT                   /db_xref="GOA:Q8CZ44"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ44"
FT                   /protein_id="AAK99277.1"
FT                   /translation="MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFNF
FT                   LNSMLALMAIFIGAGYVVGFWLLILNENQRAN"
FT   repeat_region   complement(477126..477230)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CA"
FT   gene            477306..477917
FT                   /gene="pncP"
FT                   /locus_tag="spr0474"
FT   CDS_pept        477306..477917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncP"
FT                   /locus_tag="spr0474"
FT                   /product="ABC transporter ATP binding protein-unknown
FT                   substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99278"
FT                   /db_xref="GOA:Q8DQV9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV9"
FT                   /protein_id="AAK99278.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGLAYKKSQNLWVSTLVHMFYNSWPLLYYL"
FT   gene            478078..478872
FT                   /locus_tag="spr0475"
FT   CDS_pept        478078..478872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0475"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99279"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV8"
FT                   /protein_id="AAK99279.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            478869..479504
FT                   /locus_tag="spr0476"
FT   CDS_pept        478869..479504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0476"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99280"
FT                   /db_xref="GOA:P67507"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67507"
FT                   /protein_id="AAK99280.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            479630..480109
FT                   /locus_tag="spr0477"
FT   CDS_pept        479630..480109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0477"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99281"
FT                   /db_xref="GOA:Q8DQV6"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQV6"
FT                   /protein_id="AAK99281.1"
FT                   /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDK
FT                   PEGITLNDTADLTEIISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYI
FT                   HVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVRIPYSLVSKARLAVKL"
FT   gene            480153..481289
FT                   /gene="nusA"
FT                   /locus_tag="spr0478"
FT   CDS_pept        480153..481289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="spr0478"
FT                   /product="Transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:spr0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99282"
FT                   /db_xref="GOA:Q8DQV5"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV5"
FT                   /protein_id="AAK99282.1"
FT                   /translation="MSKEMLEAFRILEEDKRIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEAFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDESDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            481311..481604
FT                   /locus_tag="spr0479"
FT   CDS_pept        481311..481604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0479"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99283"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV4"
FT                   /protein_id="AAK99283.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            481597..481896
FT                   /locus_tag="spr0480"
FT   CDS_pept        481597..481896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0480"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99284"
FT                   /db_xref="GOA:Q8DQV3"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV3"
FT                   /protein_id="AAK99284.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   LNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            481913..484705
FT                   /gene="infB"
FT                   /locus_tag="spr0481"
FT   CDS_pept        481913..484705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="spr0481"
FT                   /product="Initiation factor IF2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99285"
FT                   /db_xref="GOA:Q8DQV2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQV2"
FT                   /protein_id="AAK99285.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKTEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQAAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            484929..485306
FT                   /gene="rbfA"
FT                   /locus_tag="spr0482"
FT   CDS_pept        484929..485306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="spr0482"
FT                   /product="Ribosome binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:spr0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99286"
FT                   /db_xref="GOA:Q8DQV1"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQV1"
FT                   /protein_id="AAK99286.1"
FT                   /translation="MVQSRERNIMVNHFRIDRVGMEIKREVNEILQKKVRDPRVQGVTI
FT                   TDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFV
FT                   KDESIEYGNKIDEMLRNLDKN"
FT   repeat_region   485376..485482
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            485549..486364
FT                   /locus_tag="spr0483"
FT   CDS_pept        485549..486364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0483"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99287"
FT                   /db_xref="GOA:Q8DQV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQV0"
FT                   /protein_id="AAK99287.1"
FT                   /translation="MIRCKKEIRSLYMAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFS
FT                   KELDPKDIPTLLEQGPTTLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITI
FT                   PADVAQFYAFSLKLAQELGYIYGYEDLWASREELSEDAQNTLLLYLGVMLGVNGTAALL
FT                   RAGGITIAKQVMKTVPNKALTKTLWYPILKKVLKIFGVNLTKGGLAKGMGKFIPILGGI
FT                   ISGGLTFATMKPMGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE"
FT   gene            486366..486548
FT                   /locus_tag="spr0484"
FT   CDS_pept        486366..486548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0484"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ43"
FT                   /protein_id="AAK99288.1"
FT                   /translation="MGLIKTLAKIYGNYFLTVQGVKVMKTIKKDDNAVVGLGKLFIADK
FT                   LMDTARWLIKPEERE"
FT   repeat_region   486780..486974
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBBC"
FT   gene            486986..487231
FT                   /locus_tag="spr0485"
FT   CDS_pept        486986..487231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0485"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99289"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="PDB:2FI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ42"
FT                   /protein_id="AAK99289.1"
FT                   /translation="MEVVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNT
FT                   VGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            487231..488565
FT                   /locus_tag="spr0486"
FT   CDS_pept        487231..488565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0486"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99290"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU9"
FT                   /protein_id="AAK99290.1"
FT                   /translation="MTDERIHILRDILLELHNGASPESVQDRFDATFTGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVLDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYELMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWIQIAEESDAYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKAIMKGLREGTKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            488575..488829
FT                   /locus_tag="spr0487"
FT   CDS_pept        488575..488829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0487"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99291"
FT                   /db_xref="InterPro:IPR015026"
FT                   /db_xref="InterPro:IPR038024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ41"
FT                   /protein_id="AAK99291.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKAGKGFHDLPEGLFGERNY"
FT   gene            488925..489320
FT                   /locus_tag="spr0488"
FT   CDS_pept        488925..489320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0488"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99292"
FT                   /db_xref="GOA:Q8CZ40"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ40"
FT                   /protein_id="AAK99292.1"
FT                   /translation="MSKKLNRKKQLRNGLRRSGAFSSTVTKVVDETKKVVKRAEQSASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNW
FT                   TEKELLDLKGIGPATIKKLKENGIKFK"
FT   gene            489732..490181
FT                   /locus_tag="spr0489"
FT   CDS_pept        489732..490181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0489"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99293"
FT                   /db_xref="GOA:Q8CZ39"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ39"
FT                   /protein_id="AAK99293.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQIPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            490168..490725
FT                   /locus_tag="spr0490"
FT   CDS_pept        490168..490725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0490"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99294"
FT                   /db_xref="GOA:Q8DQU8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU8"
FT                   /protein_id="AAK99294.1"
FT                   /translation="MARTELPDKIETERLVLRVRTVADAEDIFDYASLPEVAYPAGFPP
FT                   VKTLEDEIYYLEHILPERNQKENLPAGYGIVVKGTDKIVGSVDFNHRHEDDVLEIGYTL
FT                   HPDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSKRVAEKLGFTLEARIRDR
FT                   KDVQGNRCDSLIYGLLKSEWEE"
FT   gene            490727..491689
FT                   /locus_tag="spr0491"
FT   CDS_pept        490727..491689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99295"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ38"
FT                   /protein_id="AAK99295.1"
FT                   /translation="MSDVKEEVSSLSEKQLRQIDVEYAELNDSDIIERLAYLEINNNEK
FT                   RIVISDIEPTKEIMSVSDQIFEIQKNFQKIKNMFELFISDVSDFLSIKNKLESKELEIE
FT                   EADVNRFMIHLLSSGKLFVDFNENQIKQKYSKDSEEFDCIHGFASYQYDINFTYRFCHS
FT                   LRNYSQHTDLPINEVKAVSPDDETVIIDFYIDLDYLLNSNFKWKKLKGELIKLNQETSK
FT                   IDAIALVKEYFNALTELYGNYNKLFLKLNHNTLVDIKSKLESLKLKHSRYYISKISKYD
FT                   LKYNPGNYTMSPLAAFAEIEEIYIELSKIGLVKIVNKSN"
FT   gene            491701..494352
FT                   /gene="valS"
FT                   /locus_tag="spr0492"
FT   CDS_pept        491701..494352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="spr0492"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99296"
FT                   /db_xref="GOA:Q8DQU7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQU7"
FT                   /protein_id="AAK99296.1"
FT                   /translation="MSKELSSKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAIAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNIMNDDGTMNELVFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVT
FT                   EEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDL
FT                   LNVEEELARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVT
FT                   VARIDEMKKLVK"
FT   gene            494407..495177
FT                   /locus_tag="spr0493"
FT   CDS_pept        494407..495177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0493"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99297"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU6"
FT                   /protein_id="AAK99297.1"
FT                   /translation="MMEKVMSKHPHYELLNLIGYGLAKFDKLFIKEFQCSSKSEFYRYV
FT                   VSLGIAETTGVVKNRMDLFDPYFDNNRKGWWQKAEVYRFRKDLIDMMFGNEDVHSYAEI
FT                   VKMLLASEGKKTGITIVEKPIVRTKFKRLQETGMEAENYFILHFDKEEKFQGGQLTDAR
FT                   LYGDGYDFQVDVQEYSYLAEVKGIRKSKGRVRLTAKEFEKVKEFQSDFILSLVTNLDDI
FT                   PKLVLIDNPLKHFEFKKNIIKNEIIEYRSVEDLY"
FT   gene            495460..496263
FT                   /locus_tag="spr0494"
FT   CDS_pept        495460..496263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99298"
FT                   /db_xref="GOA:Q8CZ37"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ37"
FT                   /protein_id="AAK99298.1"
FT                   /translation="MQPTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADVVKQIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNTPFQQHSKYFRDA
FT                   LVLDNAKILQRRSEFLTAFFENLLLGGQNDLSSEKMYLDLDLDFS"
FT   gene            complement(496379..496486)
FT                   /locus_tag="spr0495"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(496379..496486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0495"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99299"
FT                   /db_xref="GOA:Q8DQU5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU5"
FT                   /protein_id="AAK99299.1"
FT                   /translation="MEQAIVDYIDYYNNKRIKVKLKGLSLVQYRTKSFG"
FT   gene            complement(496468..496857)
FT                   /locus_tag="spr0496"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(496468..496857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0496"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99300"
FT                   /db_xref="GOA:Q8DQU4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU4"
FT                   /protein_id="AAK99300.1"
FT                   /translation="MEKCYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSTSPNLE
FT                   QVKSMLEQAFTEKYYENTILHSDQGWQYQHDSYHRFLESKGIQASMSRKGNSQDNGMME
FT                   SFFGILKFMAMRKHLNHLINWNKLL"
FT   gene            complement(496934..497191)
FT                   /locus_tag="spr0497"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(496934..497191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0497"
FT                   /product="Degenerate transposase (orf2)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99301"
FT                   /db_xref="GOA:Q8DQU3"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU3"
FT                   /protein_id="AAK99301.1"
FT                   /translation="MTEFSLDLLLKAIKLARSTYYYHLKQLDKPDKDQELKAEIQSIFI
FT                   EHKGNYAYRRIYLELRNRAYLVNHKRVQDLMKVLNLQAKM"
FT   gene            complement(497417..497692)
FT                   /locus_tag="spr0498"
FT                   /note="IS861-truncation"
FT   CDS_pept        complement(497417..497692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0498"
FT                   /product="Degenerate transposase (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99302"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU2"
FT                   /protein_id="AAK99302.1"
FT                   /translation="MYMNYTPKVRQKKSNFWGVFIMKLTYDDKVQIYELRKQGYSLEKL
FT                   SNKFGINNSNIRYMIKLIDRYGIEFVKKGKNRYYSPDLKQEMIHKV"
FT   gene            497816..498883
FT                   /locus_tag="spr0499"
FT   CDS_pept        497816..498883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0499"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ36"
FT                   /protein_id="AAK99303.1"
FT                   /translation="MYNFSYSCYNQPIGIKEVTLMAVFVSLDGIVVEVLDVFSSFNGDS
FT                   EFFLCKRLKDKSQFVMERSQFEEMFQLQSSRLTTQEKLQLFTSVFAGRYDVYAKNFINE
FT                   QGKIQYFPSYDYGWKQLPPEKRSFQTLTNSVLKSHFRGEAAIGIFPMHLDDSCYFLVLD
FT                   LDEGDWKEAGLTIRRIARERQMEAHLEISRSGYGLHIWFFFEEAILSRKARLFGKKLLE
FT                   LAMQESMQLSFDSFDGMFPNQDVLPKGGFDNLISLPFQGEAYHQGRTVFVDEHFQPYED
FT                   QWRYLQEIQRISTAKVALLIQEELGKQELDKELKVVLSNMIQLEKSSVTSKALFFLKNM
FT                   ASFSNPEFYSRLKLE"
FT   repeat_region   498860..498966
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            498905..499246
FT                   /locus_tag="spr0500"
FT   CDS_pept        498905..499246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0500"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ35"
FT                   /protein_id="AAK99304.1"
FT                   /translation="MLEIDLTFLIDLSCYYFILLYLKQAMRQPTYQIPERMYLFGESDY
FT                   YLWLPRGLLYPLQDKFKQVVVEDRRKVQRSIRVAFKGELTLEQELALSDMNSKENGLLH
FT                   AGQVLERSF"
FT   gene            499462..499665
FT                   /locus_tag="spr0501"
FT   CDS_pept        499462..499665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0501"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99305"
FT                   /db_xref="GOA:Q8CZ34"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ34"
FT                   /protein_id="AAK99305.1"
FT                   /translation="MIQSLFKLENSQSLLDEYEMMIVDECHHISALMFEKVVAQFRGKY
FT                   LYGLTATPERKNGHEPIVFQRN"
FT   gene            499631..499915
FT                   /locus_tag="spr0502"
FT   CDS_pept        499631..499915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0502"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99306"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ33"
FT                   /protein_id="AAK99306.1"
FT                   /translation="MVMNLLFFREIEKTKASNFIQLSDWIATDSARNQLILKDILAQVA
FT                   EGRNILVLVNRIQQIDVFEKLLKEKEVDDCYIISGKTKVRERERVYWRR"
FT   gene            499939..500571
FT                   /locus_tag="spr0503"
FT   CDS_pept        499939..500571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ32"
FT                   /protein_id="AAK99307.1"
FT                   /translation="MLSTGKYIGEGFDLPQLDTLILAAPFSWKNNLIQYSGRIHRNYKD
FT                   KSLVRIFDYVDIHVPYLEKMFQKRQVAYRKMDYRAIEGEEKQFVYVDSRYEKVLREDLA
FT                   GERQECLLILPYVHQTKLMNFLKEFRISQIEICIPETVANKAWLDQLKSQKIKVSFTQS
FT                   KIVTPILLVNKTIVWYGAMPLLGKVDEMTILRLESASIVSELVAGLR"
FT   gene            500872..501711
FT                   /gene="licT"
FT                   /locus_tag="spr0504"
FT   CDS_pept        500872..501711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="spr0504"
FT                   /product="Transcriptional antiterminator (BglG family)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99308"
FT                   /db_xref="GOA:Q8DQU1"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU1"
FT                   /protein_id="AAK99308.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKIGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGVIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            501729..503567
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0505"
FT   CDS_pept        501729..503567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0505"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99309"
FT                   /db_xref="GOA:Q8DQU0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQU0"
FT                   /protein_id="AAK99309.1"
FT                   /translation="MSYKDKVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVVQGHKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGVPVIPASYGSSVVPIIIMVWLMK
FT                   YIEKMIAKLTPAVTKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYDVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVKA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            503580..504995
FT                   /gene="bglH"
FT                   /locus_tag="spr0506"
FT   CDS_pept        503580..504995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglH"
FT                   /locus_tag="spr0506"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:spr0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99310"
FT                   /db_xref="GOA:Q8DQT9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT9"
FT                   /protein_id="AAK99310.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLIGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWY
FT                   KGVIESNGESLFK"
FT   repeat_region   505173..505279
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B2"
FT   gene            505506..506633
FT                   /gene="pheS"
FT                   /locus_tag="spr0507"
FT   CDS_pept        505506..506633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="spr0507"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:spr0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99311"
FT                   /db_xref="GOA:Q8DQT8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQT8"
FT                   /protein_id="AAK99311.1"
FT                   /translation="MVPRVNAPSGVFGMWFSFYLRETDGGNMSTIEEQLKALREETLTS
FT                   LKQITAGNEKEMQDLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAF
FT                   EETAKLLEEKKVAAQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDG
FT                   FEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLK
FT                   MISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLR
FT                   PSYFPFTEPSVEVDVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSG
FT                   FAFGLGQERVAMLRYGINDIRGFYQGDVRFSEQFK"
FT   gene            506633..507142
FT                   /locus_tag="spr0508"
FT   CDS_pept        506633..507142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0508"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99312"
FT                   /db_xref="GOA:Q8DQT7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT7"
FT                   /protein_id="AAK99312.1"
FT                   /translation="MIRKVEMADVEVLAKIAKQAFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            507219..509621
FT                   /gene="pheT"
FT                   /locus_tag="spr0509"
FT   CDS_pept        507219..509621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="spr0509"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:spr0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99313"
FT                   /db_xref="GOA:Q8DQT6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQT6"
FT                   /protein_id="AAK99313.1"
FT                   /translation="MLISYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEERQIVCGAPNVRAGIKVMVALPGARIADNYKIK
FT                   KGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEIIE
FT                   LSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVSIETDKAPYYA
FT                   ARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDNFEGTDI
FT                   RVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLEA
FT                   AVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGATVRKGIVS
FT                   AGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVRVPRRRWD
FT                   ITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTATQKLRRQVRTIAEGAGLTEIITY
FT                   TLTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALYE
FT                   IGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRLG
FT                   LQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAIE
FT                   AALQPATPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSGE
FT                   KLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(509689..510690)
FT                   /locus_tag="spr0510"
FT   CDS_pept        complement(509689..510690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99314"
FT                   /db_xref="GOA:Q8CZ31"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ31"
FT                   /protein_id="AAK99314.1"
FT                   /translation="MIKTFLSALSVILFVIPIITYSFFPSSNLNIWLSTRPILAQIYAF
FT                   PLATATMAAILSFVFFSLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNVLPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            510846..511148
FT                   /locus_tag="spr0511"
FT                   /note="IS1239-truncation"
FT   CDS_pept        510846..511148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0511"
FT                   /product="Degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99315"
FT                   /db_xref="GOA:Q8DQT5"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT5"
FT                   /protein_id="AAK99315.1"
FT                   /translation="MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREVASLLGKAPQTIH
FT                   TEIKRGTVRKCLGKGRFKEVYSADYAQQSYENNRKRSVKKSSLTKELKEKILHYT"
FT   gene            511168..511296
FT                   /locus_tag="spr0512"
FT                   /note="IS1239-truncation"
FT   CDS_pept        511168..511296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0512"
FT                   /product="Degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT4"
FT                   /protein_id="AAK99316.1"
FT                   /translation="MMVMAKGVNVGISTIYYWIHRGKLGLSKQDLLYPRKGKSLKK"
FT   gene            511419..511685
FT                   /locus_tag="spr0513"
FT   CDS_pept        511419..511685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0513"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99317"
FT                   /db_xref="GOA:Q8DQT3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT3"
FT                   /protein_id="AAK99317.1"
FT                   /translation="MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEVS
FT                   GISQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVRLEQGKS"
FT   gene            511802..514195
FT                   /gene="metE"
FT                   /locus_tag="spr0514"
FT   CDS_pept        511802..514195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="spr0514"
FT                   /product="Tetrahydropteroyltriglutamate methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:spr0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99318"
FT                   /db_xref="GOA:Q8DQT2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQT2"
FT                   /protein_id="AAK99318.1"
FT                   /translation="MRRLLQVFFFCPKQIYSFKLYQSLIFYNYTDAFFSVKIVSTTNFG
FT                   GHIMSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKHWNIVKEKGITE
FT                   IPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEKGDVRALPMKKW
FT                   FNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPFTFLQLSDFEEGV
FT                   KADDFVDSFVAAYQEVFAKLADLGATRIQLDEAALVKDLTAEEKALFLNLYNKLLADKK
FT                   GLEVLFQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFPADKTLYVGIVNG
FT                   KNIWRNNYEKSLTVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALLNHFAFAVEKLD
FT                   EIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDADYTRLPAFAEREAI
FT                   QEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAETIDEWIKWQEDI
FT                   DFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIWGDVTRLNPITV
FT                   KWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIKDEVLDLEAAGV
FT                   KIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHTHMCYSEFTDII
FT                   PAIDNMDADVISFEASRSNLEILDELKAKNFQTEVGPGVYDIHSPRVPNEGEIDNTIEA
FT                   ILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            514259..515125
FT                   /gene="metF"
FT                   /locus_tag="spr0515"
FT   CDS_pept        514259..515125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="spr0515"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99319"
FT                   /db_xref="GOA:Q8DQT1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQT1"
FT                   /protein_id="AAK99319.1"
FT                   /translation="MSRQTPSLSFEVFPPTPAVGNDNIISALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIELIKERAPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDIAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            515696..518023
FT                   /gene="pnpA"
FT                   /locus_tag="spr0516"
FT   CDS_pept        515696..518023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /locus_tag="spr0516"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:spr0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99320"
FT                   /db_xref="GOA:Q8DQT0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQT0"
FT                   /protein_id="AAK99320.1"
FT                   /translation="MSSSKTSSVSYFYFAFDVLGILIFVGKAYNFINPKGIKMAKQVFQ
FT                   TTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVMSKKMATGDFFPLQVNYEEKMY
FT                   AAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDENASAP
FT                   MAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINPSQEQAEQSLLELTVAGTKHAI
FT                   NMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVAAVGKEKAEVELLHVDAELQAE
FT                   IIAAYNSDLQKAVQVEEKLAREAATQAVKDQVTAVYEEKYANHEEFDRIMRDVAEILEQ
FT                   MEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRVHGSGLFTRGQTQALSVLTLAP
FT                   MGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAPGRREIGHGALGERALAQVLPS
FT                   LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGNNYT
FT                   VLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGITAEILTEALAQAKKARFEILD
FT                   VIEATIPEVRPELAPTAPKIDTIKIDVDKIKIVIGKGGETIDKIIAETGVKIDIDEEGN
FT                   VSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRIEKFGAFVNLFDKTDALVHISE
FT                   MAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKALLPRPPKPEHDEKGEKSERPH
FT                   RPRHQKDYKPKKEFTETPKDSE"
FT   gene            518039..518656
FT                   /gene="cysE"
FT                   /locus_tag="spr0517"
FT   CDS_pept        518039..518656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="spr0517"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:spr0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99321"
FT                   /db_xref="GOA:Q8DQS9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS9"
FT                   /protein_id="AAK99321.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   HGFKLLARMYSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            518668..519552
FT                   /locus_tag="spr0518"
FT   CDS_pept        518668..519552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0518"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99322"
FT                   /db_xref="GOA:Q8CZ30"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ30"
FT                   /protein_id="AAK99322.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFERETASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYPLANVSHLEILLADSSYQDQ
FT                   ISQLKFQAFSEEHESREVVDRYVAEALKDPESRLYILLKAGQVIGTCTVDLSTNTNYLY
FT                   GLAISEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            519634..520977
FT                   /gene="cysS"
FT                   /locus_tag="spr0519"
FT   CDS_pept        519634..520977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="spr0519"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:spr0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99323"
FT                   /db_xref="GOA:Q8DQS8"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQS8"
FT                   /protein_id="AAK99323.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIERGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   AEIEDLIQKRQEARANRDFETADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            520970..521356
FT                   /locus_tag="spr0520"
FT   CDS_pept        520970..521356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0520"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99324"
FT                   /db_xref="GOA:Q8DQS7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQS7"
FT                   /protein_id="AAK99324.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            521360..522244
FT                   /locus_tag="spr0521"
FT   CDS_pept        521360..522244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0521"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Leucine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99325"
FT                   /db_xref="GOA:Q8DQS6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS6"
FT                   /protein_id="AAK99325.1"
FT                   /translation="MREKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLASWLD
FT                   MMRTLFPNCQTVLQVGSQDYVFVLQQDKYTSVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            522381..522836
FT                   /locus_tag="spr0522"
FT   CDS_pept        522381..522836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0522"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99326"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ29"
FT                   /protein_id="AAK99326.1"
FT                   /translation="MQILCYFTITVVAKPNNSGEVHLDVSIEDNQGGSGHNFSSVSSSS
FT                   QTAKYEETGYNNNSSLYITIDKTSDATALLKLKLNNVDNQPATEVPSSGITVKLNAKDN
FT                   AGNWTSASNKKEVTVKIVSAKPTYPDKILVKNPDNIKDTEKMPLLKN"
FT   gene            523125..523298
FT                   /locus_tag="spr0523"
FT                   /note="transposase H-truncation"
FT   CDS_pept        523125..523298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0523"
FT                   /product="Transposase, uncharacterized, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99327"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS5"
FT                   /protein_id="AAK99327.1"
FT                   /translation="MKSIVTSIDERLRTRLRVIIWKQWKKKSRRLWGLLKLGVPKWIAD
FT                   KVSGWGDHYQLY"
FT   repeat_region   complement(523291..523397)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            523650..524927
FT                   /gene="vex1"
FT                   /locus_tag="spr0524"
FT   CDS_pept        523650..524927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex1"
FT                   /locus_tag="spr0524"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:spr0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99328"
FT                   /db_xref="GOA:Q8DQS4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS4"
FT                   /protein_id="AAK99328.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYES
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNAITTYLLQTLLASGDQASLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            524940..525587
FT                   /gene="vex2"
FT                   /locus_tag="spr0525"
FT   CDS_pept        524940..525587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex2"
FT                   /locus_tag="spr0525"
FT                   /product="ABC transporter ATP-binding protein-Pep export"
FT                   /db_xref="EnsemblGenomes-Gn:spr0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99329"
FT                   /db_xref="GOA:Q8DQS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS3"
FT                   /protein_id="AAK99329.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQINYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIQLV
FT                   NKKASKDTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            525639..527018
FT                   /gene="vex3"
FT                   /locus_tag="spr0526"
FT   CDS_pept        525639..527018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vex3"
FT                   /locus_tag="spr0526"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:spr0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99330"
FT                   /db_xref="GOA:Q8DQS2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS2"
FT                   /protein_id="AAK99330.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            527198..527281
FT                   /gene="pep27"
FT                   /locus_tag="spr0527"
FT   CDS_pept        527198..527281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pep27"
FT                   /locus_tag="spr0527"
FT                   /product="A secreted peptide which is the signal sensed by
FT                   VncR/S"
FT                   /db_xref="EnsemblGenomes-Gn:spr0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99331"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS1"
FT                   /protein_id="AAK99331.1"
FT                   /translation="MRKEFHNVLSSDQLLTDKRPARDYNRK"
FT   gene            527330..527986
FT                   /gene="vncR"
FT                   /locus_tag="spr0528"
FT   CDS_pept        527330..527986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncR"
FT                   /locus_tag="spr0528"
FT                   /product="VncR, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99332"
FT                   /db_xref="GOA:Q8DQS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQS0"
FT                   /protein_id="AAK99332.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASLAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            527983..529311
FT                   /gene="vncS"
FT                   /locus_tag="spr0529"
FT   CDS_pept        527983..529311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncS"
FT                   /locus_tag="spr0529"
FT                   /product="VncS, histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99333"
FT                   /db_xref="GOA:Q8DQR9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR9"
FT                   /protein_id="AAK99333.1"
FT                   /translation="MKRTGLFAKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMDLDSQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIDFPKVVQD"
FT   gene            529452..530333
FT                   /gene="fba"
FT                   /locus_tag="spr0530"
FT   CDS_pept        529452..530333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="spr0530"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:spr0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99334"
FT                   /db_xref="GOA:P0A4S2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4S2"
FT                   /protein_id="AAK99334.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(530654..531856)
FT                   /locus_tag="spr0531"
FT   CDS_pept        complement(530654..531856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0531"
FT                   /product="Hypothetical protein"
FT                   /note="Probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99335"
FT                   /db_xref="GOA:Q8CZ28"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ28"
FT                   /protein_id="AAK99335.1"
FT                   /translation="MEFSMKSVKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLT
FT                   FILATRLPLLESWFHSLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAI
FT                   YIFASIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGS
FT                   YALLGLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLK
FT                   IFQEGFESAPHPFSISGGHGQTLYFTVKTSGDHTKNIYDNLQAGSKVTLDRAYGHMIIE
FT                   EGRENQVWIAGGIGITPFISYIREHPILDKQVHFYYSFRGDENAVYLDLLRNYAQKNPN
FT                   FELHLIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKF
FT                   K"
FT   repeat_region   complement(531988..532100)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            complement(532102..532761)
FT                   /gene="glnP"
FT                   /locus_tag="spr0532"
FT   CDS_pept        complement(532102..532761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="spr0532"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99336"
FT                   /db_xref="GOA:Q8DQR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR8"
FT                   /protein_id="AAK99336.1"
FT                   /translation="MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPILRIISSIYIEFVRNVPNLLWIFTIFLVFKIKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE"
FT   gene            complement(532771..533448)
FT                   /gene="glnP"
FT                   /locus_tag="spr0533"
FT   CDS_pept        complement(532771..533448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="spr0533"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99337"
FT                   /db_xref="GOA:Q8DQR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR7"
FT                   /protein_id="AAK99337.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAVGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(533461..534255)
FT                   /gene="glnH"
FT                   /locus_tag="spr0534"
FT   CDS_pept        complement(533461..534255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="spr0534"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor
FT                   precursor"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99338"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT1"
FT                   /protein_id="AAK99338.1"
FT                   /translation="MKKKFFLSALLISLFGLAAAKPVQADTSIADIQKRGELVVGVKQD
FT                   VPNFGYKDPKTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATF
FT                   TITDERKKLYNFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGK
FT                   KKGLKFKFVELGSYPELITSLHAHRIDTFSVDRSILSGYTSKRTALLDDSFKPSDYGIV
FT                   TKKSNTELNDYLDNLVTKWSKDGSLQKLYDRYKLKPSSHTAD"
FT   gene            complement(534266..534610)
FT                   /locus_tag="spr0535"
FT                   /note="glnQ-truncation"
FT   CDS_pept        complement(534266..534610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0535"
FT                   /product="ABC transporter ATP-binding protein-glutamine,
FT                   truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99339"
FT                   /db_xref="GOA:Q8DQR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR6"
FT                   /protein_id="AAK99339.1"
FT                   /translation="MLSGGQKQRIAIARGLAMHPELLLFDEPTSALDPETIGDVLAVMQ
FT                   KLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTTDVDNFFDNPSEPRAQQFLSK
FT                   IINHESDKVK"
FT   gene            complement(534635..535024)
FT                   /locus_tag="spr0536"
FT                   /note="glnQ-truncation"
FT   CDS_pept        complement(534635..535024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0536"
FT                   /product="ABC transporter ATP-binding protein-glutamine,
FT                   truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99340"
FT                   /db_xref="GOA:Q8DQR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR5"
FT                   /protein_id="AAK99340.1"
FT                   /translation="MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKTVLENVTLA
FT                   PIKVLGIDKKEAEKTAQKYLEFVNM"
FT   repeat_region   complement(535114..535210)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            535289..537523
FT                   /gene="recJ"
FT                   /locus_tag="spr0537"
FT   CDS_pept        535289..537523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="spr0537"
FT                   /product="Single-stranded DNA-specific exonuclease, 5'-3'"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99341"
FT                   /db_xref="GOA:Q8DQR4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR018779"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR4"
FT                   /protein_id="AAK99341.1"
FT                   /translation="MDVFLITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGI
FT                   QDQESLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASI
FT                   VKESLEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALA
FT                   QSMGVDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQV
FT                   ELLDLVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETV
FT                   GFQIAPRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKT
FT                   MVDPEKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIF
FT                   EALDPHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEEL
FT                   DLEALSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASF
FT                   EVVAFGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNA
FT                   VLPEGVPVLDFPGELPNLAASEAVVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYY
FT                   LTGYGTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIK
FT                   DGVMTVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            537698..539359
FT                   /locus_tag="spr0538"
FT   CDS_pept        537698..539359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0538"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99342"
FT                   /db_xref="GOA:Q8DQR3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR3"
FT                   /protein_id="AAK99342.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPERIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEEYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            539428..540207
FT                   /gene="estA"
FT                   /locus_tag="spr0539"
FT   CDS_pept        539428..540207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="spr0539"
FT                   /product="tributyrin esterase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99343"
FT                   /db_xref="GOA:Q8DQR2"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR2"
FT                   /protein_id="AAK99343.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGVNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALTTNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIRDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            540319..541539
FT                   /gene="murM"
FT                   /locus_tag="spr0540"
FT   CDS_pept        540319..541539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="spr0540"
FT                   /product="Serine/alanine adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:spr0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99344"
FT                   /db_xref="GOA:Q8DQR1"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR1"
FT                   /protein_id="AAK99344.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRVVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            541544..542776
FT                   /gene="murN"
FT                   /locus_tag="spr0541"
FT   CDS_pept        541544..542776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murN"
FT                   /locus_tag="spr0541"
FT                   /product="Alanine adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:spr0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99345"
FT                   /db_xref="GOA:Q8DQR0"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQR0"
FT                   /protein_id="AAK99345.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQGLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSDYMSKLQGEQSKLEENLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            542892..543551
FT                   /locus_tag="spr0542"
FT   CDS_pept        542892..543551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0542"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99346"
FT                   /db_xref="GOA:Q8CZ27"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ27"
FT                   /protein_id="AAK99346.1"
FT                   /translation="MWRLFWRLVWIVVLLCVLAFGLLWYLNGDFQGALKQAERSVKIGQ
FT                   QSIDQWEKTGQLPKLSQTDSHQHSEGRWAQASARIYLDPQMDSRFQEAYLEAIQNWNQT
FT                   GAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNLLTGQFLSVTVRLNHYYLSNPY
FT                   YGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFYGIQEEDVANLRKIYETSE"
FT   gene            543591..545435
FT                   /gene="uvrC"
FT                   /locus_tag="spr0543"
FT   CDS_pept        543591..545435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="spr0543"
FT                   /product="Exonuclease ABC-subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:spr0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99347"
FT                   /db_xref="GOA:Q8DQQ9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQQ9"
FT                   /protein_id="AAK99347.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGSLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGV
FT                   PRVVAEAVQRKLNPQGEALSQVAEERVDYQTEGNHNEP"
FT   gene            545425..546258
FT                   /locus_tag="spr0544"
FT   CDS_pept        545425..546258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0544"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99348"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ8"
FT                   /protein_id="AAK99348.1"
FT                   /translation="MNHKIAILSDVHGNATALEAVIADAKNQGASEYWLLGDIFLPGPG
FT                   ANDLVALLKDLPITASVRGNWDDRVLEALDGQYGLEDPQEVQLLRMTQYLMERMDPATI
FT                   VWLRSLPLLEKKEIDGLRFSISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHV
FT                   HKQLLRYGSQGQQIINPGSIGMPYFNWEALKNHRAQYAVIEVEDGELLNIQFRKVAYDY
FT                   EAELELAKSKGLPFIEMYEELRRDDNYQGHNLELLASLIEKHGYVEDVKNFFDFL"
FT   repeat_region   complement(546326..546438)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CA"
FT   gene            complement(546440..547255)
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0545"
FT   CDS_pept        complement(546440..547255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-SBP"
FT                   /locus_tag="spr0545"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor
FT                   precursor"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99349"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWT0"
FT                   /protein_id="AAK99349.1"
FT                   /translation="MNGDSMKKFSLLLAILPFLVACGNQATPKETSAQKTIVLATAGDV
FT                   PPFDYEDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSY
FT                   TKERAEKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKH
FT                   TDNPATINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPS
FT                   NYIIFSSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            547411..548016
FT                   /gene="nrd"
FT                   /locus_tag="spr0546"
FT   CDS_pept        547411..548016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrd"
FT                   /locus_tag="spr0546"
FT                   /product="Nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99350"
FT                   /db_xref="GOA:Q8DQQ7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ7"
FT                   /protein_id="AAK99350.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIEDRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR"
FT   gene            548029..549429
FT                   /gene="pepV"
FT                   /locus_tag="spr0547"
FT   CDS_pept        548029..549429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="spr0547"
FT                   /product="Dipeptidase"
FT                   /EC_number="3.4.14.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99351"
FT                   /db_xref="GOA:Q8DQQ6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011291"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ6"
FT                   /protein_id="AAK99351.1"
FT                   /translation="MIAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGAARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFRFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVASVSLSEHGHTPHYVPMEDPLVQTLLNVY
FT                   EKQTGLQGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            549483..550061
FT                   /locus_tag="spr0548"
FT   CDS_pept        549483..550061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0548"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99352"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ5"
FT                   /protein_id="AAK99352.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIELLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQVLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKAYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   repeat_region   complement(550056..550206)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBA"
FT   gene            550225..550377
FT                   /locus_tag="spr0549"
FT   CDS_pept        550225..550377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0549"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99353"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ26"
FT                   /protein_id="AAK99353.1"
FT                   /translation="MKEIAFDAFYQLYQNDQLSLVDVREVDEFAALHLEGAHNLPLSQL
FT                   ADSYD"
FT   gene            550378..550512
FT                   /locus_tag="spr0550"
FT   CDS_pept        550378..550512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0550"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99354"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ4"
FT                   /protein_id="AAK99354.1"
FT                   /translation="MDKDRLHYIICKSGMRSARACQFLLEQGYNVINVQGGMLAFEEL"
FT   gene            550668..552008
FT                   /gene="brnQ"
FT                   /locus_tag="spr0551"
FT   CDS_pept        550668..552008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="spr0551"
FT                   /product="Branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99355"
FT                   /db_xref="GOA:Q8DQQ3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ3"
FT                   /protein_id="AAK99355.1"
FT                   /translation="MKEIFMAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAI
FT                   AGFVFSGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTA
FT                   TTAYEVGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIV
FT                   ILVVLGAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGF
FT                   SSKKEYISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEI
FT                   FGSTAQLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLG
FT                   LDAIIKYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIANVLGSSF
FT                   KVEFLANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   repeat_region   552013..552121
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_AC"
FT   gene            552212..553249
FT                   /locus_tag="spr0552"
FT   CDS_pept        552212..553249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0552"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99356"
FT                   /db_xref="GOA:Q8DQQ2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ2"
FT                   /protein_id="AAK99356.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREIADYLVKTLEGFGYQPVRTSKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKMDRIGGFPWNMIEGENCTIHV
FT                   ASTGEKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDAKVTSEKETRALGIEVGDFI
FT                   SFDPRTVVTETGFIKSRHLDDKVSAAILLNLLRIYKEEKIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPAQVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVIATERMVDAYLK
FT                   STLVD"
FT   gene            553218..553721
FT                   /locus_tag="spr0553"
FT   CDS_pept        553218..553721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0553"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99357"
FT                   /db_xref="GOA:Q8CZ25"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ25"
FT                   /protein_id="AAK99357.1"
FT                   /translation="MLILRARWWTNMCLICQRIDLIKKEENPYFVKELETGYLVVGDHQ
FT                   YFEGYSLFLAKEHVSELHHLKKETRLRFLEEMSLVQEAVAKAFAAEKMNIELLGNGDAH
FT                   LHWHLFPRRTGDMNGHGLKGRGPVWWVPFEEMTAETCQAKPDEIKRLVKRLSSEVDKLL
FT                   EIKE"
FT   gene            553724..554440
FT                   /locus_tag="spr0554"
FT   CDS_pept        553724..554440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0554"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99358"
FT                   /db_xref="GOA:Q8DQQ1"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="PDB:4OX5"
FT                   /db_xref="PDB:4OXD"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ1"
FT                   /protein_id="AAK99358.1"
FT                   /translation="MKKRYLVLTALLALSLAACSQEKTKNEDGETKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAESG
FT                   LSLEEYYGFEGGDYVD"
FT   repeat_region   554438..554623
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            554749..555174
FT                   /gene="rplK"
FT                   /locus_tag="spr0555"
FT   CDS_pept        554749..555174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="spr0555"
FT                   /product="50S Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:spr0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99359"
FT                   /db_xref="GOA:Q8CWS9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWS9"
FT                   /protein_id="AAK99359.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            555382..556071
FT                   /gene="rplA"
FT                   /locus_tag="spr0556"
FT   CDS_pept        555382..556071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="spr0556"
FT                   /product="50S Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:spr0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99360"
FT                   /db_xref="GOA:P66096"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66096"
FT                   /protein_id="AAK99360.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   repeat_region   complement(556333..556439)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   repeat_region   556664..557178
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBBBBBBBBC"
FT   repeat_region   557770..557876
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B2"
FT   gene            558589..559581
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0557"
FT   CDS_pept        558589..559581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0557"
FT                   /product="ABC transporter ATP-binding protein-role in
FT                   polysaccharide efflux"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99361"
FT                   /db_xref="GOA:Q8DQQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQQ0"
FT                   /protein_id="AAK99361.1"
FT                   /translation="MAMIEVEHLQKNFVKTVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPNSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            559541..560401
FT                   /locus_tag="spr0558"
FT   CDS_pept        559541..560401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0558"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99362"
FT                   /db_xref="GOA:Q8DQP9"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP9"
FT                   /protein_id="AAK99362.1"
FT                   /translation="MRILSVASTERSSRMIKLWRRYKPFINAGVQELITYRVNFILYRI
FT                   GDVMGAFVAFYLWKAVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEV
FT                   KDGSIIMRLLRPVHFAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGL
FT                   TVLYLFSLTLAYLINFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKV
FT                   VSDILSFLPFSSLIYTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFI
FT                   TIQGG"
FT   gene            560403..561188
FT                   /locus_tag="spr0559"
FT   CDS_pept        560403..561188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0559"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99363"
FT                   /db_xref="GOA:Q8DQP8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP8"
FT                   /protein_id="AAK99363.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            561441..561686
FT                   /locus_tag="spr0560"
FT   CDS_pept        561441..561686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0560"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99364"
FT                   /db_xref="GOA:Q8CZ24"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ24"
FT                   /protein_id="AAK99364.1"
FT                   /translation="MSRRKKAYQGRKIGSQLLATLESEARKKVGYLQVKTVAEASNKDY
FT                   DRTNDFYRGLGFKKLEIFSQLWNPQNPCQILIKKLE"
FT   repeat_region   561998..562192
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            562418..568852
FT                   /gene="prtA"
FT                   /locus_tag="spr0561"
FT   CDS_pept        562418..568852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtA"
FT                   /locus_tag="spr0561"
FT                   /product="Cell wall-associated serine proteinase precursor
FT                   PrtA"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99365"
FT                   /db_xref="GOA:Q8DQP7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP7"
FT                   /protein_id="AAK99365.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSSSEDALSISDKEKVV
FT                   VDKETENKEKHKDIHNAIETSKDTEEKKTTIIEEKEVVSKNPVIDTKTSNEEAKIKEEN
FT                   SNQSQGDHTDSFVNKNTENPKKEDKVVYIAEFKDKESGEKAIKGLSNLKNTKVLYTYDR
FT                   IFNGSAIETTPDNLDKIKQIEGISSIERAQKVQPMMNHARKEIGVEEAIDYLKSINAPF
FT                   GKNFDGRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAF
FT                   NYYNGGKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYK
FT                   MYSDAGSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIP
FT                   MVVATGNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVN
FT                   IGGESFKYRNIGAFFDKNKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMD
FT                   RIYTKDLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISG
FT                   DDGVKLWNMINPDKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFA
FT                   PDTDKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGT
FT                   SMATPIVAASTVLIRPKLKEMLERPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSW
FT                   KEKSQYFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYF
FT                   TIKLHNTSNRPLTFKVSASAITTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGA
FT                   NITFEHGTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALNSNGKKINF
FT                   QPSLSMPLMGFAGNWNHEPILDKWAWEEGSRSKTLGGYDDDGKPKIPGTLNKGIGGEHG
FT                   IDKFNPAGVIQNRKDKNTTSLDQNPELFAFNNQGINAPSSSGSKIANIYPLDSNGNPQD
FT                   AQLERGLTPSPLVLRSAEEGLISIVNTNKEGENQRDLKVISREHFIRGILNSKSNDAKG
FT                   IKSSKLKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKY
FT                   RLTKDYPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARD
FT                   QKEHPEKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEIK
FT                   GAGDLRGKIIEVIALDGSSNFTKIHRIKFADQADEKGMISYYLVDPDKDASKYEKLGEI
FT                   SEDKLKNAKSPEENTNNNQAKDEDSKPDEKSSVEGEASLEINKTISTIREFENKDLKKL
FT                   IKKKFREVNDFTSETGKRIEEYDYKYDDKGNIIAYDDGSALQYETEKFDEIKSKIYGVL
FT                   SPSKDGHFEILGKISNVSKNAKVYYGNSYKSIEIKATKYDSHSKTMIFDLYANINDIVD
FT                   GLAFAGDMRLFVKDDNQIKAETKIRMPEKNKETKAEYPYVSSYGNVIELGEGDLSKNKP
FT                   DNLTKMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIA
FT                   KIQKANPNLRVLSETTIYADSRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEA
FT                   IDKDGNLVTDSSKLVLFGKDDKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFN
FT                   PSKSNKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLN
FT                   VKDGDIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEV
FT                   NIDPKGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYVNGKEYTSFDDIKQITDKT
FT                   LNIKIVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILP
FT                   VYKGELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDV
FT                   SKKKDNPQVNHSQLNESHRKEDLQREDHSQKSDSTKDVTATVLDKNNISSKSTTNNPNK
FT                   LPKTGTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   repeat_region   569213..569257
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_B"
FT   gene            569431..569952
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0562"
FT   CDS_pept        569431..569952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0562"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99366"
FT                   /db_xref="GOA:Q8DQP6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP6"
FT                   /protein_id="AAK99366.1"
FT                   /translation="MLYLWHKVNGKKGKLMVLDYFFDKNLVFCLEADNQEQLFDQVATL
FT                   LEEREIVTPTYREALITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLE
FT                   KPVTFHNMIAPDKEVEVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEK
FT                   LYAYIAEAIA"
FT   gene            569990..570295
FT                   /locus_tag="spr0563"
FT   CDS_pept        569990..570295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0563"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99367"
FT                   /db_xref="GOA:Q8CZ23"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ23"
FT                   /protein_id="AAK99367.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIEAAIKEHGLS"
FT   gene            570343..571818
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0564"
FT   CDS_pept        570343..571818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTS-EII"
FT                   /locus_tag="spr0564"
FT                   /product="Phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99368"
FT                   /db_xref="GOA:Q8DQP5"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP5"
FT                   /protein_id="AAK99368.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNGAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLLIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLQGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVAFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   repeat_region   complement(571839..572014)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBBA"
FT   gene            572123..578809
FT                   /gene="bgaA"
FT                   /locus_tag="spr0565"
FT   CDS_pept        572123..578809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaA"
FT                   /locus_tag="spr0565"
FT                   /product="beta-galactosidase precursor"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:spr0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99369"
FT                   /db_xref="GOA:Q8DQP4"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="PDB:4CU9"
FT                   /db_xref="PDB:4CUA"
FT                   /db_xref="PDB:4CUB"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP4"
FT                   /protein_id="AAK99369.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKPEEKAPRIESQASSQEKPLKEDAKAVTNEEVNQMIENRKVDFNQNWYFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLYKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSLVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTNLNSVDKSVSYVLTDGSVQEYEVDKWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPVVPTVTVGGEAVTGLTSRQPMQYRT
FT                   LSYGAQLPEVTASAENADVTVLQASAANGMRASIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLNAEYEGAKGQVELTIQANTEKKIAQSIRPVNVVTDLHQEPSLPATVTVEYDK
FT                   GFPKTHKVTWQAIPKEKLDSYQIFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAIRIRMVKADNKRGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVPAVTANVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGSNLVAEVTVRVTDKLG
FT                   ETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQAKLHFFADSGTDAPSKLVLERYVGPGFEVPTYYSNYQAYE
FT                   SGHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKVMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSAVQEDLPKLEFVEKDLAYKTVEKKDS
FT                   TLYLGETRVEQEGKVGKERIFTVINPDGSKEEKLREVVEVPTDRIVLVGTKPVAQEAKK
FT                   PQVSEKADTKPIDSSEADQTNKAQLPNTGSAASQAAVAAGLALLGLSAGLVVTKGKKED
FT                   "
FT   repeat_region   578968..579073
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            complement(579191..579598)
FT                   /locus_tag="spr0566"
FT   CDS_pept        complement(579191..579598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0566"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99370"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ22"
FT                   /protein_id="AAK99370.1"
FT                   /translation="MEENDREILRQTSRTDTGLFSRRNPPLLIKYAMFDKKQKRGHKQS
FT                   AKNLANWHYNDKEDSYTHPDGWYYRFHHTKHQKTQTDFQQEIKVYYADEPESVPQKGLY
FT                   MNERYQNLKAKECQALLSPEGRQISLNARLM"
FT   gene            complement(579666..579911)
FT                   /locus_tag="spr0567"
FT   CDS_pept        complement(579666..579911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0567"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99371"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ21"
FT                   /protein_id="AAK99371.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEEHHFYAFY
FT                   HAFDRPSYHLKMLVSTLLFAYSQGIFSGRKIEKWKS"
FT   gene            complement(580123..580482)
FT                   /locus_tag="spr0568"
FT   CDS_pept        complement(580123..580482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0568"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99372"
FT                   /db_xref="GOA:Q8CZ20"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ20"
FT                   /protein_id="AAK99372.1"
FT                   /translation="MGMILMKLASILLLILTLVVCIILTKLFRLKKLGRNFADLAFPVL
FT                   VFEYYLITAKTFTHNFLPRLGLALSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLT
FT                   LIMYIEMIVELFLMK"
FT   gene            580406..581026
FT                   /locus_tag="spr0569"
FT   CDS_pept        580406..581026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0569"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99373"
FT                   /db_xref="GOA:Q8CZ19"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ19"
FT                   /protein_id="AAK99373.1"
FT                   /translation="MVRIMQTTKVSINNKIDANFIKIIPILYHKKKLMETRNRGIYRKV
FT                   RLLRLWVIFVIMKVIKSYNTLNDYYRKLFGEKTFKVPIDAEFDCPNRDGTVAHGGCTFC
FT                   TVSGSGDTIVAPDAPIREQFYKEIDFMHRKWPDVQKYLVYFQNFTNTHEKVEVIRERYE
FT                   QAINEPGVVGINIGMRPDCLPDETIEYLAELSECMHVTVELGL"
FT   gene            581084..581530
FT                   /locus_tag="spr0570"
FT   CDS_pept        581084..581530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0570"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99374"
FT                   /db_xref="GOA:Q8CZ18"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ18"
FT                   /protein_id="AAK99374.1"
FT                   /translation="METVKRLRKYPKIEIVSHLINGLPGETHEMMVENVRRCVTNNDIQ
FT                   GIKLHLLHLMTNTRMQRDYHEGRLQLMSQDEYVRVICDQLEIIPKHIVIHRITGDAPRD
FT                   MLIGLMWSLNKWEALNSIEMEMRRRGSVQGCKAVKQEFENEKTT"
FT   gene            581508..582071
FT                   /locus_tag="spr0571"
FT   CDS_pept        581508..582071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99375"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP3"
FT                   /protein_id="AAK99375.1"
FT                   /translation="MKMKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQV
FT                   YAFDIQKQALEKTQERLHQAGLTNAQLILQGHETLDQFVTKAKAGIFNLGYLPSADKSV
FT                   ITRPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIY
FT                   RTLNQVNNPPFLVMIEKLERYRHG"
FT   gene            582064..582318
FT                   /locus_tag="spr0572"
FT   CDS_pept        582064..582318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0572"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99376"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ17"
FT                   /protein_id="AAK99376.1"
FT                   /translation="MDKQYLHEKLDAMRQNFVESTHHERSVGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            582330..584384
FT                   /gene="nha2"
FT                   /locus_tag="spr0573"
FT   CDS_pept        582330..584384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nha2"
FT                   /locus_tag="spr0573"
FT                   /product="Na+/H+ antiporter"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99377"
FT                   /db_xref="GOA:Q8DQP2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP2"
FT                   /protein_id="AAK99377.1"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LLWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHTFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LILPHLSDEEEESKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKDKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYRRSLISFMQESRLRETTIISSGAFVERVINRVKPNNINEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   repeat_region   584386..584539
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            584548..585423
FT                   /locus_tag="spr0574"
FT   CDS_pept        584548..585423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0574"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99378"
FT                   /db_xref="GOA:Q8DQP1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP1"
FT                   /protein_id="AAK99378.1"
FT                   /translation="MKEYDMKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLIS
FT                   IFPLLLVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVL
FT                   SALWSFSKSINFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQFLFAFALFLILFGQM
FT                   ILALLAHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAF
FT                   VLLVILGVLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQ
FT                   SLKDQVFKKD"
FT   gene            585634..586344
FT                   /gene="ccdA"
FT                   /locus_tag="spr0575"
FT   CDS_pept        585634..586344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="spr0575"
FT                   /product="Cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99379"
FT                   /db_xref="GOA:Q8DQP0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQP0"
FT                   /protein_id="AAK99379.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGFL
FT                   VLFGNASILSQLFE"
FT   gene            586337..586930
FT                   /locus_tag="spr0576"
FT   CDS_pept        586337..586930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0576"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99380"
FT                   /db_xref="GOA:Q8DQN9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN9"
FT                   /protein_id="AAK99380.1"
FT                   /translation="MNKMERNINMKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMK
FT                   TEQTASKTSAAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTD
FT                   EIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRS
FT                   YPTQAFIDKEGKLVKTHPGFMEKDAILQTLKELS"
FT   gene            586941..588053
FT                   /gene="msrA"
FT                   /locus_tag="spr0577"
FT   CDS_pept        586941..588053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="spr0577"
FT                   /product="Peptide methionine sulfoxide reductase paralog"
FT                   /db_xref="EnsemblGenomes-Gn:spr0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99381"
FT                   /db_xref="GOA:P65444"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65444"
FT                   /protein_id="AAK99381.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   repeat_region   588051..588250
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            588303..589058
FT                   /gene="rr09"
FT                   /locus_tag="spr0578"
FT   CDS_pept        588303..589058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rr09"
FT                   /locus_tag="spr0578"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99382"
FT                   /db_xref="GOA:Q8DQN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN8"
FT                   /protein_id="AAK99382.1"
FT                   /translation="MVKEQSMTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGR
FT                   QAWELIQKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKL
FT                   GVDDYLLKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQ
FT                   FSLKSLASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKV
FT                   GFEDMNYFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            589055..590746
FT                   /gene="hk09"
FT                   /locus_tag="spr0579"
FT   CDS_pept        589055..590746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hk09"
FT                   /locus_tag="spr0579"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99383"
FT                   /db_xref="GOA:Q8DQN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN7"
FT                   /protein_id="AAK99383.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIETGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            590841..591425
FT                   /locus_tag="spr0580"
FT   CDS_pept        590841..591425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0580"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99384"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQN6"
FT                   /protein_id="AAK99384.1"
FT                   /translation="MTTEVTEMNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEV
FT                   LGGQIGKESSQEIGELIVETILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIV
FT                   SVHPTLHAGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILRE
FT                   IGHAHVTALTSRPKLIGGARAHYPQDAIRKF"
FT   gene            591447..597077
FT                   /gene="zmpB"
FT                   /locus_tag="spr0581"
FT   CDS_pept        591447..597077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="spr0581"
FT                   /product="Zinc metalloprotease"
FT                   /note="Similar to IgA1 protease"
FT                   /db_xref="EnsemblGenomes-Gn:spr0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99385"
FT                   /db_xref="GOA:Q8DQN5"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQN5"
FT                   /protein_id="AAK99385.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGTMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEV
FT                   KPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQA
FT                   GEPVAPRKDEQAPVEPENQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETKTAKG
FT                   TQEEGKEGQAPVQEVNPEYKVTTGTVEKSTESELDFTTEVVPDDTKYVDEEVVERQGSK
FT                   GVQVTKTTYETVEVVETDKVLSTTTEVKTPVVPKVVKKGTKPVETREEVIPFATKEQED
FT                   DTLKRGTRQVAQEGVNGKKQITETYKTIRGEKTNEAPTVEETVLQAPQDEIIKKGTKGL
FT                   EKPTLQWANTEKDVLKKSATASYTLTKPAGVEIKSIKLALKDKDGQLVKEVTVAENNLN
FT                   ATLDKLKYYQGYTLSTTMVYDRGEGEETEKLEDKQIQLDLKKVEIKNIKETSLMNVDAE
FT                   GNETDKSLLSEKPTDVSQLYLRVTTHDNKVTRLAVSSVEEVVVDGKTLYKVVAKAPDLV
FT                   QRRADDTLSEEYVHYFEKQLPKVNNVYYNFNELVKDMQANPMGEFKLGADLNAVNVKPA
FT                   GKAYVMAKFRGTLSSVENHQYTIHNLERPLFNEAEGATLKNFNLGNVNINMPWADKVAP
FT                   IGNMFKKSTLENIKVVGSVTGNNDVTGAVNKLDEANMRNVAFIGKINSLGDKGWWSGGL
FT                   VSESWRSNTDSVYFDGDIVGNNSKFGGLVAKVNHGSNQWDVKQKGRLTNSVVKGTMTLK
FT                   NHGQSGGLVHENYDWGWVENNISMMKVNNGEIMYGSGSIDGDPYFGFDYFKNNYYVKDV
FT                   ATGESTYKRSKQIQSISQAEADAKIANMGITANTFAIQDPVVNKLNRIIDRDSEYKAIQ
FT                   DYQETRNLAYRNLEKLQPFYNKEWIVNQGNKLTDESNLVKKTVLSVTGMKSGQFVTDLS
FT                   SVDKIMIHYADGTKEEFGVSAISDSRVKQVKEYNVDDLGVVYTPNMVDKNRDSLITKVK
FT                   EKLSSVALDSAEVKSITNNPASLYLEESFAEVRETLDKLVKSLLENEDHQLNSDEVAEK
FT                   ALLKKVEDNKAKIILALTYLNRYYGIDYDGLNFKHLMMFKPDFYGKTPSILDFLIRIGS
FT                   AEKNLKGDRSLEAYREVIGGTIGKGELNGLLGYNMRLFTKYTDLNDWFIHAAKNVYVSE
FT                   PETTTEDFKDKRHRIYDGLNNDVHGRMILPLLNLKKAHIFVISTYNTIAFSSFEKYGKN
FT                   TEEERNAYKAEIDRVAKAQQRYLDFWSRLALPKVRNQLLKSQNSVPTPVWDNQVYVGLG
FT                   GANRMGYGDGGRVVTPVRELFGPTDRWHQINWNMGAMAKIYERPWKDDQVYFMVTNMME
FT                   PFGISAFTHETTHVNDRMAYYGGDWHREGTDLEAFAQGMLQTPDKSTTNGEYGALGINM
FT                   AYERKNDGEQLYNYDPEKLDSREKIDSYMKNYNESMMMLDYLEASAVIRQNLSDNSKWF
FT                   KKMDKEWRTNADRNRLIGEPHQWDKLRDLTEEEKKLPIDSIDKLVENNFVTLHGMPKNG
FT                   RYRTEGFDSSYQPVNMMAGVFGGNTSKSTVGSISFKHNAFRMWGYYGYENGFIPYVSNK
FT                   LKGAANKENKGLLGDDFIIKKVSKNQFQNLEEWKKHWYHEVYDKAQKGFVEIEVDGVKI
FT                   STYAQLQSLFEEAVSKDLAGMDDKNIKNHYQYTENLKWKIYKQLLKNTDGFSSDLFTAP
FT                   QA"
FT   gene            597147..598868
FT                   /gene="pabB"
FT                   /locus_tag="spr0582"
FT   CDS_pept        597147..598868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="spr0582"
FT                   /product="Para-aminobenzoate synthetase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99386"
FT                   /db_xref="GOA:Q8DQN4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN4"
FT                   /protein_id="AAK99386.1"
FT                   /translation="MHRKTVIDFRALGERYIFTKPIKELKTRNLTEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKAPLLGEYLLYFTVHDRVETSPIPLTYDEVDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQDLSANPFAIYNRMVVEQEAGYN
FT                   AYVEHDDMAVISMSPELFFEQNDRELTTRPMKGTTQRAITDQEDLEQASWLEQDSKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLRADVDLVTIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLHPNGRRIFNVAIRTIQLHQGEA
FT                   IYGVGGGITWDSTWQSEYREVHQKAAVLYRKQARFQLITTGKISQKNLLFEEQHLERLR
FT                   TASRYFAFPYDAEDLRQKIEAECQSCDIDQDYRLRISLSKSGEIELSRQILTPLSLHFC
FT                   QAKLCLQEANLQQAFTYFKTTYRPHLNLGEQEIIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQYLLETGQVEEKVLTLTDFAQAEAIYGCNAVRGLYELSLEEN"
FT   gene            599026..600015
FT                   /locus_tag="spr0583"
FT   CDS_pept        599026..600015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0583"
FT                   /product="Hypothetical protein"
FT                   /note="Similar to 1,4-beta-N-acetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99387"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ16"
FT                   /protein_id="AAK99387.1"
FT                   /translation="MNKRLFLKMSLVTLPILALFSQPVLAEENIHFSSCKEAWANGYSD
FT                   IHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQSTAIQINTSSATTSGWVKQDGAWY
FT                   YFDGNGNLVKNAWQGSYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYAKNAWQGAYYL
FT                   KSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQA
FT                   WYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQASTASSSND
FT                   SNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDH"
FT   gene            600133..601110
FT                   /gene="glcK"
FT                   /locus_tag="spr0584"
FT   CDS_pept        600133..601110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="spr0584"
FT                   /product="Glucose kinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:spr0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99388"
FT                   /db_xref="GOA:Q8DQN3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN3"
FT                   /protein_id="AAK99388.1"
FT                   /translation="MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDE
FT                   GSHIVDDMIESIQHRLDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIK
FT                   QKIEKALGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGV
FT                   AGAAGELGHITVDFDQPISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLID
FT                   NGEEVTAKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGE
FT                   FLLQGVQKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            601207..602046
FT                   /gene="thyA"
FT                   /locus_tag="spr0585"
FT   CDS_pept        601207..602046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="spr0585"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:spr0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99389"
FT                   /db_xref="GOA:P67050"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67050"
FT                   /protein_id="AAK99389.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(602094..602264)
FT                   /locus_tag="spr0586"
FT   CDS_pept        complement(602094..602264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0586"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99390"
FT                   /db_xref="InterPro:IPR021402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ15"
FT                   /protein_id="AAK99390.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            602140..602328
FT                   /locus_tag="spr0587"
FT   CDS_pept        602140..602328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0587"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ14"
FT                   /protein_id="AAK99391.1"
FT                   /translation="MKAAFCSSGSITFFLNAYTAPATAATVPATPVTRPLANPLAMSLP
FT                   PLYSQSASLLKRSHFSD"
FT   gene            602334..603269
FT                   /gene="miaA"
FT                   /locus_tag="spr0588"
FT   CDS_pept        602334..603269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="spr0588"
FT                   /product="tRNA isopentenylpyrophosphate transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:spr0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99392"
FT                   /db_xref="GOA:Q8CWS7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWS7"
FT                   /protein_id="AAK99392.1"
FT                   /translation="MCYNNSNEKMGIFQGKKMKTKIIVIVGPTAVGKTALAIEVAKRFN
FT                   GEVVSGDSQQVYRGLDIGTAKASPEEQAAVPHHLIDVREITESYSAFDFVSEAKMTIED
FT                   IHSRGKLAIIAGGTGLYIQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVEQAG
FT                   LEIPQFNRRRAMRALEIAHFGQDLENQEILYEPLIICLDDERSQLYERINHRVDLMFEA
FT                   GLLDEAKWLFDHSPNVQAAKGIGYKELFPYFRGEQTFEEARESLKQATRRFAKRQLTWF
FT                   RNRMQVTFYQIGESGVQDRILSQIEEFLDD"
FT   gene            603262..604500
FT                   /locus_tag="spr0589"
FT   CDS_pept        603262..604500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0589"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99393"
FT                   /db_xref="GOA:Q8DQN2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN2"
FT                   /protein_id="AAK99393.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            604493..605116
FT                   /locus_tag="spr0590"
FT   CDS_pept        604493..605116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0590"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99394"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ13"
FT                   /protein_id="AAK99394.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTDQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGLGRIFFENEEKISDDLLFEIAQIFPHQLVFEESGKIYMKLVEDEEVISLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            605131..606060
FT                   /locus_tag="spr0591"
FT   CDS_pept        605131..606060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0591"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99395"
FT                   /db_xref="GOA:Q8DQN1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQN1"
FT                   /protein_id="AAK99395.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTGA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            606081..606836
FT                   /locus_tag="spr0592"
FT   CDS_pept        606081..606836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0592"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99396"
FT                   /db_xref="GOA:Q8DQN0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQN0"
FT                   /protein_id="AAK99396.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEPDAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(606890..607936)
FT                   /gene="cpsY"
FT                   /locus_tag="spr0593"
FT   CDS_pept        complement(606890..607936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsY"
FT                   /locus_tag="spr0593"
FT                   /product="Regulatory function on capsule expression"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99397"
FT                   /db_xref="GOA:Q8DQM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM9"
FT                   /protein_id="AAK99397.1"
FT                   /translation="MLHIIECFHKTHSSKILCFFQEETHTMLLIFLSSLAILRQVWYNK
FT                   NMRIQQLHYIIKIVETGSMNEAAKQLFITQPSLSNAVRDLENEMGIEIFIRNPKGITLT
FT                   RDGMEFLSYARQVVEQTQLLEERYKNPVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEK
FT                   YELFLRETRTWEIIDDVKNFRSEVGVLFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIF
FT                   VSKTNPLAKKDKVKLSDLENFPYLSYDQGTHNSFYFSEEILSQEHHKKSIVVSDRATLF
FT                   NLLIGLDGYTIATGILNSNLNGDNIVSIPLDIDDPIELVYIQHEKTSLSKMGERFIDYL
FT                   LEEVQFDS"
FT   gene            607862..608131
FT                   /locus_tag="spr0594"
FT   CDS_pept        607862..608131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0594"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99398"
FT                   /db_xref="InterPro:IPR009256"
FT                   /db_xref="InterPro:IPR023164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM8"
FT                   /protein_id="AAK99398.1"
FT                   /translation="MSLFLKKTQNFARMSLMKTFYDVQQFLKRFGIIVYMGKRLYDIEL
FT                   MKLELSRIYDAGLMDKLDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            608131..608511
FT                   /locus_tag="spr0595"
FT   CDS_pept        608131..608511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0595"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99399"
FT                   /db_xref="GOA:Q8DQM7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM7"
FT                   /protein_id="AAK99399.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            608630..608827
FT                   /locus_tag="spr0596"
FT   CDS_pept        608630..608827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0596"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99400"
FT                   /db_xref="GOA:Q8CZ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ12"
FT                   /protein_id="AAK99400.1"
FT                   /translation="MGILSIILGLLFPIVGLILGIIGLVLAISYQKESQLDYKIEKILN
FT                   ILGIVISVVNWIVAIALIFR"
FT   gene            complement(608867..609592)
FT                   /gene="rsuA"
FT                   /locus_tag="spr0597"
FT   CDS_pept        complement(608867..609592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="spr0597"
FT                   /product="Ribosomal small subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:spr0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99401"
FT                   /db_xref="GOA:Q8DQM6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM6"
FT                   /protein_id="AAK99401.1"
FT                   /translation="MRLDNLLAQEKISRKAMKQALLRGKILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVEVNGLLTPDHIQAFQKGIVFLDGTVCKPA
FT                   KLEILSASPSISQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAESNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            609733..611595
FT                   /gene="typA"
FT                   /locus_tag="spr0598"
FT   CDS_pept        609733..611595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="spr0598"
FT                   /product="GTP-binding protein TypA/BipA (tyrosine
FT                   phosphorylated protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:spr0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99402"
FT                   /db_xref="GOA:Q8CWS6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWS6"
FT                   /protein_id="AAK99402.1"
FT                   /translation="MNIIEEIMTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDAR
FT                   TELAERAMDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDG
FT                   VVLVVDAYEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGA
FT                   DDDQLDFPVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVS
FT                   LLDYNDFVGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAK
FT                   AGDLIAVSGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTS
FT                   RKVEERLQAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEV
FT                   IVKEIDGVKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPAR
FT                   GLIGYSTEFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIE
FT                   ERGTIFVNPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILT
FT                   LEESLEFLNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            611615..611869
FT                   /locus_tag="spr0599"
FT   CDS_pept        611615..611869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0599"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99403"
FT                   /db_xref="GOA:Q8CZ11"
FT                   /db_xref="InterPro:IPR021506"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ11"
FT                   /protein_id="AAK99403.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            612185..612532
FT                   /locus_tag="spr0600"
FT   CDS_pept        612185..612532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0600"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:spr0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99404"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM5"
FT                   /protein_id="AAK99404.1"
FT                   /translation="MLHCCSRCAFFERKNKMKTKKHRLLALVLISSFTLLGAASAAVQY
FT                   PDGGVWTYGEGSGGGWAFSNYYHGKKYHYSSIVSRWDGHSDKGEAPAGKTSYAWIWTKW
FT                   GEQVAFYYDYD"
FT   gene            612603..614624
FT                   /locus_tag="spr0601"
FT   CDS_pept        612603..614624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99405"
FT                   /db_xref="GOA:Q8DQM4"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="InterPro:IPR016976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM4"
FT                   /protein_id="AAK99405.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSALLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLNYKALVPVIKGRLPLKR
FT                   LMILTLLCQLVAVFTVGYAVKTGLTSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   TENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSPDANTLYVSPSY
FT                   LDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEEASA
FT                   PLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSSWSI
FT                   NAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGI
FT                   ASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR
FT                   DLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            614626..615267
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0602"
FT   CDS_pept        614626..615267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0602"
FT                   /product="ABC transporter ATP-binding protein-sodium
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99406"
FT                   /db_xref="GOA:Q8DQM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQM3"
FT                   /protein_id="AAK99406.1"
FT                   /translation="MIELKNISKKFGSRQLFSDTNLHFEGGKIYALIGTSGCGKTTLLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            615371..616723
FT                   /gene="murD"
FT                   /locus_tag="spr0603"
FT   CDS_pept        615371..616723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="spr0603"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
FT                   ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:spr0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99407"
FT                   /db_xref="GOA:Q8DQM2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQM2"
FT                   /protein_id="AAK99407.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKRIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQIASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLTSKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRDVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            616727..617785
FT                   /gene="murG"
FT                   /locus_tag="spr0604"
FT   CDS_pept        616727..617785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="spr0604"
FT                   /product="Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNAc transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99408"
FT                   /db_xref="GOA:Q8DQM1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQM1"
FT                   /protein_id="AAK99408.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLSKVEHVGAVTK
FT                   VSDQKNPEPDELVDIQTHFNHKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELSQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            617795..618985
FT                   /gene="divIB"
FT                   /locus_tag="spr0605"
FT   CDS_pept        617795..618985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="spr0605"
FT                   /product="Cell division protein DivIB"
FT                   /db_xref="EnsemblGenomes-Gn:spr0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99409"
FT                   /db_xref="GOA:Q8DQM0"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQM0"
FT                   /protein_id="AAK99409.1"
FT                   /translation="MSKDKKNEDKETLEELKELSEWQKRNQEYLKKKAEEEVALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEPESKEKEE
FT                   QDKKLAKKATKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKDIRVEGT
FT                   VQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIKVKE
FT                   YDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKVFVSELAQISP
FT                   ELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPSVVD
FT                   MEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKKQEEESNRNQTNQRSSRR"
FT   gene            complement(619165..619395)
FT                   /locus_tag="spr0606"
FT   CDS_pept        complement(619165..619395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0606"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99410"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ10"
FT                   /protein_id="AAK99410.1"
FT                   /translation="MNKLQQPARARIAKPNPIPVASPAEKSLTGTEISSISSNKKLSCM
FT                   IITPYLFNNRLLQLRELPQFQVKLPPKIHHL"
FT   gene            619725..620573
FT                   /locus_tag="spr0607"
FT   CDS_pept        619725..620573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0607"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99411"
FT                   /db_xref="GOA:Q8CZ09"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ09"
FT                   /protein_id="AAK99411.1"
FT                   /translation="MLVGKKYYLRFYIVLSKMGLIDSMKSRKKINIFKISWDFNITLSE
FT                   KLNYKRFNKNFEKILFGIFPLALILQCFIMYIYRADILTNFQNFPITLNILLFWLLVVI
FT                   ISATIHEFSHAIIANNYQIEIPNCGIMLLLFNLAFFVDLSGVQFLKNKKQFLKIMLAGI
FT                   ASNSILSLTGLLVLLFTSYKLLGLLFFIINLGMIFINSIPFFQYDSGIILRYLNSNNNN
FT                   LNFQYIVQLLIAFVIIYFPLSQLLQFLTPNIIVRSIGGVVVSILLSILYMIGRTKYVLR
FT                   K"
FT   gene            620916..621929
FT                   /locus_tag="spr0608"
FT   CDS_pept        620916..621929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0608"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99412"
FT                   /db_xref="GOA:Q8CZ08"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ08"
FT                   /protein_id="AAK99412.1"
FT                   /translation="MYGVRKLIVADYDIIEPSNLNRQILYTESNVGKEKINVLSEKIHK
FT                   YNSDVQVVPISIKVSSVEELEKIVAEYGSIDFIVKAIDTPIDIIKIVNQFAVSHKISYI
FT                   SGGFNGCYLIIDNIYIPTIGSCFGCRNINKDINKYTLSDKTKWPTTPEMPAILGGIMTN
FT                   LIIKIFLGCYNEILIDNAYVYNMRNHALSQEKYVLENGECPICKKNNKVKDNNIRAKTF
FT                   IRSVCFCLLSGGVAFLSAIGQFTVIGTQLIVLFLGIIFAIYYAYYNKNIQTSLENIVWL
FT                   FSSFEILFLLVNFRTFIQLPVDIFICMIIFLMLWIFIMLGIVCLSYYITLLFGKEA"
FT   gene            622097..622222
FT                   /locus_tag="spr0609"
FT                   /note="ABC-NBD-truncation"
FT   CDS_pept        622097..622222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0609"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99413"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL9"
FT                   /protein_id="AAK99413.1"
FT                   /translation="MLSKNVEYKGGAMSMIEVSHLSKSFGDKIALNNISFTVKEG"
FT   gene            622319..622972
FT                   /locus_tag="spr0610"
FT                   /note="ABC-NBD-truncation"
FT   CDS_pept        622319..622972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0610"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99414"
FT                   /db_xref="GOA:Q8DQL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL8"
FT                   /protein_id="AAK99414.1"
FT                   /translation="MGQKSQNLTSGELKRIGLVSDTSGFYEKMSLYNNLLFYSKFYNIS
FT                   KSRVDNLLKRVGLYDSRKMVAGKLSTGMRQRMLLARALINKPAVLFLDEPTSGLDPTTS
FT                   RTIHELILELKTAGTTIFLTTHDMNEATLLCDYVALLNKGKLVEQGAPSELIQRYNKDK
FT                   KIKVTDYNGNQITFDFTSLEQVSQADLENIFSIHSCEPTLEDIFITLTGGKLNA"
FT   gene            622965..623678
FT                   /locus_tag="spr0611"
FT   CDS_pept        622965..623678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0611"
FT                   /product="Hypothetical protein"
FT                   /note="Putative membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99415"
FT                   /db_xref="GOA:Q8CZ07"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ07"
FT                   /protein_id="AAK99415.1"
FT                   /translation="MLKRFLALVWLRCQIILSNKSILLQVLVPFAFTYFYKYLMETQGK
FT                   VNDQQALVLLMMCLPFSLALAVGSPITIILSEEKEKYNLQTLLLSGVKGSEYILSTMFL
FT                   PFLLTFVIMGTTPLILGVTIVHTFNYITIVLLTSLSIILFYLLIGLTAKSQVVAQVISL
FT                   PAMILVAFLPMLSSLDKTVAKITDYSFMGLFTKFFTKWEGFSWNETLIPNLTLLIWIVL
FT                   LLTLITITIRKKKIS"
FT   gene            complement(623952..624095)
FT                   /locus_tag="spr0612"
FT                   /note="IS1239-truncation"
FT   CDS_pept        complement(623952..624095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0612"
FT                   /product="Degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:spr0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99416"
FT                   /protein_id="AAK99416.1"
FT                   /translation="MGILFYFADAYSSWQRGSNENANGLLREYFLKPIWQQLPKKSLMV
FT                   LC"
FT   gene            624413..625114
FT                   /gene="pyrF"
FT                   /locus_tag="spr0613"
FT   CDS_pept        624413..625114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="spr0613"
FT                   /product="Orotidine-5'-decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:spr0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99417"
FT                   /db_xref="GOA:Q8DQL6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQL6"
FT                   /protein_id="AAK99417.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKILSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEEPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            625148..625780
FT                   /gene="pyrE"
FT                   /locus_tag="spr0614"
FT   CDS_pept        625148..625780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="spr0614"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:spr0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99418"
FT                   /db_xref="GOA:Q8DQL5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQL5"
FT                   /protein_id="AAK99418.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSDLIHLAQEEGYITPEGLYLLKRFKEDQENWQEG"
FT   gene            625960..626364
FT                   /locus_tag="spr0615"
FT   CDS_pept        625960..626364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0615"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99419"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ06"
FT                   /protein_id="AAK99419.1"
FT                   /translation="MKRRKIYSLFCVVTIASSLFLPTVLARQIGDYDLTLPRWGSDTTS
FT                   ELEKENASAGINNNDSTGGGKTLNTSIRSAYSGSDITPVYSLGSGSRIVMYYNGGGDNY
FT                   IGSGTRLAMAPQFGNHVRIHTSGSWSPDSY"
FT   gene            626460..627224
FT                   /locus_tag="spr0616"
FT   CDS_pept        626460..627224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0616"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99420"
FT                   /db_xref="GOA:Q8CZ05"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ05"
FT                   /protein_id="AAK99420.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQLLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKLGAIFIPVAYMMVGGILWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSAHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            627173..627976
FT                   /locus_tag="spr0617"
FT   CDS_pept        627173..627976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0617"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99421"
FT                   /db_xref="GOA:Q8CZ04"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ04"
FT                   /protein_id="AAK99421.1"
FT                   /translation="MFGCLWYIFSTFRGLCIMKQFVQFYKKDFLAVLVYFILLLSCVLS
FT                   STVYLLRCRQYSIHPNVLEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIR
FT                   LKSIKHFTSFSFKLAALSTGIWTATLFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISI
FT                   ANNASFFIGFFFSYIAYYFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLDN
FT                   GIIGLLPIFQYMVNSNPYALIYWLTLLSIIIPLTVFSVHRNWRRV"
FT   gene            627980..628684
FT                   /locus_tag="spr0618"
FT   CDS_pept        627980..628684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0618"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99422"
FT                   /db_xref="GOA:Q8CZ03"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ03"
FT                   /protein_id="AAK99422.1"
FT                   /translation="MEMGKLSSHMWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFMEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLVLFCFMLYALGA
FT                   NVQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSI
FT                   FYFTRQKRRFIE"
FT   gene            628681..629328
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0619"
FT   CDS_pept        628681..629328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0619"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99423"
FT                   /db_xref="GOA:Q8DQL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL4"
FT                   /protein_id="AAK99423.1"
FT                   /translation="MNEIIILKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(629408..629956)
FT                   /locus_tag="spr0620"
FT                   /note="ABC-SBP-truncation"
FT   CDS_pept        complement(629408..629956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0620"
FT                   /product="ABC transporter substrate-binding protein-unknown
FT                   substrate, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99424"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL3"
FT                   /protein_id="AAK99424.1"
FT                   /translation="MISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLIT
FT                   DVKQLEGKTLIVTKGTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEV
FT                   LAWALENKGFEVGITSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTL
FT                   HPTYGDAAKADDLVVEGGH"
FT   gene            complement(630031..630273)
FT                   /locus_tag="spr0621"
FT                   /note="ABC-SBP-truncation"
FT   CDS_pept        complement(630031..630273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0621"
FT                   /product="ABC transporter substrate-binding protein-unknown
FT                   substrate, truncation"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL2"
FT                   /protein_id="AAK99425.1"
FT                   /translation="MKLFKPLLTVLALAFALIFITACSSGGNAGSSSGKTTAKARTIDE
FT                   IKKSGELRIAVFGDKKPFGYVDNDGSYQGYATILN"
FT   gene            complement(630285..631043)
FT                   /gene="glnQ"
FT                   /locus_tag="spr0622"
FT   CDS_pept        complement(630285..631043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="spr0622"
FT                   /product="ABC transporter ATP-binding protein-glutamine
FT                   transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99426"
FT                   /db_xref="GOA:Q8DQL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL1"
FT                   /protein_id="AAK99426.1"
FT                   /translation="MSETILEIKELKKSFGDNPILQGLSLEIKKGEVVVILGPSGCGKS
FT                   TLLRCLNGLESIQGGDILLDGQSIVENKKDFHLVRQKIGMVFQSYELFPHLDVLQNLIL
FT                   GPIKAQGRDKKEVTEEALQLLERVGLLDKQHSFARQLSGGQKQRVAIVRALLMHPEIIL
FT                   FDEVTASLDPEMVREVLELINDLAQEGRTMILVTHEMQFAQAIADQIIFLDQGKIAEEG
FT                   TAQAFFTNPQTKRAQEFLNVFDFSQFGSYL"
FT   gene            complement(631044..631721)
FT                   /gene="glnP"
FT                   /locus_tag="spr0623"
FT   CDS_pept        complement(631044..631721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="spr0623"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99427"
FT                   /db_xref="GOA:Q8DQL0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQL0"
FT                   /protein_id="AAK99427.1"
FT                   /translation="MQDSGIQVLFQGNNLLRILQGLGVTIGISILSVLLSMMFGTVMGI
FT                   IMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLARNFNINISGETSAIIVFTLWGT
FT                   AEMGDLVRGAITSLPKHQFESGQALGLTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKT
FT                   TSLVVLIGVVEVTKVGQQIIDSNRLTIPTASFWIYGTILVLYFAVCYPISKLSTHLEKH
FT                   WRN"
FT   gene            complement(631681..632361)
FT                   /gene="glnP"
FT                   /locus_tag="spr0624"
FT   CDS_pept        complement(631681..632361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="spr0624"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99428"
FT                   /db_xref="GOA:Q8DQK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK9"
FT                   /protein_id="AAK99428.1"
FT                   /translation="MDWSIVEQYLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYR
FT                   IPVLAQVATAYIELSRNTPLLIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAES
FT                   FRSGLEAISQTQQEIGLAIGLTPLQVFRYVVLPQATAVALPSFSANVIFLIKETSVFSA
FT                   VALADLMYVAKDLIGLYYETDIALAMLVVAYLIMLLPISLVFSWIERRIRHAGFGNPST
FT                   LSRK"
FT   gene            632576..632722
FT                   /locus_tag="spr0625"
FT                   /note="lctO-truncation"
FT   CDS_pept        632576..632722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0625"
FT                   /product="lactate oxidase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99429"
FT                   /protein_id="AAK99429.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   SFQ"
FT   gene            632850..634340
FT                   /gene="lysS"
FT                   /locus_tag="spr0626"
FT   CDS_pept        632850..634340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="spr0626"
FT                   /product="Lysyl-tRNA synthetase (lysine--tRNA ligase)
FT                   (LYSRS)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:spr0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99430"
FT                   /db_xref="GOA:Q8CWS5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWS5"
FT                   /protein_id="AAK99430.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIREITGVDFWQDMT
FT                   LEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   repeat_region   634413..634519
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_C"
FT   gene            634965..636101
FT                   /gene="lctO"
FT                   /locus_tag="spr0627"
FT   CDS_pept        634965..636101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="spr0627"
FT                   /product="Lactate oxidase"
FT                   /EC_number="1.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:spr0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99431"
FT                   /db_xref="GOA:Q8DQK7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK7"
FT                   /protein_id="AAK99431.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   repeat_region   complement(636174..636280)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            636656..637324
FT                   /locus_tag="spr0628"
FT   CDS_pept        636656..637324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0628"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99432"
FT                   /db_xref="GOA:Q8DQK6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="PDB:2A6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK6"
FT                   /protein_id="AAK99432.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   repeat_region   637362..637519
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABBC"
FT   gene            637592..638395
FT                   /gene="thiM"
FT                   /locus_tag="spr0629"
FT   CDS_pept        637592..638395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="spr0629"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:spr0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99433"
FT                   /db_xref="GOA:Q8DQK5"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQK5"
FT                   /protein_id="AAK99433.1"
FT                   /translation="MKRKDFNMTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPA
FT                   MSEFPADLEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEY
FT                   RKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIP
FT                   IVVTGEVDAIAVNGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAM
FT                   LVYNIAGEMAEKRPNGHLPGTFKVEFINALYEITDEDVKEFKRVK"
FT   gene            638397..639026
FT                   /gene="thiE"
FT                   /locus_tag="spr0630"
FT   CDS_pept        638397..639026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="spr0630"
FT                   /product="Thiamin-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99434"
FT                   /db_xref="GOA:Q8DQK4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQK4"
FT                   /protein_id="AAK99434.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   SALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNMDGVSIISAISYAKNIEKTVREMSEQ"
FT   repeat_region   complement(639419..639490)
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B"
FT   gene            639551..640144
FT                   /locus_tag="spr0631"
FT   CDS_pept        639551..640144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0631"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99435"
FT                   /db_xref="GOA:Q8DQK3"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK3"
FT                   /protein_id="AAK99435.1"
FT                   /translation="MSHFSLKKEFFMLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNIF
FT                   SLLLTPLGLQAFANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLG
FT                   ALLSGLVQGLGSEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVL
FT                   SLLVVRFISVYFFCTILVRAIVKLYHQFATGGKA"
FT   gene            640145..641530
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0632"
FT   CDS_pept        640145..641530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ABC-NBD"
FT                   /locus_tag="spr0632"
FT                   /product="ABC transporter ATP-binding protein-cobalt or
FT                   other cation transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99436"
FT                   /db_xref="GOA:Q8DQK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK2"
FT                   /protein_id="AAK99436.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQVIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIIARVQKVGILFQNPNHQFTMENLFEELIFTLENIGY
FT                   HLQEIDSKIAEVVQQCRCEAILHRPIHHLSGGEKQKAAMAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKAYIDHMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVASSPELFHMDRTTCEFGNRSLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGRIAWKGTVLKKKKSLYRELTSIVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            641532..642182
FT                   /locus_tag="spr0633"
FT   CDS_pept        641532..642182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0633"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99437"
FT                   /db_xref="GOA:Q8DQK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK1"
FT                   /protein_id="AAK99437.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            642193..642885
FT                   /gene="tenA"
FT                   /locus_tag="spr0634"
FT   CDS_pept        642193..642885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="spr0634"
FT                   /product="Transcriptional regulator of extracellular enzyme
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:spr0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99438"
FT                   /db_xref="GOA:Q8DQK0"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQK0"
FT                   /protein_id="AAK99438.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEISDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDTFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            642890..643414
FT                   /locus_tag="spr0635"
FT   CDS_pept        642890..643414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0635"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99439"
FT                   /db_xref="GOA:Q8CZ02"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ02"
FT                   /protein_id="AAK99439.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFHYSALGEIL
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFSERID"
FT   gene            643414..644217
FT                   /gene="thiM"
FT                   /locus_tag="spr0636"
FT   CDS_pept        643414..644217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="spr0636"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:spr0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99440"
FT                   /db_xref="GOA:Q8DQJ9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQJ9"
FT                   /protein_id="AAK99440.1"
FT                   /translation="MQEFTNPFPIGSSSLIHCITNEISCEMLANGILALGCKPVMADDS
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLV
FT                   KDLLDYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLVVSKNQVAVLGNGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEVYE"
FT   gene            644210..644842
FT                   /gene="thiE"
FT                   /locus_tag="spr0637"
FT   CDS_pept        644210..644842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="spr0637"
FT                   /product="Thiamine phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99441"
FT                   /db_xref="GOA:P66921"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66921"
FT                   /protein_id="AAK99441.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPVVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLKKLHNILS"
FT   repeat_region   complement(644846..645004)
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_CBBA"
FT   gene            complement(645051..645842)
FT                   /gene="thiD"
FT                   /locus_tag="spr0638"
FT   CDS_pept        complement(645051..645842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="spr0638"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:spr0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99442"
FT                   /db_xref="GOA:Q8DQJ8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ8"
FT                   /protein_id="AAK99442.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESIFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSSARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   gene            646178..646603
FT                   /gene="copY"
FT                   /locus_tag="spr0639"
FT   CDS_pept        646178..646603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="spr0639"
FT                   /product="COPAB ATPases metal-fist type repressor"
FT                   /db_xref="EnsemblGenomes-Gn:spr0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99443"
FT                   /db_xref="GOA:Q8DQJ7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ7"
FT                   /protein_id="AAK99443.1"
FT                   /translation="MTNVDFGGMVMQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDW
FT                   SKSTVQTLLSRLVEKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLL
FT                   ADLIVECEFTQTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            646614..646985
FT                   /locus_tag="spr0640"
FT   CDS_pept        646614..646985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0640"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99444"
FT                   /db_xref="GOA:Q8DQJ6"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ6"
FT                   /protein_id="AAK99444.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQA
FT                   GEFSFACGMNMMHGKMIVE"
FT   gene            646986..649238
FT                   /gene="ctpA"
FT                   /locus_tag="spr0641"
FT   CDS_pept        646986..649238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="spr0641"
FT                   /product="P-type ATPase-probable copper transporter"
FT                   /EC_number="3.6.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:spr0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99445"
FT                   /db_xref="GOA:Q8DQJ5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ5"
FT                   /protein_id="AAK99445.1"
FT                   /translation="METMTEIVKASLENGIQKIRIQAEKGYHPAHIQLQKGIPAEITFH
FT                   RATPSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKT
FT                   RKSLSLLQRFWITSIFTVPLVILMIGMLTGSISHQVMHWGTFLATTPIMLVAGKPYIQS
FT                   AWASFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKM
FT                   RKNTSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGV
FT                   SSIDESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQT
FT                   SRAPIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLII
FT                   ACPCALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVT
FT                   DIIGDEVEVFGLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQALHGKGVSGRING
FT                   KQVLLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKL
FT                   AISQLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQAAGKVAF
FT                   VGDGINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILL
FT                   NLFWAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            649445..651220
FT                   /gene="spxB"
FT                   /locus_tag="spr0642"
FT   CDS_pept        649445..651220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="spr0642"
FT                   /product="Pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:spr0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99446"
FT                   /db_xref="GOA:Q8DQJ4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ4"
FT                   /protein_id="AAK99446.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDDTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAISKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   AFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            651331..651678
FT                   /locus_tag="spr0643"
FT   CDS_pept        651331..651678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0643"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99447"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ01"
FT                   /protein_id="AAK99447.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(651795..652448)
FT                   /locus_tag="spr0644"
FT                   /note="transposase C"
FT   CDS_pept        complement(651795..652448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0644"
FT                   /product="Degenerate transposase"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99448"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ3"
FT                   /protein_id="AAK99448.1"
FT                   /translation="MVGEILCHVQNILRKQTLKPLSRLKIKSQFKKTRKRFKTSRRFRK
FT                   VRLMYQDEAGFGRISKLGSCWAPIGVGLHIHSHYIREFRYCYGAVDAHTGASVFLIAGG
FT                   CNTEWMNVFLEELSQAYPYDYFLLVIDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPIE
FT                   QVWKEIRKRGFKNKAFRTLEDVMNQLQDVIQGLEKEVIKSIVNRRWTRMLFESR"
FT   gene            complement(652336..652683)
FT                   /locus_tag="spr0645"
FT   CDS_pept        complement(652336..652683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0645"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99449"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZ00"
FT                   /protein_id="AAK99449.1"
FT                   /translation="MAKCKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATE
FT                   AGEFVTIDALFQAYKKKLGRSYTRDAFYQLLKRHGWRNIMPRPEHPKKADAQTIVASKN
FT                   KISIQEDKKAL"
FT   repeat_region   652704..652810
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_B1"
FT   repeat_region   652861..652960
FT                   /rpt_family="RUP element"
FT                   /rpt_type=DISPERSED
FT                   /note="Rup_A"
FT   gene            653116..653412
FT                   /locus_tag="spr0646"
FT                   /note="bgl-truncation"
FT   CDS_pept        653116..653412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0646"
FT                   /product="Phospho-beta-gluco or galactosidase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:spr0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99450"
FT                   /db_xref="GOA:Q8DQJ2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ2"
FT                   /protein_id="AAK99450.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGC
FT                   IDSVSAGTGEMNKRYGFIYVDRDNVGNGALKRSKKKSFYWYKDVIDSNGVSIE"
FT   gene            653533..654477
FT                   /gene="pmi"
FT                   /locus_tag="spr0647"
FT   CDS_pept        653533..654477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmi"
FT                   /locus_tag="spr0647"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:spr0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99451"
FT                   /db_xref="GOA:Q8DQJ1"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ1"
FT                   /protein_id="AAK99451.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGTKLRDEFGYDIPSEKVGEYWAISAHLN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDALLTKVPVKAGDFF
FT                   YVPSGTMHAIGAGILILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPA
FT                   NSRPVTIKADDLRSTLLVSNDFFAVYKWEITGKVNFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGRHFILPSDVESWTLEGQDLELIVSHP"
FT   gene            complement(654580..655971)
FT                   /locus_tag="spr0648"
FT                   /note="NSS transporter"
FT   CDS_pept        complement(654580..655971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0648"
FT                   /product="Sodium-dependent transporter"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99452"
FT                   /db_xref="GOA:Q8DQJ0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQJ0"
FT                   /protein_id="AAK99452.1"
FT                   /translation="MKMVFLTDLRKHNRIVKSINQTEGYLTTQVAFSYFEKGDQSLTMS
FT                   EKSQWGSKLGFILASAGSVIGLGSVWKFPYMTAANGGGGFLLIFLISTILIGFPLLLAE
FT                   FALGRSAGVSAIKTFGKLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGK
FT                   LFQLGGTGDYAQLFTSIISNPAIALGAQATFILLNIFIVSRGVQKGIERASKVMMPLLF
FT                   IIFVVIIERSLSLPNAMEGVLYFLKPDFSKLTSAGLLYALRQSFFALSLGVTAMLTYAS
FT                   YLDKKTNLVQSRISIVAMNISVSIMAGLAIFQARSPFNIQSEGGPSLVFIVLPQLFDKM
FT                   PFGTIFYVLFLFATVTSSVVMLEINVDNITNQDNSKRAKWSVILGILTFVFGIPSALSY
FT                   GVMADVHIFGKAFFDAMDFLVSNLLMPFGALFLSLFTGYIFKKALAMEELHLDERAWKQ
FT                   GLFQV"
FT   gene            656131..656793
FT                   /gene="mta"
FT                   /locus_tag="spr0649"
FT   CDS_pept        656131..656793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mta"
FT                   /locus_tag="spr0649"
FT                   /product="Regulator of the multidrug efflux pump pmrA"
FT                   /db_xref="EnsemblGenomes-Gn:spr0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99453"
FT                   /db_xref="GOA:Q8DQI9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI9"
FT                   /protein_id="AAK99453.1"
FT                   /translation="MVPLKSENGYRTYSQEDLERLQVILYYKYLGFSLEKIAELLKEER
FT                   TDLLPHLTRQLDYLTRERQHLDTLISTLQKTIQEQKGERKMTIEEKFTGFSYQDNQKYH
FT                   QEAVEKYGQEVMGQALERQKGHEDEATAAFNQVFQTLAQNLQVGLPATATENQEQAAKL
FT                   LQAIRTYGFDCSIEVFGHIGKGYVYNPEFKENIDKFGSETAQYTSDAIAAYVQTNAE"
FT   gene            complement(656822..657277)
FT                   /locus_tag="spr0650"
FT   CDS_pept        complement(656822..657277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0650"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to mutator protein MutT"
FT                   /db_xref="EnsemblGenomes-Gn:spr0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99454"
FT                   /db_xref="GOA:Q8DQI8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI8"
FT                   /protein_id="AAK99454.1"
FT                   /translation="MNRREAVEFVNMCMIKNGDKILVQDRVSPDWPGITFPGGHVERGE
FT                   SFVDAVIREVKEETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKV
FT                   WWEDFENLSHLKLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK"
FT   gene            complement(657297..658490)
FT                   /locus_tag="spr0651"
FT   CDS_pept        complement(657297..658490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0651"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99455"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI7"
FT                   /protein_id="AAK99455.1"
FT                   /translation="MWYNRAMKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLG
FT                   KKLAGTGGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVE
FT                   DHGRVFPASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDDQFVLKSADQTFTCEK
FT                   LIVTTGGKSYPSTGSTGFGHEIARHFKHTITDLEAAESPLLTDFPHKALQGISLDDVTL
FT                   SYGKHVITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEENREK
FT                   SLKNALKTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFV
FT                   TKGGVSLKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(658531..659376)
FT                   /locus_tag="spr0652"
FT   CDS_pept        complement(658531..659376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0652"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99456"
FT                   /db_xref="GOA:Q8DQI6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="PDB:6CNG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQI6"
FT                   /protein_id="AAK99456.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAKNIFLVTITGTLSGSHNSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEEGGLLMGYEID
FT                   "
FT   gene            659501..660058
FT                   /locus_tag="spr0653"
FT   CDS_pept        659501..660058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0653"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:spr0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99457"
FT                   /db_xref="GOA:Q8DQI5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI5"
FT                   /protein_id="AAK99457.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            660077..660544
FT                   /gene="comEB"
FT                   /locus_tag="spr0654"
FT   CDS_pept        660077..660544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEB"
FT                   /locus_tag="spr0654"
FT                   /product="dCMP deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="Putative late competence operon required for DNA
FT                   binding and uptake"
FT                   /db_xref="EnsemblGenomes-Gn:spr0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99458"
FT                   /db_xref="GOA:Q8DQI4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI4"
FT                   /protein_id="AAK99458.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            660612..661262
FT                   /gene="upp"
FT                   /locus_tag="spr0655"
FT   CDS_pept        660612..661262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="spr0655"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99459"
FT                   /db_xref="GOA:Q8DQI3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQI3"
FT                   /protein_id="AAK99459.1"
FT                   /translation="MKEGIPKMGKIEVINHPLIQHKLSILRRTDTSTKAFRELVDEIAM
FT                   LMGYEVLRDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKV
FT                   GHIGMYRDEETLQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGASNIK
FT                   FVCLVSAPEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            661436..662026
FT                   /gene="clpP"
FT                   /locus_tag="spr0656"
FT   CDS_pept        661436..662026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="spr0656"
FT                   /product="ATP-dependent CLP protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:spr0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99460"
FT                   /db_xref="GOA:P63788"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="PDB:1Y7O"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63788"
FT                   /protein_id="AAK99460.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAQETLEYGFIDEIMANNSLN"
FT   gene            662105..662353
FT                   /locus_tag="spr0657"
FT   CDS_pept        662105..662353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0657"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99461"
FT                   /db_xref="GOA:Q8DQI2"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DQI2"
FT                   /protein_id="AAK99461.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            complement(662219..662449)
FT                   /locus_tag="spr0658"
FT   CDS_pept        complement(662219..662449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spr0658"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:spr0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CYZ9"
FT                   /protein_id="AAK99462.1"
FT                   /translation="MSPYFLNSLLRIYRIIRKLSMFSLNFFDDSVFLSIKIAHKGCFQL
FT                   LDMTNPNFFNKFFLAQASDQLLHFLSWNIEL"
FT   gene            662455..663615
FT                   /gene="livJ"
FT                   /locus_tag="spr0659"
FT   CDS_pept        662455..663615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="spr0659"
FT                   /product="ABC transporter substrate-binding
FT                   protein-branched chain amino acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99463"
FT                   /db_xref="GOA:Q8DQI1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI1"
FT                   /protein_id="AAK99463.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   NNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEAAEVVKP"
FT   repeat_region   663670..663823
FT                   /rpt_family="BOX element"
FT                   /rpt_type=DISPERSED
FT                   /note="Box_ABC"
FT   gene            663874..664752
FT                   /gene="livH"
FT                   /locus_tag="spr0660"
FT   CDS_pept        663874..664752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="spr0660"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-branched chain amino acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99464"
FT                   /db_xref="GOA:Q8DQI0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQI0"
FT                   /protein_id="AAK99464.1"
FT                   /translation="MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMM
FT                   GAFIGYFLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSF
FT                   LLEYGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTK
FT                   MGKAMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTP
FT                   GLKSFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPA
FT                   GILGKNVKEKV"
FT   gene            664756..665712
FT                   /gene="livM"
FT                   /locus_tag="spr0661"
FT   CDS_pept        664756..665712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="spr0661"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-branched chain amino acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99465"
FT                   /db_xref="GOA:Q8DQH9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQH9"
FT                   /protein_id="AAK99465.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            665712..666476
FT                   /gene="livG"
FT                   /locus_tag="spr0662"
FT   CDS_pept        665712..666476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="spr0662"
FT                   /product="ABC transporter ATP-binding protein-branched
FT                   chain amino acid transport"
FT                   /note="Putative"
FT                   /db_xref="EnsemblGenomes-Gn:spr0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK99466"
FT                   /db_xref="GOA:Q8DQH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DQH8"
FT                   /protein_id="AAK99466.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKRVIEAYLGGEA"
FT   gene            666476..667186
FT                   /gene="livF"
FT                   /locus_tag="spr0663"
FT   CDS_pept        666476..667186
FT                   /codon_start=1
FT