(data stored in ACNUC7421 zone)

EMBL: AE007869

ID   AE007869; SV 2; circular; genomic DNA; STD; PRO; 2841580 BP.
XX
AC   AE007869; AE007943-AE008196; AE008688; AE008975-AE009230;
XX
PR   Project:PRJNA283;
XX
DT   09-MAR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Agrobacterium tumefaciens str. C58 circular chromosome, complete sequence.
XX
KW   .
XX
OS   Agrobacterium fabrum str. C58
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium;
OC   Agrobacterium tumefaciens complex.
XX
RN   [1]
RP   1-2841580
RX   DOI; 10.1126/science.1066804.
RX   PUBMED; 11743193.
RA   Wood D.W., Setubal J.C., Kaul R., Monks D.E., Kitajima J.P., Okura V.K.,
RA   Zhou Y., Chen L., Wood G.E., Almeida N.F.Jr., Woo L., Chen Y.,
RA   Paulsen I.T., Eisen J.A., Karp P.D., Bovee D.Sr., Chapman P.,
RA   Clendenning J., Deatherage G., Gillet W., Grant C., Kutyavin T., Levy R.,
RA   Li M.J., McClelland E., Palmieri A., Raymond C., Rouse G.,
RA   Saenphimmachak C., Wu Z., Romero P., Gordon D., Zhang S., Yoo H., Tao Y.,
RA   Biddle P., Jung M., Krespan W., Perry M., Gordon-Kamm B., Liao L., Kim S.,
RA   Hendrick C., Zhao Z.Y., Dolan M., Chumley F., Tingey S.V., Tomb J.F.,
RA   Gordon M.P., Olson M.V., Nester E.W.;
RT   "The genome of the natural genetic engineer Agrobacterium tumefaciens C58";
RL   Science, e1252229 294(5550):2317-2323(2001).
XX
RN   [2]
RP   1-2841580
RX   DOI; 10.1126/science.1066803.
RX   PUBMED; 11743194.
RA   Goodner B., Hinkle G., Gattung S., Miller N., Blanchard M., Qurollo B.,
RA   Goldman B.S., Cao Y., Askenazi M., Halling C., Mullin L., Houmiel K.,
RA   Gordon J., Vaudin M., Iartchouk O., Epp A., Liu F., Wollam C., Allinger M.,
RA   Doughty D., Scott C., Lappas C., Markelz B., Flanagan C., Crowell C.,
RA   Gurson J., Lomo C., Sear C., Strub G., Cielo C., Slater S.;
RT   "Genome sequence of the plant pathogen and biotechnology agent
RT   Agrobacterium tumefaciens C58";
RL   Science, e1252229 294(5550):2323-2328(2001).
XX
RN   [3]
RP   1-2841580
RA   Hinkle G., Slater S.C., Goodner B.;
RT   "Complete Genome Sequence of Agrobacterium tumefaciens C58 (Rhizobium
RT   radiobacter C58), the Causative Agent of Crown Gall Disease in Plants";
RL   Unpublished.
XX
RN   [4]
RP   1-2841580
RA   Hinkle G., Slater S.C., Goodner B.;
RT   ;
RL   Submitted (14-AUG-2001) to the INSDC.
RL   Cereon Genomics, 45 Sidney Street, Cambridge, MA 02139, USA
XX
RN   [5]
RC   Sequence update by submitter
RP   1-2841580
RG   agrobacterium.org
RA   Slater S.C., Setubal J.C., Zhao Y., Goodner B., Houmiel K., Sun J.,
RA   Kaul R., Goldman B., Chen Q., Huang W.Mun., Casjens S., Farrand S.,
RA   Burr T., Nester E., Kadoi R., Ostheimer T., Pride N., Sabo A., Henry E.,
RA   Telepak E., Wood D.;
RT   ;
RL   Submitted (30-OCT-2007) to the INSDC.
RL   Virginia Bioinformatics institute, Virginia Polytechnic Institute and State
RL   University, Washington Street Box 0477, Blacksburg, VA 24060, USA
XX
DR   MD5; bebda5767992cedaba442e4eb183229a.
DR   BioSample; SAMN02603108.
DR   EnsemblGenomes-Gn; Atu0053.
DR   EnsemblGenomes-Gn; Atu0054.
DR   EnsemblGenomes-Gn; Atu0055.
DR   EnsemblGenomes-Gn; Atu0057.
DR   EnsemblGenomes-Gn; Atu0059.
DR   EnsemblGenomes-Gn; Atu0060.
DR   EnsemblGenomes-Gn; Atu0123.
DR   EnsemblGenomes-Gn; Atu0227.
DR   EnsemblGenomes-Gn; Atu0389.
DR   EnsemblGenomes-Gn; Atu0414.
DR   EnsemblGenomes-Gn; Atu0435.
DR   EnsemblGenomes-Gn; Atu0505.
DR   EnsemblGenomes-Gn; Atu0541.
DR   EnsemblGenomes-Gn; Atu0616.
DR   EnsemblGenomes-Gn; Atu0808.
DR   EnsemblGenomes-Gn; Atu0814.
DR   EnsemblGenomes-Gn; Atu1017.
DR   EnsemblGenomes-Gn; Atu1193.
DR   EnsemblGenomes-Gn; Atu1224.
DR   EnsemblGenomes-Gn; Atu1231.
DR   EnsemblGenomes-Gn; Atu1265.
DR   EnsemblGenomes-Gn; Atu1266.
DR   EnsemblGenomes-Gn; Atu1267.
DR   EnsemblGenomes-Gn; Atu1502.
DR   EnsemblGenomes-Gn; Atu1555.
DR   EnsemblGenomes-Gn; Atu1583.
DR   EnsemblGenomes-Gn; Atu1585.
DR   EnsemblGenomes-Gn; Atu1635.
DR   EnsemblGenomes-Gn; Atu1665.
DR   EnsemblGenomes-Gn; Atu1723.
DR   EnsemblGenomes-Gn; Atu1797.
DR   EnsemblGenomes-Gn; Atu1809.
DR   EnsemblGenomes-Gn; Atu1811.
DR   EnsemblGenomes-Gn; Atu1964.
DR   EnsemblGenomes-Gn; Atu1991.
DR   EnsemblGenomes-Gn; Atu1992.
DR   EnsemblGenomes-Gn; Atu2009.
DR   EnsemblGenomes-Gn; Atu2049.
DR   EnsemblGenomes-Gn; Atu2109.
DR   EnsemblGenomes-Gn; Atu2161.
DR   EnsemblGenomes-Gn; Atu2355.
DR   EnsemblGenomes-Gn; Atu2479.
DR   EnsemblGenomes-Gn; Atu2539.
DR   EnsemblGenomes-Gn; Atu2540.
DR   EnsemblGenomes-Gn; Atu2542.
DR   EnsemblGenomes-Gn; Atu2545.
DR   EnsemblGenomes-Gn; Atu2546.
DR   EnsemblGenomes-Gn; Atu2547.
DR   EnsemblGenomes-Gn; Atu8111.
DR   EnsemblGenomes-Gn; EBG00001174086.
DR   EnsemblGenomes-Gn; EBG00001174087.
DR   EnsemblGenomes-Gn; EBG00001174088.
DR   EnsemblGenomes-Gn; EBG00001174089.
DR   EnsemblGenomes-Gn; EBG00001174090.
DR   EnsemblGenomes-Gn; EBG00001174091.
DR   EnsemblGenomes-Gn; EBG00001174092.
DR   EnsemblGenomes-Gn; EBG00001174093.
DR   EnsemblGenomes-Gn; EBG00001174094.
DR   EnsemblGenomes-Gn; EBG00001174095.
DR   EnsemblGenomes-Gn; EBG00001174096.
DR   EnsemblGenomes-Gn; EBG00001174097.
DR   EnsemblGenomes-Gn; EBG00001174098.
DR   EnsemblGenomes-Gn; EBG00001174099.
DR   EnsemblGenomes-Gn; EBG00001174100.
DR   EnsemblGenomes-Gn; EBG00001174101.
DR   EnsemblGenomes-Gn; EBG00001174102.
DR   EnsemblGenomes-Gn; EBG00001174103.
DR   EnsemblGenomes-Gn; EBG00001174104.
DR   EnsemblGenomes-Gn; EBG00001174105.
DR   EnsemblGenomes-Gn; EBG00001174106.
DR   EnsemblGenomes-Gn; EBG00001174107.
DR   EnsemblGenomes-Gn; EBG00001174108.
DR   EnsemblGenomes-Gn; EBG00001174109.
DR   EnsemblGenomes-Gn; EBG00001174110.
DR   EnsemblGenomes-Gn; EBG00001174111.
DR   EnsemblGenomes-Gn; EBG00001174112.
DR   EnsemblGenomes-Gn; EBG00001174113.
DR   EnsemblGenomes-Gn; EBG00001174114.
DR   EnsemblGenomes-Gn; EBG00001174115.
DR   EnsemblGenomes-Gn; EBG00001174116.
DR   EnsemblGenomes-Gn; EBG00001174117.
DR   EnsemblGenomes-Gn; EBG00001174118.
DR   EnsemblGenomes-Gn; EBG00001174119.
DR   EnsemblGenomes-Gn; EBG00001174120.
DR   EnsemblGenomes-Gn; EBG00001174121.
DR   EnsemblGenomes-Gn; EBG00001174122.
DR   EnsemblGenomes-Gn; EBG00001174123.
DR   EnsemblGenomes-Gn; EBG00001174124.
DR   EnsemblGenomes-Gn; EBG00001174125.
DR   EnsemblGenomes-Gn; EBG00001174126.
DR   EnsemblGenomes-Gn; EBG00001174127.
DR   EnsemblGenomes-Gn; EBG00001174128.
DR   EnsemblGenomes-Gn; EBG00001174129.
DR   EnsemblGenomes-Gn; EBG00001174130.
DR   EnsemblGenomes-Gn; EBG00001174131.
DR   EnsemblGenomes-Gn; EBG00001174132.
DR   EnsemblGenomes-Gn; EBG00001174133.
DR   EnsemblGenomes-Gn; EBG00001174134.
DR   EnsemblGenomes-Gn; EBG00001174135.
DR   EnsemblGenomes-Gn; EBG00001174136.
DR   EnsemblGenomes-Gn; EBG00001174137.
DR   EnsemblGenomes-Gn; EBG00001174138.
DR   EnsemblGenomes-Gn; EBG00001174139.
DR   EnsemblGenomes-Gn; EBG00001174140.
DR   EnsemblGenomes-Gn; EBG00001174141.
DR   EnsemblGenomes-Gn; EBG00001174142.
DR   EnsemblGenomes-Gn; EBG00001174143.
DR   EnsemblGenomes-Gn; EBG00001174144.
DR   EnsemblGenomes-Gn; EBG00001174145.
DR   EnsemblGenomes-Gn; EBG00001174146.
DR   EnsemblGenomes-Gn; EBG00001174147.
DR   EnsemblGenomes-Gn; EBG00001174148.
DR   EnsemblGenomes-Gn; EBG00001174149.
DR   EnsemblGenomes-Gn; EBG00001174150.
DR   EnsemblGenomes-Gn; EBG00001174151.
DR   EnsemblGenomes-Gn; EBG00001174152.
DR   EnsemblGenomes-Gn; EBG00001174153.
DR   EnsemblGenomes-Gn; EBG00001174154.
DR   EnsemblGenomes-Gn; EBG00001174155.
DR   EnsemblGenomes-Tr; Atu0053-1.
DR   EnsemblGenomes-Tr; Atu0054-1.
DR   EnsemblGenomes-Tr; Atu0055-1.
DR   EnsemblGenomes-Tr; Atu0057-1.
DR   EnsemblGenomes-Tr; Atu0059-1.
DR   EnsemblGenomes-Tr; Atu0060-1.
DR   EnsemblGenomes-Tr; Atu0123-1.
DR   EnsemblGenomes-Tr; Atu0227-1.
DR   EnsemblGenomes-Tr; Atu0389-1.
DR   EnsemblGenomes-Tr; Atu0414-1.
DR   EnsemblGenomes-Tr; Atu0435-1.
DR   EnsemblGenomes-Tr; Atu0505-1.
DR   EnsemblGenomes-Tr; Atu0541-1.
DR   EnsemblGenomes-Tr; Atu0616-1.
DR   EnsemblGenomes-Tr; Atu0808-1.
DR   EnsemblGenomes-Tr; Atu0814-1.
DR   EnsemblGenomes-Tr; Atu1017-1.
DR   EnsemblGenomes-Tr; Atu1193-1.
DR   EnsemblGenomes-Tr; Atu1224-1.
DR   EnsemblGenomes-Tr; Atu1231-1.
DR   EnsemblGenomes-Tr; Atu1265-1.
DR   EnsemblGenomes-Tr; Atu1266-1.
DR   EnsemblGenomes-Tr; Atu1267-1.
DR   EnsemblGenomes-Tr; Atu1502-1.
DR   EnsemblGenomes-Tr; Atu1555-1.
DR   EnsemblGenomes-Tr; Atu1583-1.
DR   EnsemblGenomes-Tr; Atu1585-1.
DR   EnsemblGenomes-Tr; Atu1635-1.
DR   EnsemblGenomes-Tr; Atu1665-1.
DR   EnsemblGenomes-Tr; Atu1723-1.
DR   EnsemblGenomes-Tr; Atu1797-1.
DR   EnsemblGenomes-Tr; Atu1809-1.
DR   EnsemblGenomes-Tr; Atu1811-1.
DR   EnsemblGenomes-Tr; Atu1964-1.
DR   EnsemblGenomes-Tr; Atu1991-1.
DR   EnsemblGenomes-Tr; Atu1992-1.
DR   EnsemblGenomes-Tr; Atu2009-1.
DR   EnsemblGenomes-Tr; Atu2049-1.
DR   EnsemblGenomes-Tr; Atu2109-1.
DR   EnsemblGenomes-Tr; Atu2161-1.
DR   EnsemblGenomes-Tr; Atu2355-1.
DR   EnsemblGenomes-Tr; Atu2479-1.
DR   EnsemblGenomes-Tr; Atu2539-1.
DR   EnsemblGenomes-Tr; Atu2540-1.
DR   EnsemblGenomes-Tr; Atu2542-1.
DR   EnsemblGenomes-Tr; Atu2545-1.
DR   EnsemblGenomes-Tr; Atu2546-1.
DR   EnsemblGenomes-Tr; Atu2547-1.
DR   EnsemblGenomes-Tr; Atu8111-1.
DR   EnsemblGenomes-Tr; EBT00001752368.
DR   EnsemblGenomes-Tr; EBT00001752369.
DR   EnsemblGenomes-Tr; EBT00001752370.
DR   EnsemblGenomes-Tr; EBT00001752371.
DR   EnsemblGenomes-Tr; EBT00001752372.
DR   EnsemblGenomes-Tr; EBT00001752373.
DR   EnsemblGenomes-Tr; EBT00001752374.
DR   EnsemblGenomes-Tr; EBT00001752375.
DR   EnsemblGenomes-Tr; EBT00001752376.
DR   EnsemblGenomes-Tr; EBT00001752377.
DR   EnsemblGenomes-Tr; EBT00001752378.
DR   EnsemblGenomes-Tr; EBT00001752379.
DR   EnsemblGenomes-Tr; EBT00001752380.
DR   EnsemblGenomes-Tr; EBT00001752381.
DR   EnsemblGenomes-Tr; EBT00001752382.
DR   EnsemblGenomes-Tr; EBT00001752383.
DR   EnsemblGenomes-Tr; EBT00001752384.
DR   EnsemblGenomes-Tr; EBT00001752385.
DR   EnsemblGenomes-Tr; EBT00001752386.
DR   EnsemblGenomes-Tr; EBT00001752387.
DR   EnsemblGenomes-Tr; EBT00001752388.
DR   EnsemblGenomes-Tr; EBT00001752389.
DR   EnsemblGenomes-Tr; EBT00001752390.
DR   EnsemblGenomes-Tr; EBT00001752391.
DR   EnsemblGenomes-Tr; EBT00001752392.
DR   EnsemblGenomes-Tr; EBT00001752393.
DR   EnsemblGenomes-Tr; EBT00001752394.
DR   EnsemblGenomes-Tr; EBT00001752395.
DR   EnsemblGenomes-Tr; EBT00001752396.
DR   EnsemblGenomes-Tr; EBT00001752397.
DR   EnsemblGenomes-Tr; EBT00001752398.
DR   EnsemblGenomes-Tr; EBT00001752399.
DR   EnsemblGenomes-Tr; EBT00001752400.
DR   EnsemblGenomes-Tr; EBT00001752401.
DR   EnsemblGenomes-Tr; EBT00001752402.
DR   EnsemblGenomes-Tr; EBT00001752403.
DR   EnsemblGenomes-Tr; EBT00001752404.
DR   EnsemblGenomes-Tr; EBT00001752405.
DR   EnsemblGenomes-Tr; EBT00001752406.
DR   EnsemblGenomes-Tr; EBT00001752407.
DR   EnsemblGenomes-Tr; EBT00001752408.
DR   EnsemblGenomes-Tr; EBT00001752409.
DR   EnsemblGenomes-Tr; EBT00001752410.
DR   EnsemblGenomes-Tr; EBT00001752411.
DR   EnsemblGenomes-Tr; EBT00001752412.
DR   EnsemblGenomes-Tr; EBT00001752413.
DR   EnsemblGenomes-Tr; EBT00001752414.
DR   EnsemblGenomes-Tr; EBT00001752415.
DR   EnsemblGenomes-Tr; EBT00001752416.
DR   EnsemblGenomes-Tr; EBT00001752417.
DR   EnsemblGenomes-Tr; EBT00001752418.
DR   EnsemblGenomes-Tr; EBT00001752419.
DR   EnsemblGenomes-Tr; EBT00001752420.
DR   EnsemblGenomes-Tr; EBT00001752421.
DR   EnsemblGenomes-Tr; EBT00001752422.
DR   EnsemblGenomes-Tr; EBT00001752423.
DR   EnsemblGenomes-Tr; EBT00001752424.
DR   EnsemblGenomes-Tr; EBT00001752425.
DR   EnsemblGenomes-Tr; EBT00001752426.
DR   EnsemblGenomes-Tr; EBT00001752427.
DR   EnsemblGenomes-Tr; EBT00001752428.
DR   EnsemblGenomes-Tr; EBT00001752429.
DR   EnsemblGenomes-Tr; EBT00001752430.
DR   EnsemblGenomes-Tr; EBT00001752431.
DR   EnsemblGenomes-Tr; EBT00001752432.
DR   EnsemblGenomes-Tr; EBT00001752433.
DR   EnsemblGenomes-Tr; EBT00001752434.
DR   EnsemblGenomes-Tr; EBT00001752435.
DR   EnsemblGenomes-Tr; EBT00001752436.
DR   EnsemblGenomes-Tr; EBT00001752437.
DR   EuropePMC; PMC135364; 12218019.
DR   EuropePMC; PMC2897462; 20453144.
DR   EuropePMC; PMC3084294; 21552483.
DR   EuropePMC; PMC3091532; 19646253.
DR   EuropePMC; PMC3133165; 21398532.
DR   EuropePMC; PMC3439454; 22984411.
DR   EuropePMC; PMC3568625; 23241979.
DR   EuropePMC; PMC3754576; 23749981.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4396059; 25887558.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC5288825; 27986718.
DR   EuropePMC; PMC555942; 15757509.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC6226153; 30412579.
DR   EuropePMC; PMC6286910; 30398651.
DR   EuropePMC; PMC6509523; 31072898.
DR   EuropePMC; PMC6629968.
DR   EuropePMC; PMC99098; 11752244.
DR   GOA; Q8U530.
DR   GOA; Q8UC06.
DR   InterPro; IPR003425; CCB3/YggT.
DR   InterPro; IPR006008; Intracell_sepatation_prot_A.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE007869.
DR   SILVA-SSU; AE007869.
DR   StrainInfo; 267471; 0.
DR   UniProtKB/Swiss-Prot; Q8U530; YR5A_AGRFC.
DR   UniProtKB/Swiss-Prot; Q8UC06; YCIB_AGRFC.
XX
CC   On or before Nov 5, 2007 this sequence version replaced
CC   gi:17922003, gi:16445345.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2841580
FT                   /organism="Agrobacterium fabrum str. C58"
FT                   /chromosome="circular"
FT                   /strain="C58"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:176299"
FT                   /culture_collection="ATCC:33970"
FT   gene            203..1024
FT                   /locus_tag="Atu0001"
FT                   /old_locus_tag="AGR_C_5142"
FT   CDS_pept        203..1024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0001"
FT                   /old_locus_tag="AGR_C_5142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85826"
FT                   /db_xref="GOA:Q8UJC7"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJC7"
FT                   /protein_id="AAK85826.1"
FT                   /translation="MENKKSFFHLHLISDSTGETLMSAGRAVSAQFHTSMPVEHVYPMI
FT                   RNQKQLAQVIDLIDKEPGIVLYTIVDQQLAEFLDLRCHAIGVPCVNVLEPIIGIFQTYL
FT                   GAPSRRRVGAQHALNADYFARIEALNFAMDHDDGQMPETYDDADVVIIGISRTSKTPTS
FT                   IYLANRGIKTANIPVVPNVPLPESLYAATRPLIVGLVATSDRISQVRENRDLGTTGGFD
FT                   GGRYTDRATIMEELKYARALCARNNWPLIDVTRRSIEETAAAILALRPRTR"
FT   gene            1056..1655
FT                   /gene="maf"
FT                   /locus_tag="Atu0002"
FT                   /old_locus_tag="AGR_C_2"
FT   CDS_pept        1056..1655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="Atu0002"
FT                   /old_locus_tag="AGR_C_2"
FT                   /product="putative inhibitor of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85827"
FT                   /db_xref="GOA:Q8UJC6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJC6"
FT                   /protein_id="AAK85827.2"
FT                   /translation="MKQELILASSSASRQMLMRNAGLTFSAIPADIDERALDEQLERDG
FT                   ASPEEVALELARAKALAVSALHPEALVLGCDQTMALGTRVYHKPKNMAEAATHLLSLSG
FT                   KVHRLNSAAVLVHNGKVVWQTVSSAELAVRTLSAEFVSRHLQRVGEKALSSVGAYQLER
FT                   EGIQLFTSIEGDYFTILGLPLLPLLSKLRDMDVIDG"
FT   gene            1648..2508
FT                   /gene="aroE"
FT                   /locus_tag="Atu0003"
FT                   /old_locus_tag="AGR_C_3"
FT   CDS_pept        1648..2508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="Atu0003"
FT                   /old_locus_tag="AGR_C_3"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85828"
FT                   /db_xref="GOA:Q8UJC5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJC5"
FT                   /protein_id="AAK85828.2"
FT                   /translation="MADSRETLTINAFVVGYPIKHSRSPIIHSYWLKKFGIAGSYTAVE
FT                   VSPDDFPKFIATLKEGKPGAAVGGNATIPHKEAAYRLADHPDALAEELGAANTIWMEEG
FT                   KLHATNTDGYGFVSNLDERHPGWDKTQRAVVFGAGGASRAVIQSLRDRDVAEIHVVNRT
FT                   VERARELADRFGPRVFSHPQAALQEVMHGAGLFVNTTSLGMNGTEAPHLDFSHLAANAV
FT                   VTDIVYVPLKTPILNMAQEQGIATVDGLGMLLHQAKPGFRRWFGRIPEVDETLRSLIIA
FT                   DMEKH"
FT   gene            2508..3089
FT                   /gene="coaE"
FT                   /locus_tag="Atu0004"
FT                   /old_locus_tag="AGR_C_5"
FT   CDS_pept        2508..3089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="Atu0004"
FT                   /old_locus_tag="AGR_C_5"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85829"
FT                   /db_xref="GOA:Q8UJC4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJC4"
FT                   /protein_id="AAK85829.2"
FT                   /translation="MIVIGLTGSIGMGKTTTAKLFAEEGVPVLDSDEVVHGLYRAEAVP
FT                   LIDAAFPGTTISGMVDRQKLGDVLRKNPANFNRLEEIVHPLVRNRQEAFLAKARIDDRA
FT                   FALLDIPLLFETGAEGRVDKVVVVSCAPEIQRERVLSRPGMTEEKFEMILARQMPDAEK
FT                   RQRADFVVDSGNGVEAARDQVKEILQKLGA"
FT   gene            3110..3808
FT                   /gene="dnaQ"
FT                   /locus_tag="Atu0005"
FT                   /old_locus_tag="AGR_C_7"
FT   CDS_pept        3110..3808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="Atu0005"
FT                   /old_locus_tag="AGR_C_7"
FT                   /product="DNA polymerase III, epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85830"
FT                   /db_xref="GOA:A9CKU0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKU0"
FT                   /protein_id="AAK85830.1"
FT                   /translation="MREIIFDTETTGLESKLDRVIEIGGIELINHFPTGRTLHLYISPE
FT                   DRKVHPDALAVHGITDEFLKDKPKFAEVIDQIREFFDGARWVAHNATFDMGFINAEFAR
FT                   LGIEPVSAELVTDTLSLARRKNPMGPNSLDALCRRYGIDNSHRTKHGALLDSELLAEVY
FT                   IEMIGGRQTALGFGSAARQETIIIEEDVPLAPLQRPSALPSRLDADTIAAHGKLVLGMG
FT                   DKAIWNRYQN"
FT   gene            complement(3907..4389)
FT                   /gene="secB"
FT                   /locus_tag="Atu0006"
FT                   /old_locus_tag="AGR_C_9"
FT   CDS_pept        complement(3907..4389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="Atu0006"
FT                   /old_locus_tag="AGR_C_9"
FT                   /product="protein-export protein SECB"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85831"
FT                   /db_xref="GOA:Q8UJC2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJC2"
FT                   /protein_id="AAK85831.1"
FT                   /translation="MTAENGAQGAVSPSLNILAQYIKDLSFENPGAPRSLQGRENAPAI
FT                   NINVNVNANPISGSDFDVVLTLNAEAKDGDKILFAAELVYGGVFRIAGFPQEHMLPVLF
FT                   IECPRLLFPFARQIIADVTRNGGFPPLMIDPIDFSQMFAQRVAEEQAKAQVQAVPN"
FT   gene            complement(4493..5029)
FT                   /gene="fxsA"
FT                   /locus_tag="Atu0007"
FT                   /old_locus_tag="AGR_C_11"
FT   CDS_pept        complement(4493..5029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="Atu0007"
FT                   /old_locus_tag="AGR_C_11"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85832"
FT                   /db_xref="GOA:A9CKT9"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT9"
FT                   /protein_id="AAK85832.1"
FT                   /translation="MRFSFLPIVILMMPILEIAGFIIVGKAIGLWLTLALILFTSFLGL
FT                   LILRLGGVGMVRNLQAAGRTGAQPADELVNGAMRVVAGILLIIPGFITDILGLLLLSPA
FT                   IRRFFWKAFGPRVVVSGSFRQSGPQQGDYSGFRNGPGPAGNSKVVDLDEEEFHREGSKD
FT                   SPWSNRPDDRDLPKP"
FT   gene            5215..5868
FT                   /locus_tag="Atu0008"
FT                   /old_locus_tag="AGR_C_12"
FT   CDS_pept        5215..5868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0008"
FT                   /old_locus_tag="AGR_C_12"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85833"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2D0"
FT                   /protein_id="AAK85833.2"
FT                   /translation="MLIFFQLRSVLGRRTGNEKPPFDPYSPRDVAKGPVADDNKVVTLP
FT                   KRGEAEEDNRFAEADALAPADTPLNASLRDVMTKDPSFRPKEFLNGARMAYEMIVMGFA
FT                   DGDRKTLKNLLSKEVFDGFEAAISERESRGEVVKSTFVGIEKADITQAGVRDSEVQVTL
FT                   RIVSQLISATYDKDGKLVDGDPEAVAEVDDIWTFSRDIRSRDPNWKLIATESEQ"
FT   gene            5865..6977
FT                   /gene="mltA"
FT                   /locus_tag="Atu0009"
FT                   /old_locus_tag="AGR_C_15"
FT   CDS_pept        5865..6977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="Atu0009"
FT                   /old_locus_tag="AGR_C_15"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85834"
FT                   /db_xref="GOA:A9CKT8"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="PDB:2PNW"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT8"
FT                   /protein_id="AAK85834.1"
FT                   /translation="MNTPFSIDEVSFRDLPGWGQDDPRKLFPAMATILSHLRNAKPYRT
FT                   GALGITAAELVSLLELAERGQVNSPEQARQFFETNSVPFRISPAQGKSGFVTAFYEPEL
FT                   EVSATPDDVWRYPIYRRPPELVDIDNDNRPDGFDPSYAFGKADEEGISYFPDRRAIDEG
FT                   CLRGRGLEIAWARSKVDLFFVHVQGAARLVFPDGAIKRITYAAKAGHVFSPIGRLLLDR
FT                   GELDPKTISMQTIRQWLADHPDEVDGVLWHNRSYIFFREADVAGLDMGPIAAAKVPLVA
FT                   GRALAVDRLIHTFGLPFFIHAPTLTHLDDGKPFARLMLALDTGSAIVGPARGDIFTGSG
FT                   FEAGELAGTVRNEADFYILLPRIAAERYRR"
FT   gene            6974..7543
FT                   /locus_tag="Atu0010"
FT                   /old_locus_tag="AGR_C_17"
FT   CDS_pept        6974..7543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0010"
FT                   /old_locus_tag="AGR_C_17"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85835"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT7"
FT                   /protein_id="AAK85835.1"
FT                   /translation="MKGSRKLGKEERILWGRVAKTTRPISGRLEDLLAFDDVEEHPLEP
FT                   SVPQTGKSAFPRMIVETAEALPASPDKKPKTHQPMEKPVKRKLTRGRLPLEGRIDLHGM
FT                   FQSEAHAVLLDFLLRAHERGLRHVLVITGKGRSIGSDGALKRAVPMWFAKPEYRYLISS
FT                   YEDASANHGGDGALYVRLSRRRGEKS"
FT   gene            7540..7905
FT                   /locus_tag="Atu0011"
FT                   /old_locus_tag="AGR_C_18"
FT   CDS_pept        7540..7905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0011"
FT                   /old_locus_tag="AGR_C_18"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85836"
FT                   /db_xref="GOA:A9CKT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT6"
FT                   /protein_id="AAK85836.1"
FT                   /translation="MTPFAEAVRQLRERKGVTQKEMAAAIGVSPAYLSALEHGKRGKPS
FT                   FDLLQRIAGYFNIIWDEAEELFFLAGSSDPKVVIDTVGLPPQYTAFANRLARDIRKLPP
FT                   SVVEELSAVLQKSRSCD"
FT   gene            8064..10499
FT                   /gene="gyrB"
FT                   /locus_tag="Atu0012"
FT                   /old_locus_tag="AGR_C_19"
FT   CDS_pept        8064..10499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Atu0012"
FT                   /old_locus_tag="AGR_C_19"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85837"
FT                   /db_xref="GOA:A9CKT5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT5"
FT                   /protein_id="AAK85837.2"
FT                   /translation="MTETSSSEVGANAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSG
FT                   LHHMVYEVVDNAIDEALAGHADLVTVTLNADGSVTVTDNGRGIPTDIHSSEGVSAAEVI
FT                   MTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLRIRRNGKLHEIGFTHGVADAP
FT                   LSVIGEYEGRSGTEVTFLASPQTFTMTDYDYGTLEHRLRELAFLNSGVRILLTDKRHSD
FT                   VKQQELLYDGGLEAFVRYLDRAKKPLVDKPIAIHSEKDGITVEVALWWNDSYHENVLCF
FT                   TNNIPQRDGGTHMAGFRAALTRQVTSYADTSGIMKREKVSLQGEDCREGLTAILSVKVP
FT                   DPKFSSQTKDKLVSSEVRPVVESLVNEALSTWLEEHPSEAKILIGKVVEAAVAREAARK
FT                   ARELTRRKGALDIASLPGKLADCSERDPAKSELFLVEGDSAGGSAKQGRSRETQAILPL
FT                   RGKILNVERARFDKMLSSQEIGTLITALGTSIGKDEFNADKLRYHKIIIMTDADVDGAH
FT                   IRTLLLTFFFRQMPELIERGHLYIAQPPLYKVTRGKSVQYLKDEKALEEYLISMGIEEA
FT                   SLTLGTGEVRVGADLREVILDALRMRSLIDGLHSRYSRSIVEQAAIAGALNPELSADAA
FT                   RAQETVAEVARRLDMIAEETERGWSGVVLEDGGLRFERMVRGVKEISTLDMGLLGSADA
FT                   RHIDQLVARTRDIYATPPVLQRKDGSMELAGPRALLDAIFAAGRKGLSMQRYKGLGEMN
FT                   AEQLWETTLDANVRSLLQVRVNDATDADGLFARLMGDEVEPRRDFIQENALNVANLDI"
FT   gene            complement(10604..11206)
FT                   /locus_tag="Atu0013"
FT                   /old_locus_tag="AGR_C_21"
FT   CDS_pept        complement(10604..11206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0013"
FT                   /old_locus_tag="AGR_C_21"
FT                   /product="NAD(P)H-flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85838"
FT                   /db_xref="GOA:A9CKT4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:2FRE"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT4"
FT                   /protein_id="AAK85838.1"
FT                   /translation="MTNSNNRQSEYPVDPLFLDRWSPRAFDGSPMPKEHLLTILDAAHW
FT                   APSASNHQPWRFVYAHKDSEDWPLFVELLMEGNQKWAKNASVLLFVISRDHTISHEGEK
FT                   KPSATHSFDAGAAWFSLAMQAHLLGYHAHGMGGIFKDRIVEKLDIPDGFKVEAGVAIGT
FT                   LTDKSILPDDLAEREVPSKRVPLADVAFEGRFTGKAD"
FT   gene            11335..12177
FT                   /gene="hpcE"
FT                   /locus_tag="Atu0014"
FT                   /old_locus_tag="AGR_C_22"
FT   CDS_pept        11335..12177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcE"
FT                   /locus_tag="Atu0014"
FT                   /old_locus_tag="AGR_C_22"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85839"
FT                   /db_xref="GOA:A9CKT3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT3"
FT                   /protein_id="AAK85839.1"
FT                   /translation="MKLMRVGQPGQEKPAILDAEGKVRDLSAHVKDIGGDAISPEGLKK
FT                   IAAIDLATLPVLSEERIGACVAGTGKFICIGLNFSDHAAETGATVPPEPVIFMKATSAI
FT                   VGPNDNVTIPRGSEKTDWEVELGVVIGKTAKYVSEADALDYVAGYCVSHDVSERAFQTE
FT                   RAGQWTKGKSCDTFGPIGPWLVTKDEITDPQNLGMWLKVNGQTMQDGSSKTMVYGVAHV
FT                   VSYLSQFMSLHPGDVISTGTPPGVGMGQKPPRYLKTGDVVELGIEGLGSQKQTFVADI"
FT   gene            12339..13535
FT                   /gene="depA"
FT                   /locus_tag="Atu0015"
FT                   /old_locus_tag="AGR_C_24"
FT   CDS_pept        12339..13535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="depA"
FT                   /locus_tag="Atu0015"
FT                   /old_locus_tag="AGR_C_24"
FT                   /product="intracellular PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85840"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT2"
FT                   /protein_id="AAK85840.2"
FT                   /translation="MAPLRAGADMMRQACNNPLNPLSSTAFGRSLDAGFEVFERLTRRY
FT                   VKPEFDLGSTSVDGQTVVVTDETVWSRPFCSLVHFNRDLEPTRKPDPKVLLVAPMSGHY
FT                   ATLLRGTVEALLPSADIYITDWADARIVPATEGTFDLDDYIDYVIEMLRHIGPGAHVVA
FT                   VCQPSVPVLAAVSLMEADGDTFAPASMTLMGGPIDTRINPTAVNGLATAKPIEWFRDNV
FT                   VMQVPWPQPAFGRYVYPGFLQLSGFMSMNLDKHMTAHKDFYLNLVKNDGDSAEKHREFY
FT                   DEYLAVMDLTAEFYLQTVETVFIDHALPKGNMLHRGRAVDPTAIHNVALFTVEGENDDI
FT                   SGVGQTKAAHDLCRNIPEDKRAHYMQPDVGHYGVFNGSRFRKEIVPRMLDFIGKHQMA"
FT   gene            13605..14372
FT                   /locus_tag="Atu0016"
FT                   /old_locus_tag="AGR_C_25"
FT   CDS_pept        13605..14372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0016"
FT                   /old_locus_tag="AGR_C_25"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85841"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKT1"
FT                   /protein_id="AAK85841.1"
FT                   /translation="MFSLLRKSLKSPAPKKVVPSQRTVSVAGRQVPITVRENPRATRIT
FT                   LRIEPGGRALKLTIPMGLHHRQVDDFLERHQGWLEGKLLKFSPDDGLRPGATIDIRGIS
FT                   HRIEHTGSLRGLTHIAKDADGVAVLKVSGAPEHLRRRIATFLKKEAKADLERLVAIHGR
FT                   AAGRPVRSISMKDTRSRWGSCSHDGNLSFSWRIVMAPDRVIDYLAAHEVAHLSEMNHGP
FT                   KFWALCEKLCPHTSEAKDWLKRHGSKLHAIDFD"
FT   gene            14475..15137
FT                   /gene="trpF"
FT                   /locus_tag="Atu0017"
FT                   /old_locus_tag="AGR_C_26"
FT   CDS_pept        14475..15137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="Atu0017"
FT                   /old_locus_tag="AGR_C_26"
FT                   /product="N-(5-phosphoribosyl) anthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85842"
FT                   /db_xref="GOA:Q8UJB1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJB1"
FT                   /protein_id="AAK85842.1"
FT                   /translation="MKPDIKICGLKTPETLERVVRRGASHVGFIFFEKSPRYIEPDLAG
FT                   RLAEAARGAAKVVAVTVDADNDYLDEIVDLVRPDILQLHGSESPERLLHIKALYGLPVM
FT                   KAISIRDAADLAKIEPYIGIADRFLLDAKAPAGSDLPGGNGVSFDWTILRSLDESVDYM
FT                   LSGGLNKDNVAEALAETRASGLDLSSGVESAPGVKDLSKIDAFFDVVNDWSKGPKGA"
FT   gene            15139..16359
FT                   /gene="trpB"
FT                   /locus_tag="Atu0018"
FT                   /old_locus_tag="AGR_C_28"
FT   CDS_pept        15139..16359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="Atu0018"
FT                   /old_locus_tag="AGR_C_28"
FT                   /product="tryptophan synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85843"
FT                   /db_xref="GOA:Q8UJB0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJB0"
FT                   /protein_id="AAK85843.2"
FT                   /translation="MNDAPTPNSFRAGPDEDGRFGIYGGRFVAETLMPLILDLQAEWDK
FT                   AKSDPEFQAELKYLGTHYTGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCL
FT                   GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVARQAPNVFRMKL
FT                   LGAEVKPVTAGHGTLKDAMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQAVIGE
FT                   EAKAQMLEAEGRLPDMIIAAVGGGSNAIGIFHPFLDDKNVRIVGVEAGGKGLSGEEHCA
FT                   SITAGSPGVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPEHSWLNDIGRVEYVPIM
FT                   DHEALDAFQMLTRLEGIIPALEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDVHTVS
FT                   KFLGMDV"
FT   gene            16364..17203
FT                   /gene="trpA"
FT                   /locus_tag="Atu0019"
FT                   /old_locus_tag="AGR_C_30"
FT   CDS_pept        16364..17203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="Atu0019"
FT                   /old_locus_tag="AGR_C_30"
FT                   /product="tryptophan synthase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85844"
FT                   /db_xref="GOA:Q8UJA9"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJA9"
FT                   /protein_id="AAK85844.2"
FT                   /translation="MTVRMDKRFADLRAENRPALITYFMGGDPDFQTSLGIMKALPEAG
FT                   ADVIELGMPFSDPMADGPAIQLAGQRALKGGQTLKTTLDLAREFRKQDNATPIVMMGYY
FT                   NPIYIYGVEKFLDDAIASGIDGLIVVDLPPEMDDELCIPALARGINFIRLATPTTDGKR
FT                   LPAVLKNTSGFVYYVSMNGITGSALPDPSLISGAVGRIKAHTELPVCVGFGVKTADHAK
FT                   AIGAVADGVVVGSAIVNQIAGSLTKDGQATADTVPAVTTLVKGLSTGVRASRLAAAE"
FT   gene            17231..18127
FT                   /gene="accD"
FT                   /locus_tag="Atu0020"
FT                   /old_locus_tag="AGR_C_32"
FT   CDS_pept        17231..18127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="Atu0020"
FT                   /old_locus_tag="AGR_C_32"
FT                   /product="acetyl-coenzyme A carboxyl transferase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85845"
FT                   /db_xref="GOA:A9CKT0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKT0"
FT                   /protein_id="AAK85845.1"
FT                   /translation="MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDN
FT                   KWVIPASGYHMKMPAKARLADLFDGGIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAK
FT                   TEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIAAGEAIVKAFERAISERCPLVMFP
FT                   ASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVTASYAMLGDVHIA
FT                   EPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIMT
FT                   KAPADNANAVVPLAASA"
FT   gene            18250..19593
FT                   /gene="folC"
FT                   /locus_tag="Atu0021"
FT                   /old_locus_tag="AGR_C_35"
FT   CDS_pept        18250..19593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Atu0021"
FT                   /old_locus_tag="AGR_C_35"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85846"
FT                   /db_xref="GOA:Q7D2C0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2C0"
FT                   /protein_id="AAK85846.1"
FT                   /translation="MTKPAIGEAEKIIEELMQLHPKGFDLSLDRISRLLEKLGNPQNRM
FT                   PPVIHVAGTNGKGSVSAFCRALLEAAGLPVHVHTKPHLVNWHERYRLGVAGERGRFVED
FT                   AVFADALRRIEVANDGQKITVFEILTAVMFLLFSEHPADAAIVEVGLGGRFDATNVINS
FT                   PAVSIIMPISLDHEAYLGDRVELIAAEKAGIMKKGSPVVIGHQEYDAARETLVATAERL
FT                   GCLVSVYGQDFSAHEEFGRMVYQDEFGLADAPLPRLPGRHQLANAAAAIRAVKAAGFEV
FT                   TERMIEKAMTSVEWPGRLQRILTGKIAEIAPKGAEIWIDGGHNPGAGEVIAEAMAGFEE
FT                   KTPRPLFIIAGMINTKDPVGYFKAFADIAEYVFTVPIGGTDAAIDPVVLAHAAFDAGLV
FT                   AAPTSTLTHALEELSRRVDPEGPPPRILIGGSLYLAGNALAFNGTVPQ"
FT   gene            complement(19641..19961)
FT                   /gene="trxA"
FT                   /locus_tag="Atu0022"
FT                   /old_locus_tag="AGR_C_37"
FT   CDS_pept        complement(19641..19961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="Atu0022"
FT                   /old_locus_tag="AGR_C_37"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85847"
FT                   /db_xref="GOA:Q7D2B9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2B9"
FT                   /protein_id="AAK85847.2"
FT                   /translation="MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIS
FT                   SELAGKVKVAKLNIDENPELAAQFGVRSIPTLAIFKGGEVADIKVGAAPKTALSAWISS
FT                   AA"
FT   gene            complement(20039..23596)
FT                   /gene="uvrD"
FT                   /locus_tag="Atu0023"
FT                   /old_locus_tag="AGR_C_39"
FT   CDS_pept        complement(20039..23596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="Atu0023"
FT                   /old_locus_tag="AGR_C_39"
FT                   /product="ATP-dependant DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85848"
FT                   /db_xref="GOA:Q7D2B8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2B8"
FT                   /protein_id="AAK85848.2"
FT                   /translation="MTIDPFDAGPAADTPESWIDWTSARQRLASDPASSAWVSANAGSG
FT                   KTHVLTQRVIRLLLAGCRPSAILCLTYTKAAASEMSSRVFDRLAEWATLPDSDLKDRIT
FT                   TIEGKVPDRIKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFSVLD
FT                   DRAATTLLAEARRSLLTAVSTEDDAELVQALAYVLDLADESGLEALLSAIIANRSALRS
FT                   FLHEAKQSGGLDVRLRQEMQIAAGETEETAAEAFWPLPGLSGLVLDTYLTLADEVGGSR
FT                   VIEVAYALREAKRQPDPVRRMELIEAALLTAKGEKKSDAYVINKGMQKSAPDLVDALTL
FT                   ARDHVVACRNRYRLVRMLVATKSALVLAERLIGDFEDLKKQRSQLDFEDLIERAANLLN
FT                   RDTAGAWVHYKLDQGIDHILVDEAQDTSPVQWSIIQSLAADFFNGESARMGRRTLFAVG
FT                   DEKQSIYSFQGARPERFSQERDETKRRVDQVEQAFHRIRLPLSFRSTEDVLAAVDQVFS
FT                   DPKNASGLSADNEPVEHRSNRAGHPGTVEVWDMVAPETTEDEEDWTAPFDALRESAPAT
FT                   IVARRIAARIADMIGNQTIIEKGVERAVEPGDILVLVRKRAAFVNALTRELKRRKNIPV
FT                   AGADRLRLTDHIAVQDLLALGRFVVLPEDDLSLAALLKSPLFNLTEDDVFEIAATRSEA
FT                   ESVWQRLQVLSGEETSRLSIVTDKLRHFISLSKTATVHDFFAAVLTLHDGRKKFLGRLG
FT                   NEASDVLDEFLSFALDHERTGLPGLQAFLSVLETDSPEVKREQDKDRGEVRIMTVHASK
FT                   GLEAPVVFVVDGGSKAFNHSHVPKLRFVEGDGDAFPVWLPGSGFSNHLIRSDEERLKTA
FT                   AEDEYRRLLYVAMTRAADHLVVCGYRGQKENPECWHAIVKAALAENQDHCQPQAFSADG
FT                   EEWQGLVWRKSEARPALAPHKPAEPQQEEDHTLPPGLLAPLPALPSLPRPLSPSGAGTI
FT                   IDDGADDLAVRSPLFGEKTEASSLALQRGKLVHRMLQALPDFAESEREEAARRYAERAA
FT                   RFWPATDRERLIQAVLRVLSEPAVQPAFSANSRAEVSIMGTMTLGRQHYAVSGRIDRLA
FT                   VERDRVILVDYKTNRVPPREARELPFSHVAQLAIYREILAPLYPGKEFVCALIYTESAA
FT                   FVRVDDDAMAEALAAIKTK"
FT   gene            complement(23586..26771)
FT                   /locus_tag="Atu0024"
FT                   /old_locus_tag="AGR_C_40"
FT   CDS_pept        complement(23586..26771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0024"
FT                   /old_locus_tag="AGR_C_40"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85849"
FT                   /db_xref="GOA:A9CKS9"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS9"
FT                   /protein_id="AAK85849.1"
FT                   /translation="MTLTHHAKRVLTIAAGTPFLKTLAETLCDGRLTAGYRYDPTDPLS
FT                   LASVTIYVPTRRSARVLRSEFVDLLGGRSAILPLIRPLGETDDDSGFFDIENPEIMDLA
FT                   PPISGTGRQIELARLILAWRNSLPDAIRAIHSDSPLVAPASPADAIWLARALGEVIDAM
FT                   DTEEKDWEALQHLDTGEHAQWWQLTADFLKIASVFWPARLAELNRSSAGRHRNAILRAE
FT                   ADRLANLPDTGPIIVAGSTGSIPAAADLIAAVAALPQGTVVLPGLDLAMPEEQWQAIIE
FT                   DPTDPSSRTHPQYGLYMLLQKLGMSRDEVVQIGALDRDLEKRAAVFSAALAPAKSTSDW
FT                   NGWREGRDPGFFDEAFAAATLIEAANQREEATAIAVALRLALEAPGPGRPSQAALITPD
FT                   RGLARRVATELQRFGIEADDSAGTPLSATPQAGLTQLALEAILRPGDPVPIISLLKHPL
FT                   ARFGLSGDAFTKASKALELIALRGGRVETEIGNLEVVLDAQLLAQRDNRHPPAWRVALP
FT                   EGSVDAARDLARRIAIATEPLGSAFIRRDRSGRAFTDKLPLSDWAGRTGRVIEAICADD
FT                   SNDLAALWSGEAGDKLSSLFAELMESGDILDADGPQWIDIFAALVAGESIKPRSMRHPR
FT                   IFIFGALEARLQSVDTVVIGGLNEGLWPGQTANNPFLSRSMKTAIGLEPPERRIGQLAH
FT                   DFEMANGTRQIFYTRALRQGSTPAVASRWLQRLLALGGENFAEQLRKRGETYRHWAGLM
FT                   DESIDQETAKRPAPKPPADLQPKSYSFSEVGRLRRDPYAIYARRILKLDPLDPFNRDPN
FT                   AADRGTLYHGIIERYSREGHIPGTPASLEAMQRILDDCFDAENLPVHVDVIWRPRFAAV
FT                   ARAFIDWEKERHPSIRRSFFEARAGQEIAEAGIRLTGVADRIDIKTSGQADIIDYKTGL
FT                   APSVNQARALLDPQLALEAAALMRGAFRETGSPTPENLIYVRLRPGDRFFADQVNNEHS
FT                   NRSGKRPPKSAIELATESIDQLAKFVRSLRDGENGFASRLVPEEQQSYGGEYDHLARVS
FT                   EWSTAEPGDGDDD"
FT   gene            complement(26768..27505)
FT                   /locus_tag="Atu0025"
FT                   /old_locus_tag="AGR_C_42"
FT   CDS_pept        complement(26768..27505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0025"
FT                   /old_locus_tag="AGR_C_42"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85850"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS8"
FT                   /protein_id="AAK85850.2"
FT                   /translation="MTIKNAMVLAAGLGTRMRPITDTIPKPLVKIAGKPMIDYALDALV
FT                   EAGAETIVVNVHHHAEQMISHLGHRTDAEILISDERTQLMNSGGGLAKGLKLLKPGPVF
FT                   VMNADLFWIGERLNAVSNLRKLAQFLDPARMDMALLCVDMDRTTGHNGKRDFNLAGEGK
FT                   LTRYRDGDANPVVYAGAIAMDSRLLDDAPADAFNLNIYFDRAIEKDRLFGLSLDGHWIT
FT                   VGTPDAIDDAESIIRQFREKRFA"
FT   gene            complement(27520..29031)
FT                   /locus_tag="Atu0026"
FT                   /old_locus_tag="AGR_C_43"
FT   CDS_pept        complement(27520..29031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0026"
FT                   /old_locus_tag="AGR_C_43"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85851"
FT                   /db_xref="GOA:A9CKS7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS7"
FT                   /protein_id="AAK85851.1"
FT                   /translation="MSEDILPITISLAGEKDTIRLGEDLALALKPGDCLTLIGDLGAGK
FT                   STLARAFIRAMADEPDLEVPSPTFTIIQTYTTRIPVAHLDLYRLSDVSELDELGIDEML
FT                   EDGICLIEWPDIAAEVLPPAQTITLQLTHSGEGRVAVIEAPAQQKARLDRVFAIREFLA
FT                   KNGRGDATRRFLSGDASTRAYETISTDGPDLILMDWRRPMRGAIVADGKTYAEIVHLAQ
FT                   DARSFVAIGDYLRNSGFRAPEILAADIDQGILLLEDLGREGVLAADGTPIEERYLQSVA
FT                   CLATLHQTPRPALLPMRDGSTYDIPSFDRQAMKIEVSLLVEWYLPHKRGKALTDGEKQD
FT                   YYAIWDGLIDALAGCETGLLLRDFHSPNILWQAQNSGIGQVGLIDFQDAMIGPTAYDLA
FT                   SIVQDARVTIPPELQTRLMSHYLNSRKATPAFDEAAFLKAFAIMSAQRNCKLAGIWVRL
FT                   LERDKKPGYMKHMPRTFRYLADALSHPELAPLREWCVRMGMDFND"
FT   gene            complement(29028..31673)
FT                   /locus_tag="Atu0027"
FT                   /old_locus_tag="AGR_C_44"
FT   CDS_pept        complement(29028..31673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0027"
FT                   /old_locus_tag="AGR_C_44"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85852"
FT                   /db_xref="GOA:A9CKS6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS6"
FT                   /protein_id="AAK85852.1"
FT                   /translation="MTVHNSDLREQTVQRVENTHASVASSTRALERFCVFPDGKPAPTF
FT                   SGNALARCRLAIRAIRTGFSRARILLSGTVLTGSSTVAMAQDGLVAKTSARLFSSGETI
FT                   TYSLFVGMLSATLFSVVWLVRQRGNIEAESSEYRQALAQSHHKIAKYEALISDKSRRIV
FT                   IWDGVDKRPEFLGQLPAETGVPQADQDFLAFGRWLKPASAGQLEKSIEKLRSHAQSFDL
FT                   TIETQRGEVIEVQGRVSGGNAFARFIALNNLRAELAELQVERERLLASVSTFQELLDSI
FT                   EQPVWRRNGEGELTWVNHAYAHAVDARNAEQAVQEKRELLNTVTRQKIRAAATPESPYH
FT                   DRISTVVSGNRSFFDVVDIKTAGGSAGIAIDATEAETIREELKRVLKSHAETLDHLATP
FT                   VAIFDGRQRLQFYNQAFASLWGFDLVLLESGPDNSELLDRLRSAGKLPEQLNWKNWKET
FT                   ALSVYRSLDTKTDLWHLPNGQTLRVIATAHPQGGATWVFENLTEQVDLQMRYNTLVKVQ
FT                   GETIDHLAEGVAVFGADGRIRLSNPAFRALWGVTADEAETGTHIRAIETACAQSYDGPD
FT                   GWRAFSQFITSFDDERPSRQGTLELLSGLVLDYAIIPLPDAQTMLTFVNMTDSVRAERA
FT                   LKEKNDALLKADELKNDFVQHVSYELRSPLTNIIGFTDLLKTPGIGQLTERQAEYLDHI
FT                   STSSSVLLTIVNDILDLATVDAGIMQLNYSDNDLNELLDDVSVQIADRLQESGISLEIV
FT                   APAHLGSLVADHQRLKQILIKLLTNAINFAPEGSSVQLSCQRSEGDFVFSVADKGPGIP
FT                   EDMLKSVFDRFATRGNGGRRTGAGLGLSIVESFVSLHHGTVSIDSRPGNGTIVTCRIPS
FT                   ATLPHSIAAE"
FT   gene            complement(31670..31837)
FT                   /locus_tag="Atu0028"
FT   CDS_pept        complement(31670..31837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UJA0"
FT                   /protein_id="AAL41059.2"
FT                   /translation="MRLTKRAASFLRAPFPQIYEDGIVIGLDSDTPKGGVDEMGCLVED
FT                   AAHRTETDRG"
FT   gene            complement(31882..33282)
FT                   /gene="ahcY"
FT                   /locus_tag="Atu0029"
FT                   /old_locus_tag="AGR_C_46"
FT   CDS_pept        complement(31882..33282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="Atu0029"
FT                   /old_locus_tag="AGR_C_46"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85853"
FT                   /db_xref="GOA:Q8UJ99"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ99"
FT                   /protein_id="AAK85853.1"
FT                   /translation="MSLEKDYIVADINLAAFGRKELDIAETEMPGLMSCRKEFGESKPL
FT                   KGARITGSLHMTIQTGVLIETLKELGAEIRWASCNIFSTQDHAAAAIAAAGIPVFAVKG
FT                   ESLTEYWEYTDKIFQWTDGGLSNMILDDGGDATMYILLGARAEAGEDVLSNPGSEEEEI
FT                   LFAQINKRLKASPGWFTKQRDALKGVTEETTTGVHRLYDLAKKGLLPFPAINVNDSVTK
FT                   SKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLQGAGARVKVTEID
FT                   PICALQAAMDGFEVVRLEDVVSSADIFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDN
FT                   EIQVASLRNLKWTNIKPQVDMIEFPKGNRIILLSEGRLLNLGNATGHPSFVMSASFTNQ
FT                   VLGQIELFTKPGEYKNEVYVLPKHLDEKVARLHLEKLGVRLTELSDLQADYIGISKQGP
FT                   FKAEHYRY"
FT   gene            complement(33411..33686)
FT                   /gene="ptsH"
FT                   /locus_tag="Atu0030"
FT                   /old_locus_tag="AGR_C_49"
FT   CDS_pept        complement(33411..33686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="Atu0030"
FT                   /old_locus_tag="AGR_C_49"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85854"
FT                   /db_xref="GOA:A9CKS5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS5"
FT                   /protein_id="AAK85854.1"
FT                   /translation="MSPLSRELPIINKRGLHARASAKFVQMVEGFDATITVSKDGMTVG
FT                   GTSIMGLMMLAASPGCSVYVEASGNQAVEALAALEALVANRFGEEA"
FT   gene            complement(33698..34099)
FT                   /locus_tag="Atu0031"
FT                   /old_locus_tag="AGR_C_50"
FT   CDS_pept        complement(33698..34099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0031"
FT                   /old_locus_tag="AGR_C_50"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85855"
FT                   /db_xref="GOA:A9CKS4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS4"
FT                   /protein_id="AAK85855.1"
FT                   /translation="MIGLVLVTHGKLAEEFRHALEHVVGPQKLIETVCIGPEDDMDQRR
FT                   QDIIDAVARANDGNGVIILTDMFGGTPSNLAISVMNNGNVEVIAGVNLPMLIKLAGVRS
FT                   EDNMDKALQDASDAGRKYINVASRVLSGK"
FT   gene            complement(34225..34689)
FT                   /locus_tag="Atu0032"
FT                   /old_locus_tag="AGR_C_51"
FT   CDS_pept        complement(34225..34689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0032"
FT                   /old_locus_tag="AGR_C_51"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85856"
FT                   /db_xref="GOA:A9CKS3"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS3"
FT                   /protein_id="AAK85856.1"
FT                   /translation="MNAERFNLHATAIVVDGTGILFTGPSGSGKSELAFSFLTEAERCG
FT                   LPAALIADDQIFVYRDGETIIAERPEAIAGLLELRGSGIVSVKSVPSGVLHFAVTTVLS
FT                   PENPRLPEDDEALLMPCGGHLRLLRIPLSSLVPYGKFAALAQNLFKTNVK"
FT   gene            complement(34679..36469)
FT                   /gene="chvG"
FT                   /locus_tag="Atu0033"
FT                   /old_locus_tag="AGR_C_52"
FT   CDS_pept        complement(34679..36469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvG"
FT                   /locus_tag="Atu0033"
FT                   /old_locus_tag="AGR_C_52"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85857"
FT                   /db_xref="GOA:Q07737"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07737"
FT                   /protein_id="AAK85857.1"
FT                   /translation="MLKKTPETVSDSDDAEERGSERRHRIHPLTIIRRIFGNAVFSSLT
FT                   RRILFFNVAATVVLVGGILYLNQFREGLIDARVESLLTQGEIIAGAVSASASVDTNSIT
FT                   INPEKLLELQAGQSITPAPNDEDLSFPINPERVAPVLRRLISPTRTRARLFDADANLLL
FT                   DSRHLYSRGQVLRFDLPPVTPETQTWGDWFTSMFNRMLQPSSLPQYKEAPGGDGSIYPE
FT                   VMNALTGVRGAVVRVTEKGELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHAERLAI
FT                   MRVFGIATLVNIVLSLLLSSTIATPLRRLSAAAIRVRRGARTREEIPDFSARQDEIGNL
FT                   SIALREMTTALYDRIDAIESFAADVSHELKNPLTSLRSAVETLPRAKTEESKQRLTEII
FT                   FHDVRRLDRLISDISDASRLDAELARADASPLDLDVLMKGLVDISRQISTKKKSVAIDY
FT                   VADRKAGAKTSFVVNGHDLRIGQIVTNLIENARSFVSEESGRITVRLSRHKDRCIVQVE
FT                   DNGPGIQAEDIDRIFERFYTDRPASEGFGQNSGLGLSISRQIAEAHGGSLRAENVVDKY
FT                   GVISGARFTLSLPAAETHER"
FT   gene            complement(36525..37250)
FT                   /gene="chvI"
FT                   /locus_tag="Atu0034"
FT                   /old_locus_tag="AGR_C_54"
FT   CDS_pept        complement(36525..37250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvI"
FT                   /locus_tag="Atu0034"
FT                   /old_locus_tag="AGR_C_54"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85858"
FT                   /db_xref="GOA:Q7D2B0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2B0"
FT                   /protein_id="AAK85858.2"
FT                   /translation="MQTIALVDDDRNILTSVSIALEAEGYRVETYTDGASALDGLIARP
FT                   PQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDFITKPFS
FT                   QRLLVERVKAILRRASSREASAATGGTLKPTADQQARTLERGQLAMDQERHTCTWKGEP
FT                   VTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKLVDG
FT                   DFDMIETLYGVGYRFREAA"
FT   gene            37589..39199
FT                   /gene="pckA"
FT                   /locus_tag="Atu0035"
FT                   /old_locus_tag="AGR_C_56"
FT   CDS_pept        37589..39199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="Atu0035"
FT                   /old_locus_tag="AGR_C_56"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85859"
FT                   /db_xref="GOA:Q8UJ94"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ94"
FT                   /protein_id="AAK85859.2"
FT                   /translation="MNELGVHNPANGVAELGLGEASRVFYNLNESELYEHAIRNGEAEL
FT                   TIDGALRAVTGQHTGRSPKDKFVVRDASTENTIWWDNNKPLSPENFELLRQDMLAHAAG
FT                   KTLYVQDLIGGADEENALPTRVVTELAWHSLFIRNLLIRPKRETLSGFSQKLTIINLPS
FT                   FKADPARHGVRSETVIACDLTNGLVLIGGTSYAGENKKSVFTVLNYLLPAKGVMPMHCS
FT                   ANVGPEGDSAVFFGLSGTGKTTLSADPARTLIGDDEHGWGEHGIFNFEGGCYAKAIKLS
FT                   SEAEPEIYAATNRFGTVLENVVLDESRVPDFNDNSLTENTRSAYPLHFIPNASETGIAG
FT                   HPKTIIMLTADAFGVLPPIARLTPEQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGA
FT                   PFMPRHPAEYGNLLRELIGKHGVDCWLVNTGWTGGAYGIGKRMPIKATRALLTAALTGD
FT                   LKNAQFRTDANFGFAVPLSLDGVDGAILDPRSTWADGAAYDAQAKKLVSMFVSNFTKFE
FT                   DHVDSKVRDAAPGLLLAAE"
FT   gene            39327..39761
FT                   /locus_tag="Atu0036"
FT                   /old_locus_tag="AGR_C_57"
FT   CDS_pept        39327..39761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0036"
FT                   /old_locus_tag="AGR_C_57"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85860"
FT                   /db_xref="GOA:Q7D2A9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2A9"
FT                   /protein_id="AAK85860.2"
FT                   /translation="MASDPLYISNRITIAGWELTEQFVLAGGPGGQNVNKVSTAVQLFF
FT                   DIANSPSLSDRVKANAVRLGGRRVSKEGVLMIEASRFRSQERNREDARERLKELILEAA
FT                   APPPPVRKATKPTKGSVERRLKAKSGRSDIKKMRGKPSGD"
FT   gene            complement(39781..40749)
FT                   /gene="panK"
FT                   /locus_tag="Atu0037"
FT                   /old_locus_tag="AGR_C_59"
FT   CDS_pept        complement(39781..40749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panK"
FT                   /locus_tag="Atu0037"
FT                   /old_locus_tag="AGR_C_59"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85861"
FT                   /db_xref="GOA:Q8UJ92"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ92"
FT                   /protein_id="AAK85861.2"
FT                   /translation="MPGTLDHFRADEYSPYHFFSSEEWAKFRADTPLTLSADEVKRLRS
FT                   LDDPIDLDEVRRIYLSLSRLLSSHVEASQLLFEQRNRFLNMGDVNKTPFVIGIAGSVAV
FT                   GKSTTARILKELLARWPSSPKVDLITTDGFLYPNEVLRRENLMERKGFPESYDIGALLR
FT                   FLSAIKAGQPNVKAPRYSHLTYDVLPNEFTVIDQPDILIFEGINVLQSRDLPAGGRIVP
FT                   IVSDFFDFSIYIDADEDFIHNWYVNRFMNLRQTAFRDPNSFFNRYASISEEAALSIAEG
FT                   LWQNINLKNLRQNIVPTRPRADLILRKGENHLIDTVALRKL"
FT   gene            complement(40779..41102)
FT                   /gene="hisE"
FT                   /locus_tag="Atu0038"
FT                   /old_locus_tag="AGR_C_60"
FT   CDS_pept        complement(40779..41102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="Atu0038"
FT                   /old_locus_tag="AGR_C_60"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85862"
FT                   /db_xref="GOA:Q8UJ91"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ91"
FT                   /protein_id="AAK85862.2"
FT                   /translation="MSAFSLSDLERIVAKRAAASPDESWTAKLVAAGQERAAKKLGEEA
FT                   VEAVIAAIAQDRDGLKNEAADLLYHLLVVLKIADIPLSDVFAELERRTGQTGLAEKAAR
FT                   PTP"
FT   gene            complement(41118..41894)
FT                   /gene="hisF"
FT                   /locus_tag="Atu0039"
FT                   /old_locus_tag="AGR_C_62"
FT   CDS_pept        complement(41118..41894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="Atu0039"
FT                   /old_locus_tag="AGR_C_62"
FT                   /product="imidazoleglycerol-phosphate synthase cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85863"
FT                   /db_xref="GOA:P58799"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58799"
FT                   /protein_id="AAK85863.1"
FT                   /translation="MTLKARIIPCLDVKDGRVVKGVNFVDLIDAGDPVEAAKAYDAAGA
FT                   DELCFLDITASSDNRDTIFDVVSRTADHCFMPVTVGGGVRSVADIRKLLLCGADKVSIN
FT                   SAAVKDPDFVAQAADKFGNQCIVVSIDAKRVSKDGEADRWEIFTHGGRQPTGIDAVEFA
FT                   IKMVERGAGELLVTSMDRDGTKSGYDIGLTRSIADQVRVPVIASGGVGTLDDLVAGVRD
FT                   GHATAVLAASIFHFGTYSIGEAKSYMAEHGIAMRLD"
FT   gene            complement(41891..42634)
FT                   /gene="hisA"
FT                   /locus_tag="Atu0040"
FT                   /old_locus_tag="AGR_C_63"
FT   CDS_pept        complement(41891..42634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="Atu0040"
FT                   /old_locus_tag="AGR_C_63"
FT                   /product="phosphoribosylformino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85864"
FT                   /db_xref="GOA:P58790"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58790"
FT                   /protein_id="AAK85864.1"
FT                   /translation="MILFPAIDLKDGECVRLKLGDMEQATVYNEDPGAQAKAFEDQGFE
FT                   WLHVVDLNGAFAGETVNGAAVDAILKSTKNPVQLGGGIRTLDHIEAWLSRGLARVILGT
FT                   VAVRDPVLVIEACKRFPGQVAVGIDAKGGKVAVEGWAEASELGIIELAKRFEGAGVAAI
FT                   IYTDIDRDGILAGINWASTLELADAVSIPVIASGGLASIDDIKRMLQPDAAKLEGAISG
FT                   RALYDGRIDPTEALDLIKAAKEVRA"
FT   gene            complement(42636..43286)
FT                   /gene="hisH"
FT                   /locus_tag="Atu0041"
FT                   /old_locus_tag="AGR_C_64"
FT   CDS_pept        complement(42636..43286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="Atu0041"
FT                   /old_locus_tag="AGR_C_64"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85865"
FT                   /db_xref="GOA:P58788"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58788"
FT                   /protein_id="AAK85865.2"
FT                   /translation="MRVAIIDYGSGNLRSATKAFERAAREAGIDATIDLTDKPDHVASA
FT                   DRIVLPGVGAYADCSAGLNAMPGMHEALIEAVEKKAHPFLGICVGMQLMSSRGLEKTVS
FT                   TGLGWIEGDVVEMTPSDPTLKIPQIGWNTLEIRHAHPLFDGIKTGADGLHAYFVHSYHL
FT                   AAKHSTDVIATTNYGGAMTAFVGRDNMAGAQFHPEKSQTLGLALISNFLRWKP"
FT   gene            complement(43288..43782)
FT                   /locus_tag="Atu8115"
FT                   /old_locus_tag="AGR_C_67"
FT   CDS_pept        complement(43288..43782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8115"
FT                   /old_locus_tag="AGR_C_67"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8115"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85866"
FT                   /db_xref="GOA:Q8U5P8"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5P8"
FT                   /protein_id="AAK85866.1"
FT                   /translation="MTSYLVLEAPNGPDRDHKTTRFIADRFVWLALIAPWLWLAVNRLW
FT                   LTTAVVVIATLVAGQISMLAGFEPVGILLGFAIGLITALEGRDFLVRHLIRKGWTLTSV
FT                   ISAPDLSSAEDIYFSSLSENADKAEQLSRPVWTTSAQKSGGKNFVDDPAGSFLFDLNGR
FT                   R"
FT   gene            complement(43805..44401)
FT                   /gene="hisB"
FT                   /locus_tag="Atu0043"
FT                   /old_locus_tag="AGR_C_69"
FT   CDS_pept        complement(43805..44401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="Atu0043"
FT                   /old_locus_tag="AGR_C_69"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85867"
FT                   /db_xref="GOA:Q8UJ89"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ89"
FT                   /protein_id="AAK85867.2"
FT                   /translation="MAERKGEIIRKTNETSVSVRVDIDGTGKSKISTGVGFFDHMLDQL
FT                   SRHSLIDMDIEVQGDLHIDDHHTVEDTGIAIGQAIAKALGDRRGITRYASLDLAMDETM
FT                   TKAAVDISGRPFLVWNVNFSAPKIGTFDTELVREFFQALAQNAGITLHILNHYGANNHH
FT                   IAETCFKAVARVLRTATEIDPRQAGRVPSTKGMLA"
FT   gene            44644..45126
FT                   /gene="hslV"
FT                   /locus_tag="Atu0044"
FT                   /old_locus_tag="AGR_C_70"
FT   CDS_pept        44644..45126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="Atu0044"
FT                   /old_locus_tag="AGR_C_70"
FT                   /product="heat shock protein hslV"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85868"
FT                   /db_xref="GOA:Q8UJ88"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ88"
FT                   /protein_id="AAK85868.2"
FT                   /translation="MAGDGQVSLGQTVMKGNARKVRRIGKGEVIAGFAGATADAFTLLD
FT                   RLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKSTTLAITGNGDVLEPEH
FT                   GAIAIGSGGNYAFAAARAMMDTDKSAEEVARQSLDIAADICVYTNHNLVVETLDAE"
FT   gene            45214..46521
FT                   /gene="hslU"
FT                   /locus_tag="Atu0045"
FT                   /old_locus_tag="AGR_C_72"
FT   CDS_pept        45214..46521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="Atu0045"
FT                   /old_locus_tag="AGR_C_72"
FT                   /product="heat shock chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85869"
FT                   /db_xref="GOA:Q8UJ87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ87"
FT                   /protein_id="AAK85869.1"
FT                   /translation="MTTFSPREIVSELDRHIIGQHDAKRAVAIALRNRWRRQQLDESLR
FT                   DEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EIGIGLVREKKRAEVQAKAHQSAEERVLDALVGSTASPGTRESFRKKLRDGELDDKEID
FT                   IEVADSGSGMPGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVSKSYTDLVRDES
FT                   DKLLDNEMIQREAVKSVENDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPLVEGTT
FT                   VSTKYGPVKTDHVLFIASGAFHVAKPSDLLPELQGRLPIRVELKPLTKEDFRRILTETE
FT                   ASLIRQYKALMATEELDLDFTDDAIDALADVAVHLNSSVENIGARRLQTVMERVLDEIS
FT                   FNAPDRGGSAVKIDQEYVKKHVGDLAADTDLSRYIL"
FT   gene            46716..47681
FT                   /locus_tag="Atu0046"
FT                   /old_locus_tag="AGR_C_75"
FT   CDS_pept        46716..47681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0046"
FT                   /old_locus_tag="AGR_C_75"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85870"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS2"
FT                   /protein_id="AAK85870.1"
FT                   /translation="MRKILLAFVVALAVSAVSSSYAEAATVVPPGNRNAEQPGVPGASA
FT                   RRTKASNSSFERKYQKVIDLLSSDKALIAKIKSTAGRYGIDPIHMVGAIVGEHTYNVDA
FT                   YDRLQSYYVKAASYAGSSFRFGYKDETIAQFLTHAQFSKCQAKKDSYSLWNCREDVWDD
FT                   SFRGKTVDGVAYPNNRFSAVFFQPFYAGQTFGLGQINPLTALMLSDMVSRTSGYEKLDE
FT                   NDATAVYTAIMDPDRSLAFMAASIRKSIDDYRSIADMDISKNPGVTSTLYNVGGSQQRA
FT                   AALAQKNRQRAGGGEQPLLPEENYYGWLVNDRIKDLQALL"
FT   gene            47736..49970
FT                   /gene="glcB"
FT                   /locus_tag="Atu0047"
FT                   /old_locus_tag="AGR_C_78"
FT   CDS_pept        47736..49970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="Atu0047"
FT                   /old_locus_tag="AGR_C_78"
FT                   /product="malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85871"
FT                   /db_xref="GOA:Q8UJ85"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ85"
FT                   /protein_id="AAK85871.1"
FT                   /translation="MPRLTSDRLSVQSMPSEYKEAHVSRTDKFGLSIDDRLYAFLTDEV
FT                   LPGTGLDSETFFEGFSAIVHELSPKNRELLAKRDALQEKIDGWYRENGAPSDFDAYEAF
FT                   LKEIGYLLPEGPGFKVETNNVDPEIAVVAGPQLVVPVMNARYALNAANARWGSLYDALY
FT                   GTDAISDADGAEKGRGYNPKRGDKVIAWARNFLDESAPLETGSWSDVTGFNIADGLLQL
FT                   AIGAATTGLKDAVQFKGFSGEAAKPATILLGKNGLHTEIVIDPSTEIGKSDRAGISDVI
FT                   LESALTTIMDCEDSVAAVDAEDKVLVYGNWLGLMRGDLTEAVSKGGNTFTRRLNPDRYY
FT                   TAPDGSALTLPGRSLMLVRNVGHLMTNPAILDRDGRDVPEGIMDAVVTALIALYDVGPS
FT                   GRRQNSRAGSMYVVKPKMHGPEEVAFANEIFARVENLVGMAPNTMKMGIMDEERRTTVN
FT                   LKESIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWIAAYENWNVDIG
FT                   LECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVD
FT                   VAAVQEGLKSRGRAKLSDILSVPVAPRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVG
FT                   CSKVPDINNIGLMEDRATLRISAQHMANWLRHGVVTEAQIIKTMKRMAAVVDTQNAGDP
FT                   AYLPMASDFDGSVAFQAAVELVLKGREQPNGYTEPVLHRRRLELKAKQAG"
FT   gene            complement(50151..50864)
FT                   /locus_tag="Atu0048"
FT                   /old_locus_tag="AGR_C_80"
FT   CDS_pept        complement(50151..50864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0048"
FT                   /old_locus_tag="AGR_C_80"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85872"
FT                   /db_xref="GOA:A9CKS1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS1"
FT                   /protein_id="AAK85872.2"
FT                   /translation="MRIRTPLTLLGLTAALALAGCAETTSQSSAPTSGKIAASVPVADP
FT                   VPAKVETVQIFNDVYGPVTDAGYALPAIPINRVNEKYRRQIVEFQTSERPGTIIVNTRD
FT                   RYLYYIMSGNRAVRYGIGVGKAGFAWAGEAYVAWKQEWPMWHPPKEMADRKPEVAKYVE
FT                   AGMGPGLSNPLGARAMYLFNEKGQDTLFRIHGSPEWASIGTAASSGCIRMINQDVIDLY
FT                   SRVRPGRSTKVVVIQ"
FT   gene            51048..51533
FT                   /locus_tag="Atu0049"
FT                   /old_locus_tag="AGR_C_81"
FT   CDS_pept        51048..51533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0049"
FT                   /old_locus_tag="AGR_C_81"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85873"
FT                   /db_xref="GOA:Q7D2A6"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2A6"
FT                   /protein_id="AAK85873.2"
FT                   /translation="MTILSFTNNNPLIDGRQSDKAMLVRRGVQVLLHEMRHSVLPELPL
FT                   ASGRRADLISLSAKGEIWIIEIKSSIEDFRVDRKWPDYRLHCDRLFFATHPEVPTDIFP
FT                   EECGLILSDGYGAHMLRDAPEHKLPPATRKSVMLDFSRTAATRLMLAEWTTGRSFGE"
FT   gene            complement(51594..52181)
FT                   /gene="actR"
FT                   /locus_tag="Atu0050"
FT                   /old_locus_tag="AGR_C_82"
FT   CDS_pept        complement(51594..52181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actR"
FT                   /locus_tag="Atu0050"
FT                   /old_locus_tag="AGR_C_82"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85874"
FT                   /db_xref="GOA:A9CKS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKS0"
FT                   /protein_id="AAK85874.1"
FT                   /translation="MKIEDQTPATSEPVDDIDPIGPDRSLLIVDDDGPFLRRLARAMET
FT                   RGFAVDTAETVSEGIARSKAAPPKYAVVDLRLADGNGLEVIEAIRQNRDDTQIVVLTGY
FT                   GNIATAVTAVKLGALDYLAKPADADDVFNALTQRKGEKTEVPENPMSADRVRWEHIQRV
FT                   YEMCERNVSETARRLNMHRRTLQRILAKRAPK"
FT   gene            complement(52255..53562)
FT                   /gene="actS"
FT                   /locus_tag="Atu0051"
FT                   /old_locus_tag="AGR_C_85"
FT   CDS_pept        complement(52255..53562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actS"
FT                   /locus_tag="Atu0051"
FT                   /old_locus_tag="AGR_C_85"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85875"
FT                   /db_xref="GOA:Q7D2A4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2A4"
FT                   /protein_id="AAK85875.2"
FT                   /translation="MAGHPIETTRLGRASRRIRLQTIIWLRWLAVAGQTATILFVAFAL
FT                   NFPLPLLACGLLIAALALANLFLTARFPSTYRLEPWEATLLLAFDLLQLTALIYITGGL
FT                   SNPFAPLICVQVIIAFASQPLKHSLILLGFAVICSTAIAFSPFPVPWYPDEVLPIQLLL
FT                   HVGTWVAIIATTSFAAFYAYRVSHEANQLADALAATELVLEREKHLSQLDGLAAAAAHE
FT                   LGTPLATISVVAKEMERELGHDEKYGEDIALLRSQSERCRDILRRLTSLSADNEEHMSR
FT                   LPLSSLIEEVMAPHREFGIRLELVEKTGRAEEPVGIRNAGIIYGLGNLIENAVDYAREK
FT                   VTVTVDHDAQNVAVTIEDDGPGYAHDVLARIGEPYVTERHNDTRAGGLGLGLFIAKTLL
FT                   ERSGAAVTFENRASSKSGARVTIVWPRALMDDKRSR"
FT   gene            complement(53592..56078)
FT                   /gene="hrpB"
FT                   /locus_tag="Atu0052"
FT                   /old_locus_tag="AGR_C_86"
FT   CDS_pept        complement(53592..56078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="Atu0052"
FT                   /old_locus_tag="AGR_C_86"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85876"
FT                   /db_xref="GOA:Q7D2A3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D2A3"
FT                   /protein_id="AAK85876.2"
FT                   /translation="MTRTPVPIKTELPELPVSAVLGDIAQVLAAKKRAVLSAPPGAGKT
FT                   TLVPLRLLHEDWRGDGKIILLEPRRLAARAAAGRMAELLRENVGETVGYRMRLDNRVSS
FT                   KTRIEVVTEGVFARMVLDDPELSGVSTVIFDEFHERSLDGDFGLALALDVQAGLREDLR
FT                   ILVMSATLDVERIGALMGDAPVIQSLGRTFPIDIRYEERWQGIHVDEKVAKAITEAHAS
FT                   ETGSILAFLPGQAEITRTASRLEGRFPDDTDIIPLYGNLSQKEQDAAIKPAPGGRRKIV
FT                   LATSIAETSITIDGVRVVIDSGLQRLPVFEPATGITRLETVRVSRASADQRAGRAGRTE
FT                   PGIAIRLWHQGQTAALNAFTPPQILASDLSGLALDLAHWGVHDPSALAFLDAPPEAALK
FT                   ESVALLKNLGALDNSGGLTRQGHLMRGLSLPPRLAAMVIASAEEGAGKKAAMLAVMLTE
FT                   QGLGGNDIDLDERLRRFFSERSERAQAARKLASRLLDAIGDKTAKAETPSEVGALLLHA
FT                   YPDRIALQRGARGRYVMANGRGAELAETERLAASKMLVVADITGRAAQPRVLAAAAIER
FT                   ADIEERMPHLIVQQEQLLFDKASGQARARKVTRLGAIILDETPLPRPDGEQAARALANG
FT                   VREFGLDILPFSKETLQLRDRIGFLNASIGDPWPDVSDAALLARLEEWFVPFQNGARSL
FT                   QDIRPGSLSEGILSLVPHEVARDLGRLAPTHFEAPTGQRHPIRYDASEPTLSIRVQELF
FT                   GLKAHPAIAQGRLPLLLELTSPAHRPIQTTRDLPGFWTGSWKDVRADMRGRYPRHPWPE
FT                   DPASALPTSRAKPRGT"
FT   gene            56746..58225
FT                   /locus_tag="Atu0053"
FT   rRNA            56746..58225
FT                   /locus_tag="Atu0053"
FT                   /product="16S ribosomal RNA"
FT   gene            58553..58629
FT                   /locus_tag="Atu0054"
FT   tRNA            58553..58629
FT                   /locus_tag="Atu0054"
FT                   /product="tRNA-Ile"
FT   gene            58688..58763
FT                   /locus_tag="Atu0055"
FT   tRNA            58688..58763
FT                   /locus_tag="Atu0055"
FT                   /product="tRNA-Ala"
FT   gene            complement(59238..59627)
FT                   /locus_tag="Atu0056"
FT   CDS_pept        complement(59238..59627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UJ79"
FT                   /protein_id="AAL41084.1"
FT                   /translation="MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHHL
FT                   LDLAEPFLLAYAQRGAKSGNPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDVFD
FT                   TILFEGTPVHFEVVSLRPASRDIIR"
FT   gene            59719..61975
FT                   /locus_tag="Atu0057"
FT   rRNA            59719..61975
FT                   /locus_tag="Atu0057"
FT                   /product="23S ribosomal RNA"
FT   gene            62235..62492
FT                   /locus_tag="Atu0058"
FT   CDS_pept        62235..62492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41085"
FT                   /db_xref="UniProtKB/TrEMBL:A9CLT5"
FT                   /protein_id="AAL41085.1"
FT                   /translation="MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTK
FT                   VDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE"
FT   gene            62607..62725
FT                   /locus_tag="Atu0059"
FT   rRNA            62607..62725
FT                   /locus_tag="Atu0059"
FT                   /product="5S ribosomal RNA"
FT   gene            62964..63040
FT                   /locus_tag="Atu0060"
FT   tRNA            62964..63040
FT                   /locus_tag="Atu0060"
FT                   /product="tRNA-Met"
FT   gene            63196..65004
FT                   /gene="recQ"
FT                   /locus_tag="Atu0061"
FT                   /old_locus_tag="AGR_C_92"
FT   CDS_pept        63196..65004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="Atu0061"
FT                   /old_locus_tag="AGR_C_92"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85881"
FT                   /db_xref="GOA:A9CKR9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR9"
FT                   /protein_id="AAK85881.1"
FT                   /translation="MNADPLNILKAVYGYDAFRGRQGEIIQHVVAGNNAFVLMPTGGGK
FT                   SLCYQIPALAREGMGLVVSPLIALMVDQVAALRQAGVRAEALNSDLSPEERRTLWRDVR
FT                   AGNVDILYAAPETLLKPDVLDALQSIDLSLIAVDEAHCLSQWGHDFRPPYRQLDMLIAR
FT                   FPNTPRMALTATADEPTRAEILGHLAIDEADAFIAGFDRPNIRYAIMEKDNPRTQLKRF
FT                   LNGRENESGIVYCLSKRKVEETAAWLREEGRDALPYHAGMDKAAREENQTRFQHGEAVI
FT                   IVATVAFGMGIDKPDVRFVVHIDLPGSIEAYYQETGRAGRDGLPSDVLMLYGYEDIALR
FT                   NRFIEESDAADQRKYMERQKLDALLGLAETAGCRRQVLLSYFGDRCEPCGNCDTCSSPP
FT                   DLFEGAIAAQKLLSCIYRTGERFGQAYVISVLLGAQDERITKFGHDSITTYGIGKEHDN
FT                   RTWRAILRQLVALRLIEVDLSGHGGLSISENGRRFLREKPSLMLRIPSAPRSTRRDAPR
FT                   NAMSTALPEADRGLFEALRAKRMEIARAQNVPPYVIFHDKTLIELAAARPASAKEMAQI
FT                   AGVGQTKLERYGPAFLDTIMQHAAGE"
FT   gene            complement(65054..66286)
FT                   /gene="frcR"
FT                   /locus_tag="Atu0062"
FT                   /old_locus_tag="AGR_C_93"
FT   CDS_pept        complement(65054..66286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcR"
FT                   /locus_tag="Atu0062"
FT                   /old_locus_tag="AGR_C_93"
FT                   /product="transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85882"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR8"
FT                   /protein_id="AAK85882.1"
FT                   /translation="MRQSVETAPQAPPTTMDMSGGANQIGVRAYNERLVLSLVRRHGGL
FT                   SKAEISRLCGLSAQTVSVIMRSLEKDGLLIRGERLRGKVGQPSTPMRLNPDAVFSFGVK
FT                   IGRRSVDLVLMDFVGRIRLKLRKTYPYPMPEWILPFVIEGISELESKLSAVERQKIAGV
FT                   GIAAPFELWNWAQEVGAPQAEMERWRDVDIRSEIANGISYPVFLQNDATSACGAELVFG
FT                   AGQNYADFLYVFIGSFIGGGVVLNSALFSGKTGTAGAIGPLPVQGQDGNTVQLLKIASI
FT                   FVLENMLRERGIDPRPLWFSPDEWIDFGEPLENWIQKTAAALAQAVIAAASIIDFSSVI
FT                   IDGGFPDWVRTRIVSATRLALKHHDLQGVTLPEIVEGAVGSQARAIGGASLPLFSRYLI
FT                   DQNVLFKDTTG"
FT   gene            66551..67573
FT                   /gene="frcB"
FT                   /locus_tag="Atu0063"
FT                   /old_locus_tag="AGR_C_94"
FT   CDS_pept        66551..67573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcB"
FT                   /locus_tag="Atu0063"
FT                   /old_locus_tag="AGR_C_94"
FT                   /product="ABC transporter, substrate binding protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85883"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR7"
FT                   /protein_id="AAK85883.1"
FT                   /translation="MKTTVSALLGALALGVSFASAASAADTSVCLITKTDTNPFFVKMK
FT                   EGATAKAKELGVTLKSYAGKIDGDSESQVAAIETCIADGAKGILITASDTKGIVPAVQK
FT                   ARDAGLLVIALDTPLEPVDAADSTFATDNLLAGELIGKWAAGTLGDKAKDAKIAFLNLT
FT                   PSQPTVDVLRNQGFMKGFGIDVKDINKIGDEDDKRIVGHDVTNGNEEGGRSAMENLLQK
FT                   DPTINVVHTINEPAAAGAYEALKAVGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYP
FT                   LLMAALGVEAVKKFADTGEKPKPTAGKNFFDTGVTLVTDKPVKGLDSIDTKEGLKKCWG
FT                   "
FT   gene            67798..68880
FT                   /gene="frcC"
FT                   /locus_tag="Atu0064"
FT                   /old_locus_tag="AGR_C_96"
FT   CDS_pept        67798..68880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcC"
FT                   /locus_tag="Atu0064"
FT                   /old_locus_tag="AGR_C_96"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85884"
FT                   /db_xref="GOA:A9CKR6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR6"
FT                   /protein_id="AAK85884.2"
FT                   /translation="MSDQPVRAQPHNEFEKVLSGSSTQVAAFDTHNKSLLEKFQHFLHS
FT                   SPAAVPLIVLVLSLAIFGMTLGGKFFSAFSLTLILQQVAIVGIVGAAQSLVILTAGIDL
FT                   SVGAIMVLSSVVMGQFTFRYGLPAELSIICGLAVGAFCGFINGVLVSRMRLPPFIVTLG
FT                   MWQIVLATNFLYSANETIRAQDIVQQAPILQFFGNNIRIGNAVFTYGVLAMVLLVALLW
FT                   YVLNRTAWGRHLYAVGDDPDAAELAGVNVKRMLTTVYTLSGLICAFAGWALIGRIGSVS
FT                   PTAGQFANIESITAVVIGGISLFGGRGSIMGMIFGALIVGVFSLGLRLIGTDPQWTYLL
FT                   IGVLIILAVAIDQWIRKVAG"
FT   gene            68880..69662
FT                   /gene="frcA"
FT                   /locus_tag="Atu0065"
FT                   /old_locus_tag="AGR_C_98"
FT   CDS_pept        68880..69662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frcA"
FT                   /locus_tag="Atu0065"
FT                   /old_locus_tag="AGR_C_98"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85885"
FT                   /db_xref="GOA:A9CKR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR5"
FT                   /protein_id="AAK85885.1"
FT                   /translation="MAKEPILTARNLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGK
FT                   SSLIKAISGAVTPDEGEIRLEGQPVQFRSPIEARKAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGIQGSLFRALDRPAMEKFAREKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVVILDEPTAALGVKESRRVLELILDVRSRGLPIVLISHNMPHVFEVADRIH
FT                   IHRLGKRLCVINPKDYSMSDAVAFMTGAKEAPQETLAA"
FT   gene            69659..70288
FT                   /locus_tag="Atu0066"
FT                   /old_locus_tag="AGR_C_100"
FT   CDS_pept        69659..70288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0066"
FT                   /old_locus_tag="AGR_C_100"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85886"
FT                   /db_xref="GOA:A9CKR4"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR4"
FT                   /protein_id="AAK85886.1"
FT                   /translation="MTLKLETIVEDVLRRAEGQSRFIIAIAGPPGAGKSTLADALCDAL
FT                   RARGETAAVLPMDGFHMDNGILEERGLLSRKGAPETFDVRGFLDIVSAVREGGQEVLVP
FT                   VFDRSREIAIASARAIAPDTRLILAEGNYLLLNEAPWTVLSGSFDLTIFVGPSVAVLEE
FT                   RLRNRWQGYGLNAAQIHAKLFENDLPNGKRVIENARPADIHIDIWE"
FT   misc_binding    70421..70645
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch; predicted by RFAM"
FT   gene            70953..71174
FT                   /gene="nrdH"
FT                   /locus_tag="Atu0068"
FT                   /old_locus_tag="AGR_C_102"
FT   CDS_pept        70953..71174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="Atu0068"
FT                   /old_locus_tag="AGR_C_102"
FT                   /product="glutaredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85887"
FT                   /db_xref="GOA:A9CKR3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR3"
FT                   /protein_id="AAK85887.2"
FT                   /translation="MTVTVYSKPACVQCTATYRALDRIGVPYEIIDISEDTDALDHVRG
FT                   LGYMQVPVVVAGERHWAGFRPDMIGSIS"
FT   gene            71188..71586
FT                   /gene="nrdI"
FT                   /locus_tag="Atu0069"
FT                   /old_locus_tag="AGR_C_104"
FT   CDS_pept        71188..71586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="Atu0069"
FT                   /old_locus_tag="AGR_C_104"
FT                   /product="NrdI protein involved in ribonucleotide
FT                   reduction"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85888"
FT                   /db_xref="GOA:Q8UJ69"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ69"
FT                   /protein_id="AAK85888.1"
FT                   /translation="MGLIVYYSSRSENTHRFLLKLERRLFRLPLGAEEDVPQVSEPYVL
FT                   VTPTYGGGGTKGAVPKPVIRFLNEPSNRNLIRGVIAAGNTNFGAAFASAGDIVSRKCAV
FT                   PFLYRFELLGTEEDVANVKHGLERFWTR"
FT   gene            71679..73760
FT                   /gene="nrdE"
FT                   /locus_tag="Atu0070"
FT                   /old_locus_tag="AGR_C_106"
FT   CDS_pept        71679..73760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="Atu0070"
FT                   /old_locus_tag="AGR_C_106"
FT                   /product="ribonucleoside-diphosphate reductase 2 alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85889"
FT                   /db_xref="GOA:Q7D293"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D293"
FT                   /protein_id="AAK85889.2"
FT                   /translation="MLNLYDENGKIQLDKDRLAARQYFLQHVNQNTVFFHNLREKLDYL
FT                   VTEGYYEQEVLDQYSFNFVRDLYDEAYSRKFRFPTFLGAFKYYTSYTLKTFDGKRYLER
FT                   YEDRVCMVALALARGDEQLARDLMDEIISGRFQPATPTFLNAGKKSRGELVSCFLLRVE
FT                   DNMESIGRSINSALQLSKRGGGVALSLTNIREFGAPIKQIENQSSGVIPVMKLLEDSFS
FT                   YANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELARN
FT                   NEDMYLFSPYDVERVYGVPLTEISVTEKYHEMVADSRIRKKKIKAREFFQVIAEIQFES
FT                   GYPYIMFEDTVNRANPVAGRISMSNLCSEILQVSEASEFNADLSYSHMGKDISCNLGSL
FT                   NIASAMDSADFGKTIETSIRALTAVSDMSHISSVPSVEKGNDASHAIGLGQMNLHGYLA
FT                   RERIFYGSEEGIDFTNIYFYTVTYHAIRASNRLAVERGQSFKGFENSKYASGDYFDKYT
FT                   DREWLPATEKVRDLFEKAGIAIPTQEDWTALKQDVMASGLYNQNLQAVPPTGSISYINH
FT                   STSSIHPIVSKIEIRKEGKIGRVYYPASYLSNDNLEYYQDAYEIGPEKIIDTYAAATQH
FT                   VDQGLSLTLFFRDTATTRDINRAQIYAWRRGIKTIYYIRLRQMALEGTQVQGCVSCTL"
FT   gene            73777..74751
FT                   /gene="nrdF"
FT                   /locus_tag="Atu0071"
FT                   /old_locus_tag="AGR_C_107"
FT   CDS_pept        73777..74751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="Atu0071"
FT                   /old_locus_tag="AGR_C_107"
FT                   /product="ribonucleoside-diphosphate reductase 2 beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85890"
FT                   /db_xref="GOA:Q7D292"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D292"
FT                   /protein_id="AAK85890.2"
FT                   /translation="MNIAVKPASRIRAVNWNRIEDDKDLEVWNRLTSNFWLPEKVPLSN
FT                   DIPSWGTLKPEEQELTIRVFTGLTLLDTIQNGVGAVRLMPDSATPHEEAVLSNISFMEA
FT                   VHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSAIIMREYDSGDPLKKKIASVFLE
FT                   SFLFYSGFYLPMFWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALDRLGEAQRQE
FT                   IKDFAFDLLLELYDNEAKYTEDLYDGVGLTEDVKQFLHYNANKALMNLGYEALFPAEAC
FT                   RVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF"
FT   gene            complement(74781..76016)
FT                   /locus_tag="Atu0072"
FT                   /old_locus_tag="AGR_C_108"
FT   CDS_pept        complement(74781..76016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0072"
FT                   /old_locus_tag="AGR_C_108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85891"
FT                   /db_xref="GOA:A9CKR2"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR2"
FT                   /protein_id="AAK85891.1"
FT                   /translation="MARWRMPDPIDQHQNHANYSVVATFLAGSYLWTFIVTGNPSMRLI
FT                   ISLVLMISLLSSCAGRPGADVLQAVNTRAKDAKIVTAYVASTREKSEEAKKGFSALRAA
FT                   EPNYARFDISIPPTHKSGKIEWSTGKPDAKKDFVVTKAQMLSKTSFTTDLGDISRSGKQ
FT                   IALFVHGYNYSYQEALFRAAQMAADANMDGVPLVFSWPSQANLTGYVADKESATYSRDA
FT                   LATLLTDLTRQTPRKSIVVFGHSMGGWLVMEALRQLRFEGRNDVIAKLQVVLAAPDIDA
FT                   DVFRKQIEVVGRLNPPLTVLVSKDDRALKASSILGADVTRIGALDVADPQVQEAALKEG
FT                   VQFVDISNLKASDPLNHDRYAALASLVPQLEASRNGNGQNGIGRAGAFVFDAIGATVSS
FT                   PFRLASQVVNPQ"
FT   gene            76045..77172
FT                   /locus_tag="Atu0073"
FT                   /old_locus_tag="AGR_C_109"
FT   CDS_pept        76045..77172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0073"
FT                   /old_locus_tag="AGR_C_109"
FT                   /product="recF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85892"
FT                   /db_xref="GOA:Q8UJ65"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ65"
FT                   /protein_id="AAK85892.2"
FT                   /translation="MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLE
FT                   AVSFLSPGRGLRRAVLSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRL
FT                   RLNGTPVKSVDELTDHLRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRASDF
FT                   EKAMRGRNRLLSEGRFDPVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAGNAAF
FT                   PSATLSLAGFMDDRLNRPAVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFVRHAEK
FT                   NMEAERCSTGEQKALLVGLVLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAALFDLIH
FT                   ALGGQSFMTGTDAAMFSALGERAQFFNVSHGGITA"
FT   gene            77195..77956
FT                   /gene="moeB"
FT                   /locus_tag="Atu0074"
FT                   /old_locus_tag="AGR_C_111"
FT   CDS_pept        77195..77956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="Atu0074"
FT                   /old_locus_tag="AGR_C_111"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85893"
FT                   /db_xref="GOA:Q7D290"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D290"
FT                   /protein_id="AAK85893.2"
FT                   /translation="MDPLSPEEIERYKRHILLPEIGGAGQQRLKAARVLVIGAGGLGAP
FT                   VLHYLAAAGVGTLGMIDDDVVSLSNLQRQVIHDTGTIGELKTESARKTIARLNPHVRTL
FT                   MYEERFSQVWAHDHLPSFDLLIDGSDNFDTRYAAADAAEAAKRPLVTGAVGRFDGSVTV
FT                   LKPYETNAEGSLLPGYRDLFPAPPPQGLIPNCAETGIVGALTGVIGTLMAMEAIKVITG
FT                   AGEPLIGRLLLYDALSARFETVKYKRRAREK"
FT   gene            77960..78436
FT                   /locus_tag="Atu0075"
FT                   /old_locus_tag="AGR_C_112"
FT   CDS_pept        77960..78436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0075"
FT                   /old_locus_tag="AGR_C_112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85894"
FT                   /db_xref="GOA:A9CKR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR1"
FT                   /protein_id="AAK85894.1"
FT                   /translation="MIEIAKIGDDFDRWQDLLALIMTSFAYMDGVIDPPSSAYRLTLEN
FT                   LAEKARAEIAFVALDSDELLGCLFCRPEPPASLYVGKLCVSPKAQGKGIGKLLLLQAEA
FT                   LARELALPALRLETRIELLSNHTKFAAWGFVKTAENAHAGYDRTTSIEMTKFLG"
FT   gene            complement(78443..79132)
FT                   /locus_tag="Atu0076"
FT                   /old_locus_tag="AGR_C_113"
FT   CDS_pept        complement(78443..79132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0076"
FT                   /old_locus_tag="AGR_C_113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85895"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKR0"
FT                   /protein_id="AAK85895.1"
FT                   /translation="MGIQAKFLLLISVLLVLVGSPAGAQPPSPEETAELYYRAWLNFDR
FT                   ASMVRLDKEWGASGSGQRYTDMELVADPIAWQRQYKGVHSPKGTTSEQSDQFAKLWVAS
FT                   TARVLCKAEPAHVGSQTPAGVFVVRIKMNCSLPDVGPAFQRLKAATSADEIGDRTRMPS
FT                   VKLMKQMVEATRTAPLTHKVTTEVQLVSGPDKSIWRVGTAEIQPQTGIDRVSSVFLSQM
FT                   VQSGLLQ"
FT   gene            complement(79181..80185)
FT                   /locus_tag="Atu0077"
FT                   /old_locus_tag="AGR_C_114"
FT   CDS_pept        complement(79181..80185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0077"
FT                   /old_locus_tag="AGR_C_114"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenases
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85896"
FT                   /db_xref="GOA:A9CKQ9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ9"
FT                   /protein_id="AAK85896.1"
FT                   /translation="MTHKKRPTVYITRKLPDVVETRMRELFDAELNIDDSPRSEEELVA
FT                   AMQRVDVLVPTVTDRITAAMIEKAGPQLKLIASFSNGIDHVDVDAAARKGITVTNTPNV
FT                   LTEDSADITMALVLAVPRRMIEGTRVLANGADEWLGWSPTWMLGRRISGKRIGIVGMGR
FT                   IGTAVARRAKAFGLSIHYHNRKRVNPATEAELEATYWDSLDQMLARVDIVSVNCPSTPA
FT                   TYHLISARRLALMQPTSYIVNTARGDIIDEAAMIQCLREGKIAGAGLDVYENEPQVNPK
FT                   LIKLAKEGKVVLLPHMGSATIEGRIEMGDKVIINIRTLFDGHRPPNRVLPGRN"
FT   gene            80360..80899
FT                   /locus_tag="Atu0078"
FT                   /old_locus_tag="AGR_C_117"
FT   CDS_pept        80360..80899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0078"
FT                   /old_locus_tag="AGR_C_117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85898"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D286"
FT                   /protein_id="AAK85898.2"
FT                   /translation="MGMRSVVSIVCIALSLGLLGAAGEAMAQGAAKGASGLPLPRFVSL
FT                   KSKRVNMRIGPSTDYAVSWMYLKSGMPVEIIQEYENWRRIRDADGTEGWVNQALLSGER
FT                   TAVAAPWMRGKGKEVYVNMRREAQSGAAVTARLEPGVVFRIGECNGDWCRAEAGQASGW
FT                   VSQGEIWGAYPGEAFK"
FT   gene            complement(80892..81884)
FT                   /locus_tag="Atu0079"
FT                   /old_locus_tag="AGR_C_118"
FT   CDS_pept        complement(80892..81884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0079"
FT                   /old_locus_tag="AGR_C_118"
FT                   /product="Atu0079-1 mutant of pfkB family carbohydrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85899"
FT                   /db_xref="GOA:Q8U5P4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5P4"
FT                   /protein_id="AAK85899.1"
FT                   /translation="MTKFDVLTVGNAIVDIISRCDDRFLNDNAITKGAMNLIDAERAEL
FT                   LYSLMGPALEASGGSAGNTAAGVANFGGKAAYFGKVAEDQLGEIFQHDIRAQGVYFETK
FT                   PEGTFPPTARSMIFVTEDGERSMNTYLGACVDLGPEDVEDDVVAKTKVTYFEGYLWDPP
FT                   RAKDAIRECARIAHENGREVSMTLSDSFCVGRYRDEFLDLMRSGTVDIVFANKQEALSL
FT                   YETEDFELALTKIAADCKIAAVTMSEEGAVILRGTERVKVEAYPVHDVVDTTGAGDLFA
FT                   AGFLFGYTQDRSLEDCGKLGCLAAAAVIQQVGPRPMSSLKALGEKHGLI"
FT   gene            82362..83306
FT                   /locus_tag="Atu0080"
FT                   /old_locus_tag="AGR_C_121"
FT   CDS_pept        82362..83306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0080"
FT                   /old_locus_tag="AGR_C_121"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85901"
FT                   /db_xref="GOA:A9CKQ8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ8"
FT                   /protein_id="AAK85901.1"
FT                   /translation="MSAVAANVAPIFILILIGWLTVKAGLLRADAGDILSDFVFKIAVP
FT                   TLIFRTLAEANFHGASPFRLWITYFAGVAVTWAFGHIVTRYVFKQDVRIAVIAGISSAF
FT                   ANNIFIGLPLVGRSVGDEGLVALSILLAIHLPVMMIAGTILMENATHKAVGGEKRGMAA
FT                   VFKQVGRNLVTNPLVIGLAIGLSTNVSGVALTPILKTVVDQVASMAGPAALISLGMALT
FT                   KYTIRGNMGIAVTMTVFKLLLLPACVWAMGHALGLSREWTAALVLTSSVPTGVNAWLIA
FT                   NRFGIGHSVAASTISISTATGVLSVSLWAWLLS"
FT   gene            complement(83313..84329)
FT                   /gene="rsmC"
FT                   /locus_tag="Atu0081"
FT                   /old_locus_tag="AGR_C_122"
FT   CDS_pept        complement(83313..84329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="Atu0081"
FT                   /old_locus_tag="AGR_C_122"
FT                   /product="ribosomal RNA small subunit methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85902"
FT                   /db_xref="GOA:Q7D284"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D284"
FT                   /protein_id="AAK85902.2"
FT                   /translation="MSRDAVKTLFHPFASDMLAMPKEGERVLFLGAEAGPRLDGFDAEI
FT                   VAVQHLRPLYRALEAQGTGVAPDVSGEDYDAALLLCGKHRGENENRVAEALSRVKAGGL
FT                   IVAAGSKEDGIVTLRKTLSKLGIESESTPKYHGVAIWFKRPEDVSAAVLKLAQKPATVE
FT                   GRFTALPGMFSHDRVDDGSELLASRLPTDFDGNAADFGAGWGYLSIMLAEKSPRTARID
FT                   LFEADWNALEFAKTNLLENNPRLTARFFWQDLANEPPKEKYDLIIMNPPFHAAGQAAEP
FT                   ALGQAFIKAAAGALRSGGKLLMVANRGLPYEPVLAAEFRTTAEVCRNARFKILSAQK"
FT   gene            complement(84465..86606)
FT                   /gene="pnpA"
FT                   /locus_tag="Atu0082"
FT                   /old_locus_tag="AGR_C_124"
FT   CDS_pept        complement(84465..86606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /locus_tag="Atu0082"
FT                   /old_locus_tag="AGR_C_124"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85903"
FT                   /db_xref="GOA:A9CKQ7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKQ7"
FT                   /protein_id="AAK85903.1"
FT                   /translation="MFNKHSVEIEWAGRPLKLETGKVARQADGAVIATYGETMVLATVV
FT                   SAKSPKPGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPLFP
FT                   EGYKNDTQVVVTVIQHDLENDPDVLSMVAASAALTLSGIPFMGPVGGARVGYINGEYVL
FT                   NPHLDEMDESVLDLVVAGTQDAVLMVESEAKELNEEIMLGAVMFGHKGFQPVIDAIIKL
FT                   AEVAAKEPREFEPEDFSALENEMLGLAETELRTAYKITEKAARYAAVDAVKTKVKAHFL
FT                   PEEGEAKYSPEEIGAVFKHLQAKIVRWNVLDTKSRIDGRDLSTVRPIVSEVGILPRTHG
FT                   SALFTRGETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGR
FT                   REIGHGKLAWRAIRPMLPTAEQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPL
FT                   AKPVAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTADGITSLQMDIKIAGITE
FT                   EIMKIALEQAQGGRKHILGEMANAITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKV
FT                   IREIVEKTGAKINIEDDGTVKIASASGKEIEAARKWIHSIVAEPEVGQIYEGTVVKTAD
FT                   FGAFVNFFGARDGLVHISQLASERVAKTSDVVKEGDKVWVKLMGFDERGKVRLSMKVVD
FT                   QATGKEVAADKKDGEAAAE"
FT   gene            complement(86872..87141)
FT                   /gene="rpsO"
FT                   /locus_tag="Atu0084"
FT                   /old_locus_tag="AGR_C_126"
FT   CDS_pept        complement(86872..87141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="Atu0084"
FT                   /old_locus_tag="AGR_C_126"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85904"
FT                   /db_xref="GOA:Q8UJ54"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ54"
FT                   /protein_id="AAK85904.1"
FT                   /translation="MSITAERKAALITEYATKAGDTGSPEVQVAILTERINNLTGHFKD
FT                   HKKDNHSRRGLLTLVSSRRSLLDYLKKKDEARYTKLIGALGIRR"
FT   gene            complement(87307..88254)
FT                   /gene="truB"
FT                   /locus_tag="Atu0085"
FT                   /old_locus_tag="AGR_C_127"
FT   CDS_pept        complement(87307..88254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="Atu0085"
FT                   /old_locus_tag="AGR_C_127"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85905"
FT                   /db_xref="GOA:Q8UJ53"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ53"
FT                   /protein_id="AAK85905.1"
FT                   /translation="MSKPRKQQHRKPKGRPISGWLILDKPLDFGSTEAVSKIKWLFNAQ
FT                   KAGHAGTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVTWGEQRATDDLEGEVVES
FT                   SDQRPEEQAIRDILPNYTGVIMQTPPQFSAIKIAGERAYDLARDGETVEIPAREVEIHR
FT                   LTLLACPDADTAHFEVECGKGTYVRALARDMGRDLGCFGHISELRRTMVAPFGEDMMVP
FT                   LETLTALEAIEDRDERLEALDAFLIDTAEALSSLPRLIINDDQAHRLKMGNPILLRGRD
FT                   APANHPEAYATAQGKLVAIGEIGEGEFRPKRVFG"
FT   gene            complement(88258..88674)
FT                   /gene="rbfA"
FT                   /locus_tag="Atu0086"
FT                   /old_locus_tag="AGR_C_129"
FT   CDS_pept        complement(88258..88674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="Atu0086"
FT                   /old_locus_tag="AGR_C_129"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85906"
FT                   /db_xref="GOA:Q8UJ52"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ52"
FT                   /protein_id="AAK85906.1"
FT                   /translation="MAKATSSAPSQRMLRVGEQVRAALTQILQRGEVRDDLIEGTVISI
FT                   SEVRMSPDLKIATAYVTPLGVADHTDIISALNRHAKFMRGRLGPQLRQMKYMPELRFRD
FT                   DTSFDNYQKIDALLRSPEVQRDLGPSNEKDDEQN"
FT   gene            complement(88750..91491)
FT                   /gene="infB"
FT                   /locus_tag="Atu0087"
FT                   /old_locus_tag="AGR_C_131"
FT   CDS_pept        complement(88750..91491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="Atu0087"
FT                   /old_locus_tag="AGR_C_131"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85907"
FT                   /db_xref="GOA:Q8UJ51"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ51"
FT                   /protein_id="AAK85907.1"
FT                   /translation="MTDNNDDKTLNAPAKKTLTLKPGGMNQGTVRQDMGRGRTNAVVVE
FT                   TRKRRPHRPEDEKPVQPVVAAPKPAAPAPVAARPQAPQPRIHQPGGQQQRPGSSQSQQR
FT                   SGSSAPQQRQADRPRGNVLHDLSAGEMEARRRALMEAQARDVVEAKQRAEDEARRKVEE
FT                   EQRIAAEKMEAANRAAEEAAAAKVAASQPAAEVRAEPASERPAAAAAPAPRTDARPQSA
FT                   AAAPRSAPATPDAAAPRGRRTGGDDEDDRGAVRRGSSLPARGKVVAPAPAKPAARLKTE
FT                   EERRRGKLTVTSNLEEDGTPRGRSMASMRRRQEKFRRSQMQETREKVLREVILPETITI
FT                   QELSQRMSERAVDVIKFLMKEGQMLKPGDVIDADLAELIAVEFGHTVKRVSESDVEEGI
FT                   FNQTDDEGEMVSRPPVVTIMGHVDHGKTSLLDAIRQANVVSGEAGGITQHIGAYQVEKN
FT                   GHKITFIDTPGHAAFTAMRARGAQATDIAVLVVAADDSVMPQTIESINHAKAAGVPIVV
FT                   AINKIDKHEANPDKVRQQLLQHEVFVESMGGEVLDVEVSAKNKLNLDKLLEAILLQAEI
FT                   LDLKADPSRTAEGTVIEAELDRGRGAVATVLVQKGTLKPGQIIVAGDQWGRVRALVNDK
FT                   GDHVKEAGPAMPVEILGLSGTPSAGDRFAVVENESRAREISEYRQRLARDKAVARQTGQ
FT                   RGSLEQMMSQLQTSGLKEFPLVIKADVQGSVEAIIASLDKLGTDEVRARVVHSGAGAIT
FT                   ESDISLAEASNAAIIGFNVRANAQARTASERAGIEIRYYNIIYDLVDDVKAAMSGLLSP
FT                   ERRETFLGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLVRDNVVIHEGKLKTLKR
FT                   FKDEVNEVPVGQECGMAFENYEDIRAGDTIECFRVEHITRTL"
FT   gene            complement(91594..92295)
FT                   /locus_tag="Atu0088"
FT                   /old_locus_tag="AGR_C_134"
FT   CDS_pept        complement(91594..92295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0088"
FT                   /old_locus_tag="AGR_C_134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85908"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ6"
FT                   /protein_id="AAK85908.1"
FT                   /translation="MTSQAHEPDDLPETDDDGRIKGDVNGRMCIVTRQSGSPDELIRFV
FT                   AGPDGNVVPDLKRQLPGRGCWVTPERALIEKAIAKKLFARALKRDVKAGPELLALLDRL
FT                   MAQQLAGMMNMARKAGQFISGATKVDAAVRSGNAIAVFHATDAAADGVRKLDQARKAWA
FT                   LGSDAGNEIPSFRLSSEAEMDELMGQNAFIHACALAGQAGEGVVKRATMLEQYRLGGRS
FT                   QAERDAARTEQ"
FT   gene            complement(92292..93908)
FT                   /gene="nusA"
FT                   /locus_tag="Atu0089"
FT                   /old_locus_tag="AGR_C_136"
FT   CDS_pept        complement(92292..93908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="Atu0089"
FT                   /old_locus_tag="AGR_C_136"
FT                   /product="N-utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85909"
FT                   /db_xref="GOA:A9CKQ5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ5"
FT                   /protein_id="AAK85909.1"
FT                   /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYG
FT                   SETNIRADINSKTGEIRLQRLLEVVEAAEDYSTQIPLELARDRNPDAKLGDFIADPLPP
FT                   MDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRIGEIVNGTVKRVEYGNVIVDLGRGE
FT                   GIIRRDEMIPRENMRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYD
FT                   GIIQIKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWS
FT                   QEPASFIVNALQPAEVAKVVLDEESERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDI
FT                   DIMTEQEESERRQKEFNERTALFMEALDVDEMVGQVLASEGFAQVEELAYVDLDEITSI
FT                   DGFDEDTADEIQTRAREYLERLEAEMDAKRKELGVTDELRQIDGLTSQMMVALGEDGIK
FT                   TIEDFAGCAADDLVGWSERKDGETKKFEGIFSKLDVSRVEAENMVVQARLLAGWITAEE
FT                   LASEQEVEAEAAEEADTAEQE"
FT   gene            complement(93972..94568)
FT                   /locus_tag="Atu0090"
FT                   /old_locus_tag="AGR_C_138"
FT   CDS_pept        complement(93972..94568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0090"
FT                   /old_locus_tag="AGR_C_138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85910"
FT                   /db_xref="GOA:Q8UJ48"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ48"
FT                   /protein_id="AAK85910.1"
FT                   /translation="MADTAQEPRLITETGIDQRIAEIIEPVLTGMGYLLVRVRLSNQNG
FT                   MTLQVMAEREDGTMNVQDCEAISMAISPVLDVEDPVEKAYHLEVSSPGIDRPMVRKTDF
FT                   TRWQGHLVKVETSILVENRKRFRGKIVEVDADSFKLERDQIAYGEEPTVVVPFNALSDA
FT                   KLILTDDLIRDALRADKAAKAAAANQNDENEADED"
FT   gene            94974..96485
FT                   /locus_tag="Atu0091"
FT                   /old_locus_tag="AGR_C_139"
FT   CDS_pept        94974..96485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0091"
FT                   /old_locus_tag="AGR_C_139"
FT                   /product="MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85911"
FT                   /db_xref="GOA:A9CKQ4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ4"
FT                   /protein_id="AAK85911.2"
FT                   /translation="MMTSLSSSENMIALVQASTSLPIMMFSLISGALADSFDRRRIMIS
FT                   AQLLMLTASVLLTVFAWSGWLTPWLLLFFTFMIGCGTALNNPSWQASVGEMVPREDLPA
FT                   AVTLNSVGFNITRSVGPAIGGIIVAAAGAAAAFFVNALSYFTLIYALFRWQPPKYASTL
FT                   PREQLLAAISAGMRYVAMSPNIGKVLVRGFLFGLSASAILALMPIVARDLVEGGPLTYG
FT                   VMLGAFGVGAIGGALVSARLREVMSSEWIVRVAFLGFAFSSGVTAVSTSSIITSLVLAI
FT                   AGACWVLALSLFNTIVQLSTPRWVVGRALSLYQTLTFGGIAVGSWLWGELAEDYGISYS
FT                   LLCSCVLMLLGVVVGLKLAMPAFASLNLDPLNRFVEPPLRLDVKPRSGPIAILIDYEIH
FT                   DEDLGEFLPLMAERRRIRLRDGARNWNLMRDLENPDIWTESYHVPTWVEYVRHNHRRTQ
FT                   ADAEAWDRLLELHRGKTRPRVHRMIERQTIPPTDDIFHKPHTDQH"
FT   gene            complement(96508..97773)
FT                   /gene="mltB"
FT                   /locus_tag="Atu0092"
FT                   /old_locus_tag="AGR_C_140"
FT   CDS_pept        complement(96508..97773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltB"
FT                   /locus_tag="Atu0092"
FT                   /old_locus_tag="AGR_C_140"
FT                   /product="lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85912"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ3"
FT                   /protein_id="AAK85912.1"
FT                   /translation="MPHRFATKALAAILSVFSATTVLAQSAPKGAAAAKYDADFNAWLK
FT                   KEIWPEARKAGISQETLEATLSGLSISWNLPDLVIPGQKPPKEQSQSQAEFSSPGAYFS
FT                   EKRLQGLAVTGRSLAATHAATLRRIETKYGVPGDIVVAIWGRESGFGRAKLPHSVVDVL
FT                   ATKAYMSTRKEMFRTELIDALKIVESGDIAASRMMGSWAGALGQPQFMPSSYLKYAVDF
FT                   DGDGHRDIWNSVPDALASIANYLSQRGWQRNRDWGFEVSIPANVSCAQEGPDLARPVAD
FT                   WAKMGITRISGKAFPVNDLTADGMMLVPAGRHGPEFVVTPNFYVIKEYNNSDLYALFIG
FT                   NLADRIAHGAGPFKGEWGNVGSMLRSDVLTMQKALVAKGYDVGKADGLAGFKTRRSLGD
FT                   WQSKNGLAPTCFPDATLKAKLK"
FT   gene            complement(97808..98413)
FT                   /gene="recR"
FT                   /locus_tag="Atu0093"
FT                   /old_locus_tag="AGR_C_142"
FT   CDS_pept        complement(97808..98413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Atu0093"
FT                   /old_locus_tag="AGR_C_142"
FT                   /product="Recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85913"
FT                   /db_xref="GOA:Q8UJ45"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ45"
FT                   /protein_id="AAK85913.1"
FT                   /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKEQLLGP
FT                   LGHAMGEAYDKVKICSCCGNVDTIDPCTVCADDRRDQSVIIVVEDVSDLWALERAGAMN
FT                   TAYHVLGGTLSPLDGVGPEDLNIKGLIDRVSAGGIRELIIAVNATVEGQATAHYITDRL
FT                   SGLGIKITRLAHGVPVGGELDYLDEGTLTAALRARTTI"
FT   gene            98472..99086
FT                   /locus_tag="Atu0094"
FT                   /old_locus_tag="AGR_C_144"
FT   CDS_pept        98472..99086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0094"
FT                   /old_locus_tag="AGR_C_144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85914"
FT                   /db_xref="GOA:A9CKQ2"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ2"
FT                   /protein_id="AAK85914.2"
FT                   /translation="MKIRAVCRGEAKSLPGKTTKTGIFKHAVNGPVMVDAEGIVSDAVC
FT                   NRKHHGGPDQAIYVMGSVDLDFWSSTLGSTVEPGFFGENLVLDGVDSAKLHVGDRFTAN
FT                   DVVLEVTAARIPCATLSARIGDPNFAPRFRQAGQSGFYCRVLKGGMLAAGEEVMFEPYP
FT                   GTKLPIPTILQRFRPMQLNEAERTAYLETPLASRFRAMLES"
FT   gene            complement(99146..99469)
FT                   /locus_tag="Atu0095"
FT                   /old_locus_tag="AGR_C_145"
FT   CDS_pept        complement(99146..99469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0095"
FT                   /old_locus_tag="AGR_C_145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85915"
FT                   /db_xref="GOA:Q8UJ43"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ43"
FT                   /protein_id="AAK85915.1"
FT                   /translation="MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNG
FT                   KGEMRGLKIDPSLFKEDEVEILEDLIVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMK
FT                   LPF"
FT   gene            complement(99494..101368)
FT                   /locus_tag="Atu0096"
FT                   /old_locus_tag="AGR_C_147"
FT   CDS_pept        complement(99494..101368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0096"
FT                   /old_locus_tag="AGR_C_147"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85916"
FT                   /db_xref="GOA:A9CKQ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ1"
FT                   /protein_id="AAK85916.1"
FT                   /translation="MSDTVPPKSSESQVGTGYRVLARKYRPKDFSDLMVGQEPMVRTLT
FT                   NAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTDTIDKPTIDLRIPGEHCQAIME
FT                   GRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTQAFNGLLKTL
FT                   EEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISAADLVGLFTAIAGKEGFEAEPQA
FT                   LSMIARAAEGSARDGLSLLDQAIAHGGGRVEAEAVRGMLGLADRARIVDLFQHVVKGDV
FT                   AAALSEFNGQYEAGANPVVVLNDLADFTHLVTRMKYVPDAAEDPSLSEIERTRGAEFAE
FT                   TIAVTALSRIWQMLLKGIPETENASRPAGAAEMVLIRLSHAANLPAPEDAARRLLELSS
FT                   ADGSYTNGGPSGGGNGGGARAYSSAQTVAAARPAEFAAPRQAGPQPSTMLRAVPDSRPQ
FT                   EMQVAAPKTEERPEPKVPVNSLQDIADLCQKNRDPVMRAKVRNFVRLVRLEPGRLDMRL
FT                   GEGAPGSLPGELGVKLKEWTGIHWIVSLSKEQGEPTLVEAEGNARDARLVDARQDPDVA
FT                   AILAQFPGAKITDVRIRAAIQDEAEDITPPSVAESSEGDILPGDDIEF"
FT   misc_feature    complement(101447..101544)
FT                   /note="Bacterial signal recognition particle RNA SRP_bact;
FT                   predicted by RFAM"
FT   gene            101634..102038
FT                   /locus_tag="Atu0097"
FT                   /old_locus_tag="AGR_C_148"
FT   CDS_pept        101634..102038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0097"
FT                   /old_locus_tag="AGR_C_148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85917"
FT                   /db_xref="GOA:A9CKQ0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKQ0"
FT                   /protein_id="AAK85917.2"
FT                   /translation="METFRLDERLARDSVLVTRLGLCELRLQNDNRWPWLLLVPQRDGV
FT                   SELFDLTPLDQAVLTFETNLVASALKEITGATKINVGALGNIVRQLHVHIIARNEGDTC
FT                   WPGPIWGHGTAVPYAVGEKESLMKKISGAL"
FT   gene            102038..103000
FT                   /locus_tag="Atu0098"
FT                   /old_locus_tag="AGR_C_150"
FT   CDS_pept        102038..103000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0098"
FT                   /old_locus_tag="AGR_C_150"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85918"
FT                   /db_xref="GOA:A9CKP9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP9"
FT                   /protein_id="AAK85918.1"
FT                   /translation="MMSMKIFETTAPHPEASLLTAFSKNALDRFAEKRTEECVAEALKV
FT                   DGTHIFAFSGNRLVLKHDEQVIDPLFSAYELAELQPDFDNAVLLGYRETGEPRIAVPVA
FT                   VAEDQLASHYKLADARTLYRDHLLDEELLSEVAQAVSLTHWNADNRFCGRCGGTMEQRI
FT                   GGYKRICASCSHTIFPRTDPVVIMMTIDIERDLCLLGRGAHFASGMYSCLAGFVEPGET
FT                   IEQAVRRETHEESGVEIGRVRYHASQPWPMPHTLMIGCYAEALSSDIARDEIELEDCRW
FT                   FTREEVAKMLEAPAGEGFSAPPIGAIAHRLMRDWVEWPE"
FT   gene            complement(103016..103879)
FT                   /gene="pheA"
FT                   /locus_tag="Atu0099"
FT                   /old_locus_tag="AGR_C_151"
FT   CDS_pept        complement(103016..103879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="Atu0099"
FT                   /old_locus_tag="AGR_C_151"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85919"
FT                   /db_xref="GOA:Q7D273"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D273"
FT                   /protein_id="AAK85919.1"
FT                   /translation="MNLITNRIAFQGEFGANSDMACRDMFPDMEPLPCPTFEDAFNAIE
FT                   NGEADLGMIPIENTLAGRVADIHHLLPESRLHIIGEYFMPIRFQLMVVPGVTKDEIRTV
FT                   HSHIHALGQCRKIIRSNGWKPVIAGDTAGSARLVSEKGDRSMAALAPRLAADLYGLDIL
FT                   AENVEDSENNVTRFVVLSRDENWAKRQSSDEIVVTTFVFNVRNIPAALYKAMGGFATNG
FT                   INMTKLESYQLGGKFVATQFYADIEGHPDDEPVRHALDELRFFSEKVRILGVYNGHAMR
FT                   GKLNQS"
FT   gene            complement(103891..104646)
FT                   /gene="kdsB"
FT                   /locus_tag="Atu0100"
FT                   /old_locus_tag="AGR_C_152"
FT   CDS_pept        complement(103891..104646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="Atu0100"
FT                   /old_locus_tag="AGR_C_152"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85920"
FT                   /db_xref="GOA:A9CKP8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKP8"
FT                   /protein_id="AAK85920.1"
FT                   /translation="MKNRDFEKAVVLIPARMASTRLPGKPLADIGGRPMIVQVALRARE
FT                   AGAERIVVAVDDEQVFAAVQNAGFDVMMTRGDHQSGSDRIFEALQKADPYGKAEYVINV
FT                   QGDLPTIEAETIRASLRPMENAAVDIATLTVEITDEEEKTNPNVVKVVGSPLSETRLRA
FT                   LYFTRTTAPYGDGPLYHHIGLYTYRRAALETFVRLPPSPLELRERLEQLRALEAGMRID
FT                   AEIVRSVPLGVDTPHDLEKARKILAGRTL"
FT   gene            104797..105375
FT                   /gene="cycM"
FT                   /locus_tag="Atu0101"
FT                   /old_locus_tag="AGR_C_155"
FT   CDS_pept        104797..105375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="Atu0101"
FT                   /old_locus_tag="AGR_C_155"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85921"
FT                   /db_xref="GOA:Q8UJ37"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ37"
FT                   /protein_id="AAK85921.1"
FT                   /translation="MNSYVNMGVGALLGTVFVLMSVSIASEGIFHAPAPEKEGYTIVAA
FT                   ESGGGEAGGGEAAAAATPIAKLLASADAAKGEAVFKKCTSCHTGESGGANKVGPNLFDV
FT                   VNRPIASHEGFSYSAGMKDFSKGASVHWDYDHLNYFLEAPKKHVPGTAMGFAGVKKETE
FT                   RADLIAYLRSLSANPAPLPDPNAAPAPMN"
FT   gene            complement(105470..106195)
FT                   /locus_tag="Atu0102"
FT                   /old_locus_tag="AGR_C_157"
FT   CDS_pept        complement(105470..106195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0102"
FT                   /old_locus_tag="AGR_C_157"
FT                   /product="exopolysaccharide production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85922"
FT                   /db_xref="GOA:Q7D271"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D271"
FT                   /protein_id="AAK85922.2"
FT                   /translation="MLGTKSSSHAVFYGAPYPAVPFETAEMQSPISDKKPSSLQRGQFA
FT                   LKRTIDIAGASIALVALAPVLATVALLVKLDSKGPVLFSQVRWGMNGRKIRVYKFRSMQ
FT                   AELGDVTGVAQTVKNDPRITRIGAILRRTNIDELPQLINVLKGDMSLVGPRCHAVGMLA
FT                   AGRLYEELVPHYHMRHRMRPGITGLAQMRGLRGPTDRSDKARARIVSDLYYVENFSVWL
FT                   DIKIMVGTVISELRGGKGF"
FT   gene            complement(106484..108778)
FT                   /gene="pbpC"
FT                   /locus_tag="Atu0103"
FT                   /old_locus_tag="AGR_C_158"
FT   CDS_pept        complement(106484..108778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="Atu0103"
FT                   /old_locus_tag="AGR_C_158"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85923"
FT                   /db_xref="GOA:A9CKP7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP7"
FT                   /protein_id="AAK85923.1"
FT                   /translation="MAGKGKSRERVEPSFGDFHESGDDLRLDASERISGASKQQAKKPR
FT                   PASGRTKSRKKEKRSRNSGRGVTGFIRSLFYWCIVLGIWGGIGVAGLVLYYGARMPSAS
FT                   SWSIPERPPNVKIVSVNGSVLANRGTTGGEALALEDMSPYIPQAVMAIEDRRFYSHFGV
FT                   DPLGLGRAIVTNVLTGRAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVLLSFWLEHEFT
FT                   KDQILAMYLNRVYFGSNAYGVEAASRRYFNKSARDVNLGEAAMLAGLLKAPSRLSPARD
FT                   PQAAEERAQVVLQSMRDVGFITDDEIKTAMSQPPTKAKRFWSGAEHYAADMVLEEVRGL
FT                   VGEVKQDIVVDTTIDPNLERDAEKALTHVLQGDGKKQGASQAALVSIDGTGAIRAVVGG
FT                   ADYAQSQFNRAVKAKRQPGSAFKPFVYVAALESGLTPYTIRNDGPVRIGNWTPENYEKK
FT                   YRGEVTLATALANSLNTIAAQLVMEVGPERVTQVAHRMGIESELQNNASIALGTSEVSL
FT                   MELTASYAPFMNGGYKATPHIVKRITDADGKVLYENKYDNPPRVLSEEIAATMNGMLSR
FT                   VITEGTGKAARLQGWQAAGKSGTTQSFRDALFVGYTSNLTTGVWFGNDDGTSMKKVTGG
FT                   GLPARAWKDFMTAAHSGLSPSPLFGLGAGGVPPLGDMQQPAPEAAPSSIGEIISNALGG
FT                   GTTDTRAYPDAPVSPNQPGMAMPPANIPSRDIEPGYQAGNGPVPPADIGGQAPAQSGPK
FT                   QTTLLDILMGN"
FT   gene            complement(108895..109353)
FT                   /locus_tag="Atu0104"
FT                   /old_locus_tag="AGR_C_159"
FT   CDS_pept        complement(108895..109353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0104"
FT                   /old_locus_tag="AGR_C_159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85924"
FT                   /db_xref="GOA:A9CKP6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP6"
FT                   /protein_id="AAK85924.1"
FT                   /translation="MSIESVRAFFIEKSPGVTVIETEGSSATVALAAEAHGVDPDQIAK
FT                   TICLKAGDTILLVVAAGTRRLDNRKFRDHFGAKPRMLGAEEVVAVTSHPIGGVCPFGLP
FT                   SALPVFCDISLKNYQEVVPAAGATNAAVKISPDVMVELTGAEWVDVCQ"
FT   gene            complement(109363..109557)
FT                   /locus_tag="Atu0105"
FT   CDS_pept        complement(109363..109557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UJ33"
FT                   /protein_id="AAL41130.1"
FT                   /translation="MKLTDNWEEEYCQSNRATLGGGVRRFDDLKIQDTSLKNRRFIAAQ
FT                   HCKKCIAISGRLEACPRSA"
FT   gene            109823..110032
FT                   /gene="cspA"
FT                   /locus_tag="Atu0106"
FT                   /old_locus_tag="AGR_C_161"
FT   CDS_pept        109823..110032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="Atu0106"
FT                   /old_locus_tag="AGR_C_161"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85925"
FT                   /db_xref="GOA:Q7D268"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D268"
FT                   /protein_id="AAK85925.2"
FT                   /translation="MATGTVKWFNATKGYGFIQPDDGSQDVFVHISAVERAGLTALNDG
FT                   QKLSYELMQDRRSGKMSAGELVAS"
FT   gene            110062..110223
FT                   /locus_tag="Atu0107"
FT                   /old_locus_tag="AGR_C_162"
FT   CDS_pept        110062..110223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0107"
FT                   /old_locus_tag="AGR_C_162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85926"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D267"
FT                   /protein_id="AAK85926.2"
FT                   /translation="MNGEAGFFRPFSFERRAEQAGLEKAGVHTNIGFSSVSDENCQAGI
FT                   LKVPLLSC"
FT   gene            complement(110444..111835)
FT                   /locus_tag="Atu0108"
FT                   /old_locus_tag="AGR_C_165"
FT   CDS_pept        complement(110444..111835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0108"
FT                   /old_locus_tag="AGR_C_165"
FT                   /product="putative metalloprotease M20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85928"
FT                   /db_xref="GOA:Q7D266"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D266"
FT                   /protein_id="AAK85928.2"
FT                   /translation="MTDVSPILSNADDNLTSSLERLFELVRIPSISTDPAYKAECRKAA
FT                   DWLVRTLSALGFTASVRDTAGHPMVVAHHDAATKDAPHVLFYGHYDVQPVDPLELWEND
FT                   PFEPAIKDIGAGRKVITGRGTADDKGQLMTFVEACRAYKAVNGVLPVRVTILFEGEEES
FT                   GSPSLKPFLDANAQELKADYALVCDTGMWDRDTPAIAAALRGLVGEEIVITAADRDLHS
FT                   GLFGGAAANPIHILTDILAGLHDETGRVTLAGFYDGVEEPPANIKASWETLGRSAEAFL
FT                   GEVGLSVPSGEKGRSVLEQTWARPTAEVNGIIGGYTGDGFKTVIAAKASAKVSFRLVGE
FT                   QNPAAIRDSFRAYVRSKIPADCSVEFHEHGASPAIQLSYDSPVLTKAKNALSEEWPKPA
FT                   VVIGMGGSIPIVGDFQKMLGMDSLLVGFGLTDDRIHSPNEKYELQSFHKGIRSWVRILD
FT                   ALAAK"
FT   gene            complement(112000..112446)
FT                   /locus_tag="Atu0109"
FT                   /old_locus_tag="AGR_C_167"
FT   CDS_pept        complement(112000..112446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0109"
FT                   /old_locus_tag="AGR_C_167"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85929"
FT                   /db_xref="GOA:Q7D265"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D265"
FT                   /protein_id="AAK85929.2"
FT                   /translation="MDGRMGFSRDESAIYLAAKMAREFTMALQKRAAALGFSPGQFPIL
FT                   IELWHEEGLTQRQLLDRIDVEQATLANTLSRMERDGLIVRKSHPSDRRAQIIELTQRGR
FT                   DLEANAIAASEATEDTLLANFRRFERQLLLEYMRRAIESAKKAK"
FT   gene            complement(112724..113134)
FT                   /locus_tag="Atu8081"
FT                   /old_locus_tag="AGR_C_168"
FT   CDS_pept        complement(112724..113134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8081"
FT                   /old_locus_tag="AGR_C_168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8081"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85930"
FT                   /db_xref="GOA:Q8U5P1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5P1"
FT                   /protein_id="AAK85930.1"
FT                   /translation="MSKVSIFKAYFGAVFLTAIIAIAAWWQGDNATTIFHKALVVPLYL
FT                   LASTGLRSYFPEIFDSKRGILGTLEFHILNSAILAAFFILVLRPFPDDIGNQLVSFFFL
FT                   IAFTGTANFARAMHARKKNQYSDQTSPHLTDL"
FT   gene            113226..116222
FT                   /gene="polA"
FT                   /locus_tag="Atu0110"
FT                   /old_locus_tag="AGR_C_169"
FT   CDS_pept        113226..116222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="Atu0110"
FT                   /old_locus_tag="AGR_C_169"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85931"
FT                   /db_xref="GOA:A9CKP5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP5"
FT                   /protein_id="AAK85931.2"
FT                   /translation="MKKGDHLFLVDGSGFIFRAFHAIPPLNRKSDGLPVNAVSGFCNML
FT                   WKLLKDARNTDVGVTPTHFAVIFDYSSKTFRNELYDLYKANRSAPPEDLVPQFGLIREA
FT                   TRAFNLPCIETEGFEADDIIATYARQAEAIGADVTIISSDKDLMQLVTANVHMYDAMKD
FT                   KQIGVPDVIEKWGVGPEKMIDLQAMTGDSTDNVPGIPGIGPKTAAQLLEEYGDLDTLLA
FT                   RAGEIKQQKRRENIIANAELARLSRQLVALRTDVPLEQSLEELVLEPQNGPKLIAFLKA
FT                   MEFTTLTRRVAEATDSDASAIDPANVPVQWGADAHGPDLDAPAAAMAGDVSAEGNNRPA
FT                   SAVAPAKRMIGEGSTPADLTTARQALFAATKIDTTAYTAIRDIATLDLWIAAAREAGVV
FT                   AFDTETTSLDPMQAELVGFSLAIADNGKDASGTDIRAAYVPLTHKTGSGGDLFSDGIKL
FT                   AEGQAPFAEALERLKDLLEDEAVLKVAQNLKYDYLLMKRHGVVMRSFDDTMLISYVLEA
FT                   GKTTHGMDTLSERWLGHTPIAYKDVTGSGKSSITFDFVNIDKATAYAAEDADVTLRLWM
FT                   ALKPRLVSERLTKVYERLERPLVPVLAHMEERGITVDRQILSRLSGELAQKAASFEEEI
FT                   YELAGERFNIGSPKQLGDILFGRMGLPGGSKTKTGQWSTSAQVLEDLAAEGAELPRKIV
FT                   DWRQLTKLKSTYTDALPSYIHPETKRVHTSYALASTTTGRLSSSEPNLQNIPVRTAEGR
FT                   KIRTAFISTPGHKLLSADYSQIELRVLAHVADIPQLRNAFENGIDIHAMTASEMFGVPV
FT                   EGMPSEVRRRAKAINFGIIYGISAFGLANQLSIARSEAGDYIKKYFERFPGIRDYMEAT
FT                   KAFARENGYVETIFGRRAHYPEIRSSNPSVKAFNERAAINAPIQGSAADIIRRAMIRIE
FT                   PALEAEKLSARMLLQVHDELIFEVEEAEIEKTLPVVVSVMEDAAMPAISMRVPLKVDAR
FT                   AADNWDEAH"
FT   gene            116299..117018
FT                   /locus_tag="Atu0111"
FT                   /old_locus_tag="AGR_C_171"
FT   CDS_pept        116299..117018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0111"
FT                   /old_locus_tag="AGR_C_171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85932"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012390"
FT                   /db_xref="InterPro:IPR015069"
FT                   /db_xref="PDB:2FSQ"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP4"
FT                   /protein_id="AAK85932.1"
FT                   /translation="MHAPLVSKDLDYISTANHDQPPRHLGSRFSAEGEFLPEPGNTVVC
FT                   HLVEGSQTESAIVSTRQRFLDMPEASQLAFTPVSSLHMTVFQGVIESRRALPYWPQTLP
FT                   LDTPIDAVTDYYRDRLSTFPTLPAFNMRVTGLRPVGMVMKGATAEDDSIVALWRDTFAD
FT                   FFGYRHPDHDTYEFHITLSYIVSWFEPECLPRWQAMLDEELEKLRVAAPVIQMRPPAFC
FT                   EFKDMNHFKELVVFDKR"
FT   gene            117212..117397
FT                   /gene="rpmF"
FT                   /locus_tag="Atu0112"
FT                   /old_locus_tag="AGR_C_173"
FT   CDS_pept        117212..117397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Atu0112"
FT                   /old_locus_tag="AGR_C_173"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85933"
FT                   /db_xref="GOA:Q8UJ26"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ26"
FT                   /protein_id="AAK85933.2"
FT                   /translation="MAVPKRKTSPSKRGMRRSADGLKSATYVEDKNSGELRRPHHIDLK
FT                   TGMYRGRQVLTPKESA"
FT   gene            117518..119386
FT                   /locus_tag="Atu0113"
FT                   /old_locus_tag="AGR_C_174"
FT   CDS_pept        117518..119386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0113"
FT                   /old_locus_tag="AGR_C_174"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85934"
FT                   /db_xref="GOA:Q7D262"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D262"
FT                   /protein_id="AAK85934.2"
FT                   /translation="MESGFEACGRRGVSVKYRWILLMFLGLGLGYGAVTRGGGIIAESY
FT                   FGEMSDQGHTTLRLAVSALGGLLSRYEPLPALIADHDDIEELVAHPKDEALRQRANVYL
FT                   KSINTLLESSDIYIITLDGETIAASNYDGPTSFVGENFSYRPYFQDAAKGLKSRFFALG
FT                   TTSHKRGYYFSAPILFNEEIKGVIVFKVDIEGIEASFGDGENRILVSDPEGIIFMTGTP
FT                   QWLYSGLMPLTPERLARTEASRRYANATLTELPLKNGNFGSHQLMTIAQNDGDREYMVL
FT                   SQPMQDAGWTVSVLMDTGSLRTQVKTAMIAIILCLCLAAALIAAMLQRRRRLRERLTHQ
FT                   AEAQAELERRVEERTADLARVNQEIKHEIAERRQTEKQLRKMQNDLVQAGKLAALGQMS
FT                   AALSHEFNQPLAAAKNYAENASLLVERGRLEEVTENLRRISGLIDRMASISKHLRNFAR
FT                   KPNEKTAAVGLETVIRDTLEIVGPRLKAADAMLDIDLGPVPLAVKAGPVRLQQVLVNII
FT                   SNAADAVEGREDRRISLQTVQHGQAVSIFIRDHGPGVPAAISERIFDPFFTTKGVGRGL
FT                   GLGLSISYNIIKDFGGQLRVKNHEESGAEFEIELPAAAWRTEAAAE"
FT   gene            119383..120729
FT                   /gene="dctD"
FT                   /locus_tag="Atu0114"
FT                   /old_locus_tag="AGR_C_178"
FT   CDS_pept        119383..120729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /locus_tag="Atu0114"
FT                   /old_locus_tag="AGR_C_178"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85935"
FT                   /db_xref="GOA:Q7D261"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D261"
FT                   /protein_id="AAK85935.2"
FT                   /translation="MTMSRVLLIDDEEELRFSTAQALELSGFAVTMLASAEHALELIGY
FT                   SFDGVVVSDIRMPGMDGMTLLQKVRELDPEIPVILMTGHGDVQLAVNAMRNGAYDFIEK
FT                   PFTPQYLAGIIKRANDRRALVLENRRLKAVAGKHDDLETRLPGRTQVMVDLRYRIRAIG
FT                   ATDADTLIVGDTGAGKEVVARALHDISARANRPFVAINCAALPQTLIESELFGHEAGAF
FT                   PGALRSRYGKFEHARGGTILLDEIGSMPFELQGRFLRVLQERVITRLGSNETVELDVRF
FT                   IATSKVDLEQEVAAGRFRADLLYRLNVATLLVPSLSQRSADIPLLFLHLVREAAARYGR
FT                   EDMDVPQHLLSAVSLREWPGNVRELRNAADRFVLGLESDVSEVSLALDDDGTSTLAPRV
FT                   AAYEKSLIAHAIAVHGGNLKSVYESLGISRKTLYEKMQKYGLHRHMTEV"
FT   gene            120729..120932
FT                   /locus_tag="Atu0115"
FT   CDS_pept        120729..120932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41140"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UJ23"
FT                   /protein_id="AAL41140.1"
FT                   /translation="MGGFPPMDEALWVEIHPLPSIDSDKSGWREESAVAERRSRIANTV
FT                   TPAAMEEHARLKWRSFSSGRNR"
FT   gene            121502..121912
FT                   /locus_tag="Atu0116"
FT                   /old_locus_tag="AGR_C_180"
FT   CDS_pept        121502..121912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0116"
FT                   /old_locus_tag="AGR_C_180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85936"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D260"
FT                   /protein_id="AAK85936.2"
FT                   /translation="MTDLLGGQVDIMCDQTTNTTKQIQGGTVKAYAVTTAKRLDVLPDV
FT                   PTVVEAGLPKLEVGIWHGIYTPKGTPAEINEKLSKSLQVALKDKNVAARFAELGTTPSS
FT                   ESDATPAALKAKLESEIARWKPVIESAGQYAD"
FT   gene            122012..122473
FT                   /locus_tag="Atu0117"
FT                   /old_locus_tag="AGR_C_182"
FT   CDS_pept        122012..122473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0117"
FT                   /old_locus_tag="AGR_C_182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85937"
FT                   /db_xref="GOA:A9CKP3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP3"
FT                   /protein_id="AAK85937.1"
FT                   /translation="MKSLFNDPAEAICGAIFMGLGVFFALQSYGLEIGTAFRMGPGYFP
FT                   LVLAIILILLGGIIFLRSARPAGEGIGAIAWRGIFFILPAPIFFGFTVRGLGFVPALFF
FT                   SALIASFASHKMSPLMAVILSAAITVFSVAVFNYGLGLPFQRFGPWLKF"
FT   gene            122483..123988
FT                   /locus_tag="Atu0118"
FT                   /old_locus_tag="AGR_C_184"
FT   CDS_pept        122483..123988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0118"
FT                   /old_locus_tag="AGR_C_184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85938"
FT                   /db_xref="GOA:A9CKP2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP2"
FT                   /protein_id="AAK85938.1"
FT                   /translation="MDLLNNLALGFVTASSLANLFFCLIGVLLGTLIGVLPGIGATATI
FT                   AMLLPITFQLEPVSSLIMLAGIYYGAQYGGSTTAILINMPGESSSAVTAIDGYQMARKG
FT                   KAGAALAIAAIGSFFAGTVSTFLVAIFAPPLTAIALEFGAAEYFSLMVVGLVSSIALAH
FT                   GSIVKALAMVVLGLLLGLVGTDIYSGTPRFTLGIREYADGLNFVAVAVGVFGIAEILRN
FT                   LENERTRSVLIAKVSSLMPSKEDFKAMIGPVLRGTAIGSALGILPGGGAILAAFASYTV
FT                   EKRVSKNPEEFGHGAVAGVAGPESANNAGAQTSFIPLLTLGIPANPVMALMIGAMIIQG
FT                   IVPGPNVATEQPALFWGIIASMWIGNLMLVILNLPLIGLWVKLLTVPYYVLFPIIMAFC
FT                   AIGVYSVNSNVFDLYAVAFFGFIGYVLVKLRCEPAPLLLGFVLGPLLEENLRRAMILSR
FT                   GDPTTFVTRPISATLLFIALAVLIIVFLPSVKKKREEVFVEED"
FT   gene            124135..124347
FT                   /locus_tag="Atu0119"
FT                   /old_locus_tag="AGR_C_187"
FT   CDS_pept        124135..124347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0119"
FT                   /old_locus_tag="AGR_C_187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85939"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ19"
FT                   /protein_id="AAK85939.2"
FT                   /translation="MTSETEKRIIALEETIAHQAKTIEELSDQLAEQWKVVEQTRAKLD
FT                   RLTERFLSLEEQSLDAPAITRPPHY"
FT   gene            124361..124912
FT                   /locus_tag="Atu0120"
FT                   /old_locus_tag="AGR_C_189"
FT   CDS_pept        124361..124912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0120"
FT                   /old_locus_tag="AGR_C_189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85940"
FT                   /db_xref="GOA:A9CKP1"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="PDB:2I6H"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP1"
FT                   /protein_id="AAK85940.1"
FT                   /translation="MKNDTAALAADIVDFWKKAGPDKWFDKDAAFDNHFHDRFRDAHFA
FT                   AARRELDGWLEGAESSLALMLLLDQFPRNCFRGTAHMYATDPLARFFADEAIRRGHDQA
FT                   VSEDLRVFFYLPFSHAEDIAAQQRACDLNQPLGGLYLHHAEEHRDIVERFGRFPHRNGI
FT                   LLRETTPEERQYLEEGGFSG"
FT   gene            complement(124981..126114)
FT                   /gene="dnaJ"
FT                   /locus_tag="Atu0121"
FT                   /old_locus_tag="AGR_C_192"
FT   CDS_pept        complement(124981..126114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="Atu0121"
FT                   /old_locus_tag="AGR_C_192"
FT                   /product="molecular chaperone, DnaJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85941"
FT                   /db_xref="GOA:P50018"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50018"
FT                   /protein_id="AAK85941.1"
FT                   /translation="MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPDDADSER
FT                   KFKEINEAYETLKDPQKRAAYDRFGHAAFENGGMGGGGMGGGGFANGGFSDIFEDIFGE
FT                   MMGGGRARRSSGGRERGADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSGAKPGT
FT                   QPKTCATCQGSGRVRAAQGFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTEERSLSVN
FT                   IPSGIEDGTRIRLQGEGEAGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPISMTTA
FT                   ALGGTFDVTTLDGTKSRVTVPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQK
FT                   LSKRQRELLQEFEQLSSKENNPESTGFFARMKEFFDG"
FT   gene            complement(126205..128106)
FT                   /gene="dnaK"
FT                   /locus_tag="Atu0122"
FT                   /old_locus_tag="AGR_C_195"
FT   CDS_pept        complement(126205..128106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="Atu0122"
FT                   /old_locus_tag="AGR_C_195"
FT                   /product="DNAK Protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85942"
FT                   /db_xref="GOA:P50019"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50019"
FT                   /protein_id="AAK85942.1"
FT                   /translation="MAKVIGIDLGTTNSCVAVMDGKDTKVIENAEGARTTPSMVAFSDD
FT                   GERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKALVPFEIVKGDNGDAWVK
FT                   AQDKNYSPSQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISVLEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVEYLAGEFKKDQGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFI
FT                   TADASGPKHLTLKLTRAKFESLVDDLVQRTVAPCKAALKDAGVTAAEIDEVVLVGGMSR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIDRNTTIPTKKSQTFSTAEDNQSAVTIRVSQGEREMAQDNKLLGQFDLVGLP
FT                   PSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEAN
FT                   AEADKKRRAGVEAKNQAESLIHSTEKSVKEYGDKVSETDRKAIEDAIASLKTAVEAAEP
FT                   DADDIQAKTQTLMEVSMKLGQAIYEAQQAEAGDASAEGKDDVVDADYEEIKDDKKSA"
FT   gene            complement(128413..128502)
FT                   /locus_tag="Atu0123"
FT   tRNA            complement(128413..128502)
FT                   /locus_tag="Atu0123"
FT                   /product="tRNA-Ser"
FT   gene            128724..129041
FT                   /locus_tag="Atu0124"
FT                   /old_locus_tag="AGR_C_196"
FT   CDS_pept        128724..129041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0124"
FT                   /old_locus_tag="AGR_C_196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85944"
FT                   /db_xref="GOA:A9CKP0"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKP0"
FT                   /protein_id="AAK85944.2"
FT                   /translation="MKAFLRFLSFLLLIAAIFLGVLDSIRSVSTSSVNITGILSVWNYL
FT                   LPASRTMVEAALAHYIHPEAWRFFENALSGVPAFALFLALSLLCWMAGYRKRKVMRRSS
FT                   V"
FT   gene            129114..129764
FT                   /gene="msrA"
FT                   /locus_tag="Atu0125"
FT                   /old_locus_tag="AGR_C_197"
FT   CDS_pept        129114..129764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Atu0125"
FT                   /old_locus_tag="AGR_C_197"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85945"
FT                   /db_xref="GOA:Q7D255"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D255"
FT                   /protein_id="AAK85945.2"
FT                   /translation="MFLFDTLSKKTTMPTEETALPGREEALAVPETHFVNGRPLKGPYP
FT                   DGLEIIYLGMGCFWGAERLFWKTPGVWVTAVGYAGGFTRNPTYHETTTGQTGHAEVVKV
FT                   VYDPAVISLSGLLKIFFEEHDPTQGMRQGNDVGTTYRSAIYATTEGQLQQAQKARDAFQ
FT                   QALDEAGHGHAITTEIGPLETFYYAEDYHQQYLAKNPGGYCGLRGTGVSCNIG"
FT   gene            129978..130970
FT                   /locus_tag="Atu0126"
FT                   /old_locus_tag="AGR_C_200"
FT   CDS_pept        129978..130970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0126"
FT                   /old_locus_tag="AGR_C_200"
FT                   /product="membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85947"
FT                   /db_xref="GOA:A9CKN9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN9"
FT                   /protein_id="AAK85947.2"
FT                   /translation="MKKSLLTLFALAAMSASALAADIKPALVYGTGGKFDKSFNEAAAA
FT                   GAEKFKAETGIDFRDFEPTSDTQGEQAIRNFASKGFNPVVAVSFAWTSAMEKVAAEFPD
FT                   TKFVIVDSVVELPNVRSVVYKEHEGSYLVGLLAGMASKTGKVGFIGGMDIPLIRKFACG
FT                   YAQGAKAANDKIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVIYAAAGATGIGVL
FT                   QTAADNKKFSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYKDAKDDKFTPGIVALGVK
FT                   EDGVAYALDDNNKALITPEMTAAVDKAKADIIAGTVKVHDYMADNSCPK"
FT   gene            131053..132558
FT                   /locus_tag="Atu0127"
FT                   /old_locus_tag="AGR_C_202"
FT   CDS_pept        131053..132558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0127"
FT                   /old_locus_tag="AGR_C_202"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (sugar/ribonucleotide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85948"
FT                   /db_xref="GOA:Q7D253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D253"
FT                   /protein_id="AAK85948.2"
FT                   /translation="MDPAIELMGIDKKFGAVHANKNINLSVAKGTIHGIIGENGAGKST
FT                   LMSILYGFYQADAGEIRVNGKPVTIRDSQAAISAGIGMVHQHFMLVENFTVLENVMLGA
FT                   EGGALLARGRAGARRELKRLEDDYGLEVDPDAVIEELPVGLQQRVEILKAMYRGAEILI
FT                   LDEPTGVLTPAEADHLFKILGVLREQGKTIILITHKLREIMAITDSVSVMRRGEMVATR
FT                   KTSETSVEELAELMVGRRVLLRVEKGETTPGDVLLSIRNLTVKDSRGVTMVDDVSLDVR
FT                   AGEIVGIAGVAGNGQSELLEAIAGIRKPYSGEIWVDGQKVDRPDPAILRKLGLAHIPED
FT                   RHHMGLVLKFEEYENSILGYHHDERYGKGPFLNPEAIRKDAVEKIEKYDIRPPNPQLKT
FT                   ANFSGGNQQKIVVAREIERDPKMLIIGQPTRGVDIGAIEFIHRRIIEMRDAGKAILLVS
FT                   VELDEIRSLSDRIMVMFAGRVVGEKTAEAEEQTLGLMMAGIAA"
FT   gene            132566..133669
FT                   /locus_tag="Atu0128"
FT                   /old_locus_tag="AGR_C_205"
FT   CDS_pept        132566..133669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0128"
FT                   /old_locus_tag="AGR_C_205"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (sugar/ribonucleotide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85949"
FT                   /db_xref="GOA:A9CKN8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN8"
FT                   /protein_id="AAK85949.1"
FT                   /translation="MSTASTPLPNWISYGLLPLLNVVTAFLISGLVVWSIGENPLAALR
FT                   LLIEGALGRGDAIGFTLFYTTSFIFTGLSVAVAFHAGLFNIGSEGQAYVGGLGAALVAL
FT                   ALDRYVPWYVTMPFAVIGAAVFGAAWAFIPAWLQAKRGSHVVITTIMFNFIAAALMVYL
FT                   LVNVLIVPGKMAPETRTFLPGGQLPKLDWLMAWFGLKLGPAPFNVSFLIALVMCFLVWV
FT                   LIWRTKLGYEMRTLGVSPSAAIYAGIPYSRTVIIAMLISGGLAGMMALNPVMGASARLQ
FT                   VEFVGGAGFVGIAVSLMGRSHPLGIIFSALLFGILYQGGADLSFEMPNITREMIVVIQG
FT                   LVILFAGALEYMYRPAIVHIYQRLAKG"
FT   gene            133676..134647
FT                   /locus_tag="Atu0129"
FT                   /old_locus_tag="AGR_C_207"
FT   CDS_pept        133676..134647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0129"
FT                   /old_locus_tag="AGR_C_207"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (sugar/ribonucleotide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85950"
FT                   /db_xref="GOA:A9CKN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN7"
FT                   /protein_id="AAK85950.1"
FT                   /translation="MDFFDMLVSILGSTVRLTIPLLFTALAGLFSERAGVFDIGLEGKM
FT                   LAAAFASACVAYLTANPWAGLLAGIGVSILFSLIHGFAVITNRGNQIVSGVALNFIAAG
FT                   LTVVLGQAWFGQGGRTPQLPGEGRFAPIILPGADAMREVPFIGPLYANVISGNNILTYL
FT                   AFLAVPLSWWVLYRTRFGLRLRAVGENPGAVDTAGISVTWMRYRAVIVAGFLCGFSGAY
FT                   LAVAQSAAFIANMSAGKGYIALAALIFAKWKPVPVMFACLLFGFLDAFANFMQGKSVPG
FT                   IGEVPVQIFQAMPYILTCILLAGFIGVAKPPKAGGVAYAKER"
FT   gene            134652..135056
FT                   /gene="cdd"
FT                   /locus_tag="Atu0130"
FT                   /old_locus_tag="AGR_C_209"
FT   CDS_pept        134652..135056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="Atu0130"
FT                   /old_locus_tag="AGR_C_209"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85951"
FT                   /db_xref="GOA:Q7D250"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D250"
FT                   /protein_id="AAK85951.2"
FT                   /translation="MSSDPKSHALFEAAVEAMAFAYAPYSKFPVGAAIRAEDGKIYTGA
FT                   NIENISFPQGWCAEPSAISAMIMGGAKKISEVAVIAEKLPLCSPCGGCRQKIAEFATPE
FT                   TKIYLCDETGVQKVMTMEELLPSVFKTELP"
FT   gene            135056..135856
FT                   /gene="deoD"
FT                   /locus_tag="Atu0131"
FT                   /old_locus_tag="AGR_C_210"
FT   CDS_pept        135056..135856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="Atu0131"
FT                   /old_locus_tag="AGR_C_210"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85952"
FT                   /db_xref="GOA:A9CKN6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN6"
FT                   /protein_id="AAK85952.1"
FT                   /translation="MTDGLIDILVERLNGLMPRVAIVLGSGLGSLVEEVSDPIRVPYAN
FT                   LPGFPTSGVSGHAGELVAGYLGGEPVMMLSGRVHYYEKGDPAAMRAVIEALAGLGVQSL
FT                   ILTNSAGSVRQDMPPGSVMQITDHINYSGMNPLIGEESDRRFVGMTTAYDPDLMLAMRN
FT                   AAIRATVPLFGGVYMWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFFGMRVAA
FT                   ASVITNYGAGMTGAELSHEETKDMAPVGGKRLAAILKEMIAGGA"
FT   gene            135859..136632
FT                   /gene="deoC"
FT                   /locus_tag="Atu0132"
FT                   /old_locus_tag="AGR_C_211"
FT   CDS_pept        135859..136632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="Atu0132"
FT                   /old_locus_tag="AGR_C_211"
FT                   /product="2-deoxyribose-5-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85953"
FT                   /db_xref="GOA:Q8UJ09"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ09"
FT                   /protein_id="AAK85953.2"
FT                   /translation="MELQRPREAAALTLSLLDLTNLREDCTPQQIATLCQRAHTEFGNT
FT                   AAICIWPRFVAQARAAFGKDHTIRIATVVNFPSGDLDVATVVAETEAAIGDGADEIDLV
FT                   IPYRKFMAGDESAVAEMIAAVRKACAAPVLLKVILETGELKDKALIRRASEIAIAEGAD
FT                   FIKTSTGKVAVNATLEAADIMLQAIRDSKKKVGFKPAGGIGTVEDATLYLRLAETIMAP
FT                   NWAMPSTFRFGASGVLDDVLNVLAGGEPAKAASGY"
FT   gene            136629..137945
FT                   /gene="deoA"
FT                   /locus_tag="Atu0133"
FT                   /old_locus_tag="AGR_C_214"
FT   CDS_pept        136629..137945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="Atu0133"
FT                   /old_locus_tag="AGR_C_214"
FT                   /product="thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85954"
FT                   /db_xref="GOA:Q8UJ08"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ08"
FT                   /protein_id="AAK85954.1"
FT                   /translation="MSLIPQEIIRRKRDGLSLAPQEIAAFIEALSKDGISEGQAAAFAM
FT                   AVFFRGMNRDEMVALTLAMRDSGDVLSWRDIGRPVADKHSTGGVGDNVSLMLAPIVAAC
FT                   GLAVPMISGRGLGHTGGTLDKLEAIPGYDVMPDEALFRRTVQSVGCAIIGQTGDLAPAD
FT                   KRLYAIRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMQSLEDARILARA
FT                   LVDVANGAGLPTTALITDMNQPLCDAAGNAVEIVNCLEFLAGGKAGTRLEKVVLSFAAE
FT                   MLVQARKAATLEEGEALASAALSSGRAMEIFARMVSVLGGPSDFIENPSRYLACAPIIL
FT                   PVPAARSGWLASCATRDLGMVVVELGGGRTKPSDTINPAVGISDILPLGVRVEKGEPIA
FT                   VVHAASSEDAERAVKRIEDCFGIADNAPEIAASVLERIT"
FT   gene            complement(137938..138474)
FT                   /locus_tag="Atu0134"
FT                   /old_locus_tag="AGR_C_215"
FT   CDS_pept        complement(137938..138474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0134"
FT                   /old_locus_tag="AGR_C_215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85955"
FT                   /db_xref="GOA:Q7D247"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D247"
FT                   /protein_id="AAK85955.2"
FT                   /translation="MRSNHLLARAIFLLVGLSVSATQIPALMEKFQPHPETGAAKSGAT
FT                   AEASRPQPVSLGSVSLKADERGHFNATFRINGKSFDGLVDTGASMVAINETMARRLGYG
FT                   VNSLDFKYAISTANGQTLAAHVKLDRVEIGAIRVQNVDTMVLKDNALSNMLVGMSFLKQ
FT                   LSSFKVSGGEMRLVR"
FT   gene            complement(138594..139223)
FT                   /gene="upp"
FT                   /locus_tag="Atu0135"
FT                   /old_locus_tag="AGR_C_216"
FT   CDS_pept        complement(138594..139223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="Atu0135"
FT                   /old_locus_tag="AGR_C_216"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85956"
FT                   /db_xref="GOA:Q8UJ06"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ06"
FT                   /protein_id="AAK85956.1"
FT                   /translation="MDGVTVIEHPLVRHKLTIMRKKETSTAGFRRLLREISTLLCYEVT
FT                   RDLEMTMETIDTPLETIQAPVLEGKKLVFASILRAGNGLLEGMLELVPSARVAHVGVYR
FT                   DHDTLEAVEYYFKAPESLDARLVIVVDPMLATGNSSIAAVEKLKERGAKNIRFLCLLAA
FT                   PEGIKNFREAHPDVPIYTAAIDRHLNEKGYIVPGLGDAGDRMYGTK"
FT   gene            complement(139319..140296)
FT                   /gene="add"
FT                   /locus_tag="Atu0136"
FT                   /old_locus_tag="AGR_C_218"
FT   CDS_pept        complement(139319..140296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="Atu0136"
FT                   /old_locus_tag="AGR_C_218"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85957"
FT                   /db_xref="GOA:Q8UJ05"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ05"
FT                   /protein_id="AAK85957.1"
FT                   /translation="MTSHLLKAEIHCHLEGAAPPALVVKQAEKYGIDTSGFLRDGQYVW
FT                   SDFAEFIQCYDAVAQVFKSDEDYAVLTETYLTELAEANTIYSELIISPDHGDRIGLGAD
FT                   AYLAGVAEGIRIAKEKTGIETRIIVTGERHFGPERVIAAAEYAARIRHPLVTGFNMAGE
FT                   ERMGRVADYARAFDIARDAGLGLTIHAGEVCGPESVADALDLVKPSRIGHGVRAIEDAA
FT                   LISRLVETGTVLEVCPGSNIALSVYPDFASHPLKALSDAGVRVCISSDDPPFFFTSLAR
FT                   EYALAADAFGFNDAEINRMTRTALECAFVDEATRERLLARLGDA"
FT   gene            complement(140293..141513)
FT                   /gene="drm"
FT                   /locus_tag="Atu0137"
FT                   /old_locus_tag="AGR_C_219"
FT   CDS_pept        complement(140293..141513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drm"
FT                   /locus_tag="Atu0137"
FT                   /old_locus_tag="AGR_C_219"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85958"
FT                   /db_xref="GOA:Q8UJ04"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UJ04"
FT                   /protein_id="AAK85958.1"
FT                   /translation="MARAFLLVLDSFGVGGAPDAERYGDLGANTLGHIAEFCAAGAADR
FT                   AGLRAGPLKLPNMCSLGLLEIARQASGDIPAGMEPPERIFGLHGSASEISKGKDTPSGH
FT                   WEIAGTPVTFDWGYFPTEGDAFSPELVEAICRQADIPGILGNCHASGTEIIAALGEEHI
FT                   RSGKPICYTSSDSVFQIAAHETHFGLDRLIALCETVRKLLDPLNIGRVIARPFIGETVA
FT                   TFERTGNRRDFSVPPPEPTLLDRLVEAGRKVHAIGKIGDIYAHQGVTRVIKANGNAALM
FT                   DATLHAIDEAENGDLVFTNFVDFDMLYGHRRDVAGYAAALEAFDARIPEIHRKMAPGDI
FT                   ALLTADHGCDPTWRGTDHTRERVPIMAFGPGIRSRDVGIRSSYADIGESIAHHLGIEAG
FT                   SHGRSFI"
FT   gene            complement(141629..142459)
FT                   /gene="surf"
FT                   /locus_tag="Atu0138"
FT                   /old_locus_tag="AGR_C_221"
FT   CDS_pept        complement(141629..142459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surf"
FT                   /locus_tag="Atu0138"
FT                   /old_locus_tag="AGR_C_221"
FT                   /product="surfeit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85959"
FT                   /db_xref="GOA:Q7D246"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D246"
FT                   /protein_id="AAK85959.2"
FT                   /translation="MRAERGPPKQTISLPVALRKDRDMSEIAPQNRRIRPAAIVVLFLT
FT                   IALTGCLLALGTWQVQRLFWKLDLIERVDVRAHAEPVDAPAASDWPALGNPSDYEYRRV
FT                   KLTGTLLNDREVQVYTVTDLGPGYWVMTPLRRDDGSSIIVNRGFVPSDRRDPSSRTGGE
FT                   PTGNVEIVGLMRAPETGGLFLRTNDPANGRWYSRNIPQITQASGLSDVAPFYVDADATP
FT                   NPGGLPVGGKTMLTFPNNHLSYAVTWYILAAMVVAAGWYVLRNLNAPKSKRDAD"
FT   gene            complement(142569..142961)
FT                   /gene="cyoD"
FT                   /locus_tag="Atu0139"
FT                   /old_locus_tag="AGR_C_223"
FT   CDS_pept        complement(142569..142961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="Atu0139"
FT                   /old_locus_tag="AGR_C_223"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85960"
FT                   /db_xref="GOA:Q7D245"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D245"
FT                   /protein_id="AAK85960.2"
FT                   /translation="MSSEAHAHHDAHGDDHHHDGASHGTFKSYMIGFVLSVILTAIPFW
FT                   LVMGGVLENKTLLVIAIMGLGVIQIFVHMIYFLHMDTRSEGGWTFMALIFTVVVLLITL
FT                   SGSLWVMYNMNKNMMPLHIEDVKNLP"
FT   gene            complement(142961..143587)
FT                   /gene="cyoC"
FT                   /locus_tag="Atu0140"
FT                   /old_locus_tag="AGR_C_225"
FT   CDS_pept        complement(142961..143587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="Atu0140"
FT                   /old_locus_tag="AGR_C_225"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85961"
FT                   /db_xref="GOA:A9CKN5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN5"
FT                   /protein_id="AAK85961.1"
FT                   /translation="MAHTPAQSVDGAEPPVFYLKEDHHPENGTSIGFWLYLMSDCLIFA
FT                   VLFATYAVLGRSYAAGPSGADLFDLKLVAINTGFLLLSSITYGFAMLEMEKQKVKSTLI
FT                   WLGITGLFGLAFLAVELYEFHHLIEEGAGPQRSAFLSAFFALVGTHGLHVTFGTIWLVT
FT                   LMVQVAKHGLIAANKRRLMCLSMFWHFLDVIWIGVFSFVYLMGVL"
FT   gene            complement(143594..145597)
FT                   /gene="cyoB"
FT                   /locus_tag="Atu0141"
FT                   /old_locus_tag="AGR_C_227"
FT   CDS_pept        complement(143594..145597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="Atu0141"
FT                   /old_locus_tag="AGR_C_227"
FT                   /product="cytochrome O ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85962"
FT                   /db_xref="GOA:A9CKN4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN4"
FT                   /protein_id="AAK85962.1"
FT                   /translation="MIVNSDQTSFLFGKLTWESIPLHEPILVATFAAVALGGIVVVGAL
FT                   TYFRLWGYLWNEWFTSIDHKKIGIMYIILALVMLLRGFADAIMMRVQQAIASGGSEGYL
FT                   PPHHYDQIFTAHGVIMIFFMAMPMITGLMNFVVPLQIGARDVSFPFLNNFSFWMTTAGA
FT                   IITMISLFVGEYAQTGWLAYPPLSGIDGSPGVGVDYYIWGLQIAGVGTTLSGINLIVTI
FT                   IKMRAPGMTMMRMPIFVWTSLCSNILIVASFPILTATLALLTLDRYAGTNFFTNDLGGN
FT                   PMMYVNLIWIWGHPEVYILVLPAFGIFSEIVATFSGKRLFGYASMVYATAVITILSYLV
FT                   WLHHFFTMGSGANVNAFFGITTMIISIPTGAKIFNWLFTMYKGRIKFDVPMLWTIGFMI
FT                   TFVIGGMTGVLLAVPPADFVLHNSLFLIAHFHNTIIGGVVFGVLAGIVYWFPKAFGYRL
FT                   DPFWGKLSFWFWFIGFYFAFMPLYILGLMGITRRISQFEDNSLQIWFVIAAFGAFLIAL
FT                   GIASFIIQLIVSFLKRDQLRDVTGDPYNARTLEWSTSSPPPQYNFAFTPVIHDVDAWHD
FT                   MKKRGYSRPLDGFIPIHMPKNTGAGVIISAISVVLGFALVWHIWWLAALSFIGVIAVSI
FT                   AHTFNYNRDYYIPASDVSTVEAERTKLLAKQA"
FT   gene            complement(145674..146672)
FT                   /gene="cyoA"
FT                   /locus_tag="Atu0142"
FT                   /old_locus_tag="AGR_C_230"
FT   CDS_pept        complement(145674..146672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="Atu0142"
FT                   /old_locus_tag="AGR_C_230"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85963"
FT                   /db_xref="GOA:Q7D242"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D242"
FT                   /protein_id="AAK85963.2"
FT                   /translation="MNPSGDVAIQQRDLIITSTVLMLLIIVPVIVLTLFFAWKYRESAK
FT                   AEDYDPEWHHSTRLEMVIWSAPVAIILMLGTVTWISTHRLDPYRPLERIDENRQVTADI
FT                   KPITVEVVAMDWKWLFFYPELGIGSVNEFAAPVDVPINFKITGTTAMNSFFVPALAGQI
FT                   YAMGGMQTKLHAVINKEGVYDGISANFSGPGFSHMRFKFHGLSQQGFDQWVAKVKEGGK
FT                   GFGRQEYLEFAKPSEREPVQYFASVDPELYSAILNRCVEPNKLCMRDMMHIDANGGGGK
FT                   EGIDIAKALNSVVCTPLAPYGVASGPQSTPAAIKGQTFEPAALPETKQVAG"
FT   gene            147053..148375
FT                   /locus_tag="Atu0143"
FT                   /old_locus_tag="AGR_C_231"
FT   CDS_pept        147053..148375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0143"
FT                   /old_locus_tag="AGR_C_231"
FT                   /product="MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85964"
FT                   /db_xref="GOA:A9CKN3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN3"
FT                   /protein_id="AAK85964.1"
FT                   /translation="MSYTNAAPSFGQAPEANGAGPTSVDPDRITIAVILARMTEFFDFF
FT                   IYAIASALVFPHVFFSFVDPLTATLYSFAVFSLAFIARPIGSLIFLQIDRKFGRAVKLM
FT                   AALFTLCGSTMAISFLPSYDEAGMLAPCLLAAFRIGQGLGLGGAWDGLVSLLAMNAPQK
FT                   QRGWYAMMPQIGAAMGFGLASAFFIVFVTQLSNAEFLAWGWRFPFFVALALNVLALFAR
FT                   LRMIVTPEFQAMLEQHELEPRPMFRMLRSQFPVVLTGAFVPLASFALFHLVTVFPLSWV
FT                   SLNTSQRVSDFLFVQFVSAIICGGMIVVSGILADRIGRRKLLAIAAALIGLFSLVAPVL
FT                   LSSGDIGRYLFVLIGFSLLGLSFGQAGGALASRFSREYRYTGASLTSDISWLIGAGFAP
FT                   LVALGFSSKFGLFAVGIYLMSGAVCTLVALWFSRTLEMPSE"
FT   gene            148441..148662
FT                   /locus_tag="Atu0144"
FT   CDS_pept        148441..148662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41168"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIZ7"
FT                   /protein_id="AAL41168.1"
FT                   /translation="MFFYCVTAILILTRHIMKYYVSNTDIIQCVLLPECRSPGNAMRTT
FT                   TIIICEKAAIAATPLDGRKTTVRAIKRR"
FT   gene            148937..154285
FT                   /gene="gltB"
FT                   /locus_tag="Atu0145"
FT                   /old_locus_tag="AGR_C_235"
FT   CDS_pept        148937..154285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="Atu0145"
FT                   /old_locus_tag="AGR_C_235"
FT                   /product="glutamate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85965"
FT                   /db_xref="GOA:Q7D240"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D240"
FT                   /protein_id="AAK85965.2"
FT                   /translation="MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQN
FT                   PAFHGEAVGIIGNALKEQGFSVLLVRDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECAT
FT                   LAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSARTQVLKGRLNSQEVMPYFCDLTDP
FT                   RHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEAAVALAKNASIVR
FT                   PKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYEE
FT                   KNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRI
FT                   EAGGMLYYDHTERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRY
FT                   NGDLERHQRYVAYSHNQESFKFLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFS
FT                   QRFAQVTNPPLDSIREADGMTLRVALGAKPNSGAKKARQIVVRSPILTHLDMLRIREQP
FT                   ETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEEGGIAVVTDRHVSAGRA
FT                   ALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLGVQFRA
FT                   EEKFGADADKAFKRFAKAAEKSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRY
FT                   FPNVKTPVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYGTTAVR
FT                   GFVDMTEEKIGFDKGTENEEALRLLPLNRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEV
FT                   TPGYRAFSRMMAEERARRPAALRDVLELPADVTFAGSAEEFRREMGRFCRHGNNSFMVR
FT                   GLRCDEAADGSFRLQLIGPHGHELARLAALGQSLLDRFDDDIAGHWLEGGALMVQAKGE
FT                   AFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSHGALVAAAHEAVAHGTNMVGGMS
FT                   NSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQL
FT                   PSPKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEG
FT                   IGTIAVGVAKAGADVINVAGNTGGTGAAAVTSLKYTGRAAEIGIAEVHQALCATGLRAK
FT                   VLLRCSGAHQTASDVVKSALLGGDSFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAF
FT                   NGDPRALAQYLMNIAHETREILAGLGLRSLREARGRSDLLHLLDHPASVGQLDLRAMLA
FT                   VVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRFLNNCNKSVGGQLA
FT                   VDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGMIM
FT                   VHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDR
FT                   FAVRNSGATAVVEGVGDFACEYMTNGAVLNLGSFGKGFGNGMSGGFVYQYDPYGDLPKK
FT                   VSHDSILLGSITGEDEQAAIHNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGM
FT                   PRALLLYQDSDEILKAKPRKELLEELASALAGYQLRKFKLAYRDRKAVLNGTVPGYGET
FT                   DTEDMYALINNYTVLSMAQAIALQRLPMASGPSDPAIEKAVRNLILTEDYALMQRLLKY
FT                   AREALSDHSDQQLAVMIAAKRLDDYKQALARRNIWSVDSPGTYGWIIQQNRKNIEKIGR
FT                   LPGFEELFAARAIPDLATASSHSRAA"
FT   gene            154282..156051
FT                   /gene="cysJ"
FT                   /locus_tag="Atu0146"
FT                   /old_locus_tag="AGR_C_238"
FT   CDS_pept        154282..156051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="Atu0146"
FT                   /old_locus_tag="AGR_C_238"
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85966"
FT                   /db_xref="GOA:A9CKN2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN2"
FT                   /protein_id="AAK85966.1"
FT                   /translation="MMKIPYIPQDAPFNGDQRAWLAGFLAGLHSRTAIGLETSVAAAAP
FT                   KSAASVLNILVGTQTGNAEALAMDIAAAARTQGMQPVVTALDDVSMDSLGSMKRVIVVT
FT                   STYGEGEMPDNAQLFWEALAADSAPRLDEMNFAVLALGDTGYDGFCQAGKLIDTRFEQL
FT                   GGRRMKARIDCDIDFEDAAAAWIGEALPLALAVDGGKEAAVTMPDIAAQPTRAKSGWSR
FT                   KNPYPATVGVNRRLSGSGSSKEIRHYEFDLRESGLDYEAGDALGVVPLNNPKLAGALLG
FT                   HFGAVGDSQVAGLDRPVGDALLNIYEISTPSRELVAEIGKRAGHEELSHILANGDKEQL
FT                   AAFLWSKDILDLLNLGGKPLFELAEFVTFLKPLQHRAYSISSSPLLAKDSVHLTIASVR
FT                   YRAEGRERGGVCSTYLADRVEAGQSAGIFVSPNKAFRVPQDDNAPVIMVGPGTGIAPFR
FT                   AFLQERQARGARGKNWLFFGDQHRQSDFIYENELGDMSRDGVLTRLDLAFSRDQAEKIY
FT                   VQTRMRQNGKALYQWLEEGGYFYVCGDATRMAKDVDDALHSIISDEAGISAEAASDYVN
FT                   RLKREKRYLRDVY"
FT   gene            complement(156090..156596)
FT                   /locus_tag="Atu0147"
FT                   /old_locus_tag="AGR_C_239"
FT   CDS_pept        complement(156090..156596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0147"
FT                   /old_locus_tag="AGR_C_239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85967"
FT                   /db_xref="GOA:Q7D238"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D238"
FT                   /protein_id="AAK85967.2"
FT                   /translation="MGAVEFAIVFPILLALYLTSFELTIGYNTYKRASSAAATINDLIS
FT                   KTGSVDKTYLTGMQDVAAAVFAPYSTKGLKLKISGIKIDAQKQAKITWSWDEKNLRPYA
FT                   VGSVVTVPTRLLVQDSFLIHVELSVPHELLMFMPDVASSGTKSITIGRDYFFKQRDAET
FT                   ACTNC"
FT   gene            complement(156680..157276)
FT                   /locus_tag="Atu0148"
FT                   /old_locus_tag="AGR_C_240"
FT   CDS_pept        complement(156680..157276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0148"
FT                   /old_locus_tag="AGR_C_240"
FT                   /product="Atu0148-1 mutant of a conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85968"
FT                   /db_xref="GOA:Q8U5N8"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5N8"
FT                   /protein_id="AAK85968.2"
FT                   /translation="MRLARLKPLLEKFGFSRDGTAAIEFAILAIPYFLVVFAIIETFIA
FT                   LMAEQVVANATETMSRRLRTGQISSSITKEDFRRSFCNEVSVMIACSEDEIKKEEKLYV
FT                   DLRSFTAFKDIPTTIPLKAYGEYYDLDTAQFGFKPGGPETINMLRVYYRWRVVADIIRP
FT                   YLTKIRPADGSMPSHFLIVATSAFMSEKYITGGGA"
FT   gene            complement(157461..158267)
FT                   /gene="fabI"
FT                   /locus_tag="Atu0149"
FT                   /old_locus_tag="AGR_C_242"
FT   CDS_pept        complement(157461..158267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="Atu0149"
FT                   /old_locus_tag="AGR_C_242"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85969"
FT                   /db_xref="GOA:Q7D237"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D237"
FT                   /protein_id="AAK85969.2"
FT                   /translation="MNGIMQGKRGLIMGVANNHSIAWGISKALAAQGAELAFTYQGEAL
FT                   GKRVKPLAAELGSDFIVPCDVEDIASVDALFATIREKWGALDFVVHAIGFSDKNELKGL
FT                   YANTTRENFSRTMVISCFSFTEIAKRAAELMTNGGSMLTLTYNGSQRVIPNYNVMGVAK
FT                   AALEASVRYLAADYGPRDIRVNAISAGPVRTLAGAGISDARAIYAWNQKNAPLRRTADI
FT                   DDIGGSALYLLSSLSRGVTGECHYVDCGYNITSTPTLEVLSKADAE"
FT   gene            complement(158274..159497)
FT                   /gene="fabB"
FT                   /locus_tag="Atu0150"
FT                   /old_locus_tag="AGR_C_244"
FT   CDS_pept        complement(158274..159497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="Atu0150"
FT                   /old_locus_tag="AGR_C_244"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85970"
FT                   /db_xref="GOA:Q7D236"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D236"
FT                   /protein_id="AAK85970.2"
FT                   /translation="MRRVVVTGLGIVSSIGGDAAEVTASLRQAKSGISFSPDFAEHGFK
FT                   CQVWGKPSLDPTDLVDRRAMRFLSQGGAWNHVAMKQAIADSGLEESDISGNERTGIIMG
FT                   SGGPSTRTIVEAADITLKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSAC
FT                   STSAHCIGNAAEMIQWGKQDVMFAGGHEDLDWSMSNLFDAMGAMSSKYNETPGVASRAY
FT                   DVNRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCM
FT                   RQALATVKGDIDYINTHGTSTPVGDSKEIGAIREVFGDKIPHIQSTKSLTGHSLGAAGV
FT                   QESIYGLLMMQERFIGESAHISELDPEFAGVPIVRSRIDDAKIDTILSNSFGFGGTNAT
FT                   LVFQRHNG"
FT   gene            complement(159573..160088)
FT                   /gene="fabA"
FT                   /locus_tag="Atu0151"
FT                   /old_locus_tag="AGR_C_246"
FT   CDS_pept        complement(159573..160088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="Atu0151"
FT                   /old_locus_tag="AGR_C_246"
FT                   /product="D-3-hydroxydecanoyl-(acyl carrier-protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85972"
FT                   /db_xref="GOA:Q7D235"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D235"
FT                   /protein_id="AAK85972.2"
FT                   /translation="MATRQSSYNYEEILSCGRGELFGPGNAQLPLPPMLMVHRITEISE
FT                   TGGAFDKGFIRAEYDVSPDDWYFPCHFQGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRG
FT                   MALSTGEVKFKGMVRPNTKLLQYGIDFKRVMRGRLVLGTADGWLKADGETIYQASDLRV
FT                   GLSKEKAA"
FT   gene            160159..160416
FT                   /locus_tag="Atu0152"
FT                   /old_locus_tag="AGR_C_247"
FT   CDS_pept        160159..160416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0152"
FT                   /old_locus_tag="AGR_C_247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85973"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D234"
FT                   /protein_id="AAK85973.2"
FT                   /translation="MQGQRPLRPHSLSSEPSLQKSLPQYAVRIQEPSGWNQRKFAGIAG
FT                   LQPFATLGDAETIESIPCKRYMLLQLTGFISLFGTGLHGI"
FT   gene            160406..160825
FT                   /gene="irr"
FT                   /locus_tag="Atu0153"
FT                   /old_locus_tag="AGR_C_249"
FT   CDS_pept        160406..160825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irr"
FT                   /locus_tag="Atu0153"
FT                   /old_locus_tag="AGR_C_249"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85974"
FT                   /db_xref="GOA:Q7D233"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D233"
FT                   /protein_id="AAK85974.2"
FT                   /translation="MAFDATLDIGTRLRRSGLRPTRQRVALGDLLFAKGDRHLTVEELH
FT                   DEAVTAGVPVSLATVYNTLHQFTEAGLIRVLAVEGARTYFDTNVSDHHHFFVEGENEVL
FT                   DIPINNLQIDNLPEAPEGMEIAHVDVVIRLRRKRG"
FT   gene            complement(160901..161539)
FT                   /locus_tag="Atu0154"
FT                   /old_locus_tag="AGR_C_252"
FT   CDS_pept        complement(160901..161539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0154"
FT                   /old_locus_tag="AGR_C_252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85975"
FT                   /db_xref="GOA:Q7D232"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D232"
FT                   /protein_id="AAK85975.2"
FT                   /translation="MTLLGFLDYAGVAVFAATGALAASRKQLDLIGFLFFAAATGIGGG
FT                   TVRDLVLGRTPVFWVINPTYILVCVSVAVLLFFTAHLFESRYRVLIWLDALGLSAYCVM
FT                   GAAKGLAASGSATVAIVTGVLTATFGGVLRDIMAGEPSVLLRPEIYITCALLGSSIFIV
FT                   VYFFGAPLYAASAAGFLTAFCVRSGALIFGWTFPPYKGKPGRRPEDVMK"
FT   gene            161618..162136
FT                   /locus_tag="Atu8116"
FT                   /old_locus_tag="AGR_C_253"
FT   CDS_pept        161618..162136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8116"
FT                   /old_locus_tag="AGR_C_253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8116"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5N6"
FT                   /protein_id="AAK85976.1"
FT                   /translation="MIATSITETDAKENAVRIALVAALQALVLLMFPVALSAQQQLVSD
FT                   PEIYEKDHFRNECKVAAFGDDFVTRLDINNDGLMDAVVNHGVLDCDGEKGRSCDDEGCP
FT                   YNFYVQVKEGGYLMIATARIYSYDFIKRFGNMVFVLKMHPRYCERTDKEPCLMTVRVRG
FT                   TKFVTISRK"
FT   gene            complement(162149..162859)
FT                   /locus_tag="Atu0156"
FT                   /old_locus_tag="AGR_C_254"
FT   CDS_pept        complement(162149..162859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0156"
FT                   /old_locus_tag="AGR_C_254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85977"
FT                   /db_xref="GOA:Q7D231"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D231"
FT                   /protein_id="AAK85977.2"
FT                   /translation="MTRQRRRNIIRARRTGTGIALVAAISFIAGMTDAVGLHLSGDFVS
FT                   FMTGNTTRAAISLEAGVYSHAAKLLFAIVAFVAGNAGGIVVAHKFDRSILAVLVGVGLL
FT                   VAIAALLRGDAFALTQFYLVVFAMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIGRFL
FT                   LGERSLDWGIQIVPWLGMISGAICGAVLGVTLQSGALWVVAATVFAVAVATLVIPRSLR
FT                   HRYNQRVRIRRIAP"
FT   gene            163006..164007
FT                   /locus_tag="Atu0157"
FT                   /old_locus_tag="AGR_C_256"
FT   CDS_pept        163006..164007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0157"
FT                   /old_locus_tag="AGR_C_256"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85978"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D230"
FT                   /protein_id="AAK85978.1"
FT                   /translation="MPQIKRKKYRTKINQKGVPIMKRTWVIAAIATLVSSASAYAETAV
FT                   TIGMSGWTGFAPLTLAKQAGIFEKNGLKVDIKKIPQASRHLALASGDIQCAATTVETWI
FT                   AWNANGVKSTQIFQMDKSHGADGIAVRSDVSKVADLKGKTVAASAPGTSPYFFLAWILK
FT                   ENGLTLKDVKVVNLEPGPAAQAFVAGQNDAAMTYEPYLSTVRAAPDKGKILATTLDYPA
FT                   VMDTFGCTPDFLKANPQAAKALADSYFQALELIKADPEKSYATMGADVKQAGEAFAASA
FT                   KFLEWQDKAANQKFFEGEFKTFSEKSADLLLEIGVIKSKPDLSTLADTSFIK"
FT   gene            164146..164919
FT                   /locus_tag="Atu0158"
FT                   /old_locus_tag="AGR_C_257"
FT   CDS_pept        164146..164919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0158"
FT                   /old_locus_tag="AGR_C_257"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85979"
FT                   /db_xref="GOA:A9CKN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN1"
FT                   /protein_id="AAK85979.1"
FT                   /translation="MQPLQPIKNSTRIILGILFFVLFFSAWGFATLGGFVSPTFLADPI
FT                   TMLKDGIYLLTDQGFAGDIGMTIWRVVGGFVLASLIAVPVGIAMGAYKPIEALLEPFVS
FT                   FARYLPASAFVPLLILWAGIGEMQKLLVIFIGAVFQIILMVAVAVAGTRRDLVEAAYTL
FT                   GAKDRGVVRRVLIPANAPDIAEILRLVLGWAWTYVIVAELIGASSGIGYMIINSQALMA
FT                   TGQIIFGIIVIGVIGLISDFAFKSLNRKLFAWRLA"
FT   gene            164919..165704
FT                   /locus_tag="Atu0159"
FT                   /old_locus_tag="AGR_C_259"
FT   CDS_pept        164919..165704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0159"
FT                   /old_locus_tag="AGR_C_259"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85980"
FT                   /db_xref="GOA:Q7D228"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D228"
FT                   /protein_id="AAK85980.2"
FT                   /translation="MSELVIKGVSRTFPGVQGGQPTLALQPTNLEIPRNDFVTILGPSG
FT                   CGKSTLLRIIAGLDRPTTGEVLLSGKAVTGPGADRGMVFQSYTLFPWLTIRENVAFGLR
FT                   ERGVAEKEKWEIVDSYIDKVGLRGFENHWPKQLSGGMQQRTAIARALANGPKILLLDEP
FT                   FGALDNQTRGLMQELLLGIWEREQKTVIFVTHDIEEAVFMASRVVTMSARPGRIKSITP
FT                   VDLPHPRHYTIKASPEFSELRAKLTEEIRSEAIAAAAHG"
FT   gene            165739..166476
FT                   /gene="hutC"
FT                   /locus_tag="Atu0160"
FT                   /old_locus_tag="AGR_C_262"
FT   CDS_pept        165739..166476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="Atu0160"
FT                   /old_locus_tag="AGR_C_262"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85981"
FT                   /db_xref="GOA:A9CKN0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKN0"
FT                   /protein_id="AAK85981.1"
FT                   /translation="MRSTGADLEEKSLHQRIRNDVERHIMSGEWPPGYRIPFEHEMTRQ
FT                   YGCSRMTVNKALGELVQRGLIERRRRLGTFVRQPHAQSAVLEIHDIEREVQAIGLVYGY
FT                   RLDKRRLRPAGKEDGAAMALAADAPVLELTCTHFAGGVPFCLEERIVNIAAVPEAEGTD
FT                   FSQVGPGTWLLKMVPWSAAEHRISAVSADRKNAVALGIASGAACLVIDRRTWHGADYIT
FT                   RVRVTYPGDRHALVAQFSPSQNS"
FT   gene            166742..167764
FT                   /gene="exbB"
FT                   /locus_tag="Atu0161"
FT                   /old_locus_tag="AGR_C_264"
FT   CDS_pept        166742..167764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="Atu0161"
FT                   /old_locus_tag="AGR_C_264"
FT                   /product="biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85982"
FT                   /db_xref="GOA:Q7D226"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D226"
FT                   /protein_id="AAK85982.1"
FT                   /translation="MAVTLLTGLSAGAVFAQQAPETQIQSAPPTETVQPSQAPVAPATP
FT                   SAPTAEPSPTAQPSSPQPAQFEQPAQTNQTPAPSETSTPVETVNAEPASAERRTDIPHN
FT                   LSPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRAKTL
FT                   AEATDAVENKGGPAALMLRMATHEMQLSDAVVEHTDGGGIKERVSSALSRIETHAGRRM
FT                   SRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNLAVVAPGIAEALLATAIGL
FT                   VAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSRDLDFRRIPPGSTSKPAVSLVGR
FT                   "
FT   gene            167771..168274
FT                   /gene="exbD"
FT                   /locus_tag="Atu0162"
FT                   /old_locus_tag="AGR_C_265"
FT   CDS_pept        167771..168274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="Atu0162"
FT                   /old_locus_tag="AGR_C_265"
FT                   /product="biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85983"
FT                   /db_xref="GOA:A9CKM9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM9"
FT                   /protein_id="AAK85983.1"
FT                   /translation="MAGGIRENSGDDLSENHEINVTPFIDVMLVLLIIFMVAAPLATVD
FT                   VNVDLPASTAKPAERPEEPLYLTVKDDLSLNLGNDAVAREALAAAIDRQTGGKKDTRIF
FT                   LRADKAVDYGHFMEIMNLLRDAGYLKIALVGLENAAAVSQPAGSTTAQPSGQPAAPAGQ
FT                   GTAP"
FT   gene            168271..169194
FT                   /gene="tonB"
FT                   /locus_tag="Atu0163"
FT                   /old_locus_tag="AGR_C_267"
FT   CDS_pept        168271..169194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="Atu0163"
FT                   /old_locus_tag="AGR_C_267"
FT                   /product="tonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85984"
FT                   /db_xref="GOA:A9CKM8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM8"
FT                   /protein_id="AAK85984.1"
FT                   /translation="MTENGFPQARHSRLGEVTLWSAAALLMLSVHAGFAYYLMQEPEEQ
FT                   DAGGQPPAAIMIEMAAIPEAVKTEETTQAQDVEDTREVKSESSEPVEEAAPEEPPPPEP
FT                   VAETPPPEPVQPPEPPVEEIVEPQEIPEPVEPIDPVQEQMMAELENVEVPLPVMRPPPP
FT                   RVEKKVEKKEPEEKKKVERQRPKPQQASEFRETAKAEAQQSNRTAASRSNAGFFSSSSV
FT                   SKADWDAKVRSAIKRRLARAAGKSGMAITVSFKIDSGGSVGGVSILSSTGNSAMDQKLL
FT                   AVIQKTSVSPPPPGVNPSFTLPVLFE"
FT   gene            169337..170326
FT                   /locus_tag="Atu0164"
FT                   /old_locus_tag="AGR_C_268"
FT   CDS_pept        169337..170326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0164"
FT                   /old_locus_tag="AGR_C_268"
FT                   /product="putative malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85985"
FT                   /db_xref="GOA:A9CKM7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM7"
FT                   /protein_id="AAK85985.2"
FT                   /translation="MKFSIAEAEDLVSSIFERNGVLPQNARSVAKALVASEAAGQGGHG
FT                   FRRIPVYVRQARVGKVDGQARPVVRRVKPGVLSIDANHGYAYPAIDCALEELPEMARQQ
FT                   GIALAAIHRSHHAGVMALTVERFAEMGLVALMFANAPASMAPWGGHTPLYGTNPIAFAA
FT                   PIGGADPLVIDLALSKVARGKIMAARQKGETIPGDWALDRNGRPTTDPEEAIAGTMVPA
FT                   GEAKGAALALMVEIMAAAVTGGNFAFQASSLLDDKGAPPSLGHTIIAIDPVSSGGAAFT
FT                   ERLALIAGEIEKQENVRLPGRRSQGIRKQALESGIAIESDILAEIQSL"
FT   gene            complement(170547..170792)
FT                   /locus_tag="Atu0165"
FT   CDS_pept        complement(170547..170792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41189"
FT                   /db_xref="GOA:Q8UIX6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIX6"
FT                   /protein_id="AAL41189.1"
FT                   /translation="MSSKTPHEHRQTRDIVLSDRERQYLGLVARGKHPSHVALITGADE
FT                   TEVKDTLERVRNRLGAANLLNAVSIALLRGLIEQDA"
FT   gene            complement(170930..171184)
FT                   /locus_tag="Atu0166"
FT   CDS_pept        complement(170930..171184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41190"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIX5"
FT                   /protein_id="AAL41190.1"
FT                   /translation="MCRNVTIEMQNLAPDVILLARHIAYESAAYPGDMTETFQSFETAF
FT                   CARPVIVISAIGVAVPPKPRNNVPIGIGCCESGFLLHNS"
FT   gene            complement(171256..172296)
FT                   /locus_tag="Atu0167"
FT                   /old_locus_tag="AGR_C_275"
FT   CDS_pept        complement(171256..172296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0167"
FT                   /old_locus_tag="AGR_C_275"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85986"
FT                   /db_xref="GOA:A9CKM6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM6"
FT                   /protein_id="AAK85986.1"
FT                   /translation="MPEKRVSDEISVVAGLAAGVSNYARSRGIDIVPICKALDIDPATF
FT                   SSLTERISLDRFSRLLETCALISGDDAFGLQCAATFPAGASGAFGYGLISAPTVRSFLR
FT                   FLQDHVYYATNNSNFTMVADATQVTLSWSFAPGIAKRDQYVDLSLAVLVQRLRDILGER
FT                   VNQIEIGLERQKPINIQLFKERLTRRVSFSQAIHTMRLPASLLDVANPNADERLFELMN
FT                   LQCRMLRPETSADPTHFIDQVKRYMQMRLSDAELSLGEIAPYFNLSERSFQRRLAELGT
FT                   NLNEIKDAIRKNAGFKLLVESDLPVSDISYRLGYSTPGAFSRSVSRWFGATPTDIRRKH
FT                   AHHSAG"
FT   gene            complement(172384..172935)
FT                   /gene="gmk"
FT                   /locus_tag="Atu0168"
FT                   /old_locus_tag="AGR_C_277"
FT   CDS_pept        complement(172384..172935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="Atu0168"
FT                   /old_locus_tag="AGR_C_277"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85987"
FT                   /db_xref="GOA:A9CKM5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKM5"
FT                   /protein_id="AAK85987.2"
FT                   /translation="MIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGE
FT                   NHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHLEAGDVVIANGSRSALPHFG
FT                   TAFSRLKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGDFDVTTVDNSGAI
FT                   EDAGKTIMQVLQQSAGSSQP"
FT   gene            complement(172980..174116)
FT                   /gene="phnM"
FT                   /locus_tag="Atu0169"
FT                   /old_locus_tag="AGR_C_279"
FT   CDS_pept        complement(172980..174116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="Atu0169"
FT                   /old_locus_tag="AGR_C_279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85988"
FT                   /db_xref="GOA:A9CKM4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM4"
FT                   /protein_id="AAK85988.1"
FT                   /translation="MTEHALSNARIVLEDDIILGSVLIRDGKIADISEGASKTGEDLEG
FT                   DFLIPGLVELHTDHLEQHYSPRPGVIWDKIAAIQAHDAQVASSGITTVFDCLRLGSDED
FT                   GGFKKGEMREMADAIEAAADQNRLRADHLLHLRCEVASADVLEHFEDFETDPRVRLISL
FT                   MDHSPGQRQFQSMDQYIFYYQKKRGLSDEAFAEFVRRRQAASAEYSAKHRDYLAASCAK
FT                   RGITVASHDDATEAHVGEAIGHGVKLAEFPTSVEAAKASHSAGMSVLMGAPNIVRGKSH
FT                   SGNIAARDLAEIGVLDVLSSDYVPFSLLFAPFLLADQVEAISLSEALRMVTATPARTVG
FT                   LVDRGRIATGLRADLVRVHREDGVPVARSVWRQGKRVA"
FT   gene            complement(174113..174802)
FT                   /locus_tag="Atu0170"
FT                   /old_locus_tag="AGR_C_280"
FT   CDS_pept        complement(174113..174802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0170"
FT                   /old_locus_tag="AGR_C_280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85989"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D219"
FT                   /protein_id="AAK85989.2"
FT                   /translation="MRYAIYFSPAKDHPLTEAASRWLGRNAFSGTLHDDHDDYADLTEE
FT                   PRRYGFHATLKAPFELAEKYSEAELLAAVEDFAANQSAFEIPRVVVGALGPFFALVPDR
FT                   VYQPLQDFAAEVVDHFDRFRAPLSETDIARRRPQMLTESQRQNLSLWGYPHVMDDFRFH
FT                   MTLTGRIDEEEQPAMQEILSTRFAEFVDQPLAISGLALFIEETRGAPFTVHRWHPLGQQ
FT                   PKKDANP"
FT   gene            complement(175086..176435)
FT                   /gene="phnE"
FT                   /locus_tag="Atu0171"
FT                   /old_locus_tag="AGR_C_284"
FT   CDS_pept        complement(175086..176435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Atu0171"
FT                   /old_locus_tag="AGR_C_284"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85991"
FT                   /db_xref="GOA:A9CKM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM3"
FT                   /protein_id="AAK85991.1"
FT                   /translation="MSSSFILNTAERERLTAAHRHVFNRSFMQRYGLLVGLLVATAYLI
FT                   GCFFFFNVGPAFMQGRWDRASSYIQDWYSWRAQPRLRFEDGKVAPQWSSRGQYPADAKI
FT                   DWLQPLPDGGYSVVYAGTQNRLDITPTRVDVYVDGKNYPVIINDDAVVAPQGLPDEIQQ
FT                   DGKKVLVHYGFAGQAEIRTSQVYVQRRFLGWANFLFDTKSEFWGKGYGELAALALWGER
FT                   LDPARSNIGHMVDDFLDNSVWQHADILSKLMQTLVMAFVGTLFGTLVALPLAFIAARNI
FT                   TANRAANWGMKRLFDFLRSIDMLIWALFFTRSFGPGPIPGIAAIFFTDTGALGKVYAEA
FT                   LENVDDKQREGVKSVGASPIAVNRFGVLPQVLPVFISQSLYFWESNTRSATIIGAVGAG
FT                   GIGLKLLEAMGTNADWDKVAYMVLLILFVVFLFDHISNSLRSRLIGKTQH"
FT   gene            complement(176435..177421)
FT                   /gene="phnE"
FT                   /locus_tag="Atu0172"
FT                   /old_locus_tag="AGR_C_285"
FT   CDS_pept        complement(176435..177421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="Atu0172"
FT                   /old_locus_tag="AGR_C_285"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85992"
FT                   /db_xref="GOA:Q7D217"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D217"
FT                   /protein_id="AAK85992.2"
FT                   /translation="MATTLHNGTLSPEGLSASSRTVMRHYQQQLATRRIYTVISLVIFL
FT                   VILAASLNFANAANSGKFFERLPYFFDFMKTFVPDSPLEIFRAMFDLPSPYADGSLKYN
FT                   YVADRVYITDGFYIPHFIYQLIITLNIALVSTIIGTSFAFVLCFFASTNLVGAGLVRWV
FT                   VRRVMEVLRAFPEIVVAGLLTAILSIGPIAAIIAISVHTIGALGKLFFEVVENADMKPD
FT                   EGLRAAGANWLERVRFAIVPQVLPNFVSYALLRAEINVRASTIIGAVGGGGIGEVFRLS
FT                   IGNDHASKTYAIIILLLITIIAVDQFSSWLRRRLIGQQSFEFGRGAA"
FT   gene            complement(177492..178397)
FT                   /gene="phnD"
FT                   /locus_tag="Atu0173"
FT                   /old_locus_tag="AGR_C_288"
FT   CDS_pept        complement(177492..178397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="Atu0173"
FT                   /old_locus_tag="AGR_C_288"
FT                   /product="ABC transporter, substrate binding protein
FT                   (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85993"
FT                   /db_xref="GOA:A9CKM2"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM2"
FT                   /protein_id="AAK85993.1"
FT                   /translation="MLKKVLLSAVALGVLAGSAMAQDVKVLRIGLDGSENEADQIRNTK
FT                   CVADGLKAATGVSEVQVFPSPDYNGVIQGLLGGTIDIASMGASSYAKIALADPKAVDPI
FT                   LTTAGADGSTGYYTIMVARKDSGIKTLADAKGKKIGFADPDSTSGFLVPNVAIPKETGV
FT                   PVKEYFSETGFGGGHENLVLAVLDKKFDVGTTFGSGVGKWEEGYTAGNLYQMVKKGNLD
FT                   MDDIVQVWKSPLIPNGPLMVTNKLGDAMKQKVEDFFMELPKKDLACFQGFTQGKNTAYI
FT                   KVDPSFYQTIIDARKSVIGG"
FT   gene            complement(178483..179343)
FT                   /gene="phnC"
FT                   /locus_tag="Atu0174"
FT                   /old_locus_tag="AGR_C_290"
FT   CDS_pept        complement(178483..179343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="Atu0174"
FT                   /old_locus_tag="AGR_C_290"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85994"
FT                   /db_xref="GOA:Q8UIW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIW7"
FT                   /protein_id="AAK85994.2"
FT                   /translation="MSFHLKQVTRRFGKHTAVDSVDVEIPQGQMVGVIGRSGAGKSTLL
FT                   RMINRLVDPSSGSIHFNDTEVSSLKGAALRAWQRDCAMIFQQFNLVPRLDVLTNVMLGR
FT                   LNHRSTALSLFNIFSHEERLMAIAALERLGIEHVAMQAAGTLSGGQQQRVAIARALMQS
FT                   PKMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIIGMSQG
FT                   RVVFDGTPAELTAAAVTEIYGTDSQGSGIDETMTSTSINIPGAQLAARPVQQSAGPEPL
FT                   ALAGL"
FT   gene            complement(179560..180177)
FT                   /locus_tag="Atu0175"
FT                   /old_locus_tag="AGR_C_291"
FT   CDS_pept        complement(179560..180177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0175"
FT                   /old_locus_tag="AGR_C_291"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85995"
FT                   /db_xref="GOA:A9CKM1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM1"
FT                   /protein_id="AAK85995.1"
FT                   /translation="MSVKVGLEPVIHESARVTNSSIGRYTEISERCRLEEVEMGDYSYV
FT                   MQDGAIWCATIGKFVNIAASVRINATNHPMQRATLHHFTYRARSYWDDAEDETDFFAAR
FT                   RAKRVVIGHDVWIGHGATILPGITVGNGAVIGAGAVVSKDVAPYTIVGGVPARLIRERF
FT                   PAELGKRMDDLNWWDWDHARLRSALEDFRALDAEDFVAKYGG"
FT   gene            complement(180174..180881)
FT                   /gene="phnL"
FT                   /locus_tag="Atu0176"
FT                   /old_locus_tag="AGR_C_293"
FT   CDS_pept        complement(180174..180881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="Atu0176"
FT                   /old_locus_tag="AGR_C_293"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85996"
FT                   /db_xref="GOA:Q7D213"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D213"
FT                   /protein_id="AAK85996.2"
FT                   /translation="MTTPLIVSEVFKSFTMHLRDGIELPVVRDVSFSVSGGECVVLGGP
FT                   SGIGKSSILKMLYGNYAIDSGQILIRHQGEVIDMGNASPRTILDIRHRTIGYVSQFLRT
FT                   VPRVAAIDVVAEPLLARKVAAEDAREQAAMLLSKLNLPRELWSLPPATFSGGEQQRVNI
FT                   ARGFITDHAILLLDEPTASLDATNRRVVVDMIREKKEKGTALLGIFHDEEVREAVADRI
FT                   LDVSQFSPRKAAA"
FT   gene            complement(180949..181725)
FT                   /gene="phnK"
FT                   /locus_tag="Atu0177"
FT                   /old_locus_tag="AGR_C_295"
FT   CDS_pept        complement(180949..181725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="Atu0177"
FT                   /old_locus_tag="AGR_C_295"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85997"
FT                   /db_xref="GOA:Q7D212"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D212"
FT                   /protein_id="AAK85997.2"
FT                   /translation="MSDAPLLKVRDVSKYYGDRAGCRNVSFELYPGEVLAIVGESGSGK
FT                   TTLLNCISTRLMPTAGSVEYRMRDGSVRDLYHMGEAERRFLMRTDWGFVHQNPADGLRM
FT                   AVSAGANVGERLMAVGNRHYGNIRQSASEWLERVEIGTDRIDDQPRAFSGGMRQRLQIA
FT                   RNLVTSPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLAVVVVTHDLAVARLLSHRM
FT                   MVMKGGDVIEHGLTDRVLDDPREPYTQLLVSSILQV"
FT   gene            complement(181722..182624)
FT                   /gene="phnJ"
FT                   /locus_tag="Atu0178"
FT                   /old_locus_tag="AGR_C_297"
FT   CDS_pept        complement(181722..182624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="Atu0178"
FT                   /old_locus_tag="AGR_C_297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85998"
FT                   /db_xref="GOA:A9CKM0"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKM0"
FT                   /protein_id="AAK85998.1"
FT                   /translation="MLKEVSFDDGLAAYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFA
FT                   SREMPMPYGWGTGGVQLTASILGPDDVLKVIDQGADDTTNAVSIRAFFQKVADVAVTTR
FT                   TKDATIIQTRHRIPEEELHSGQVLVYQVPIPEPLRFLEPRETETRVMHALEEYGLMHVK
FT                   LYEDIARNGRISTTYAYPVKVAGRYVMDPSPTPKFDNPKMNMSDALQLFGAGREKRIYA
FT                   VPPYTDVVSLDFEDHPFEIQRFDKPCALCGGENVYLDEVVLDDKGGRMFVCSDTDHCED
FT                   RRAHGHKGHLLADVKEAAE"
FT   gene            complement(182758..183867)
FT                   /gene="phnI"
FT                   /locus_tag="Atu0179"
FT                   /old_locus_tag="AGR_C_299"
FT   CDS_pept        complement(182758..183867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="Atu0179"
FT                   /old_locus_tag="AGR_C_299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAK85999"
FT                   /db_xref="GOA:A9CKL9"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL9"
FT                   /protein_id="AAK85999.1"
FT                   /translation="MYVAVKGGETAIANAHRLLADQRRGDRDLPAMTVAQIVSQLSLAV
FT                   DRVMAEASLYDQSLAALAVKQARGDMIEAIFLLRAYRTTLPRFGYSVPVDTADMVVQRR
FT                   VSATYKDLPGGQLLGPTFDYTHRLLDPSLLEDEGVETATQREGEPEYVVRVSDILAQEG
FT                   LIESDGDMPDDHIAGDLTREPMEFPMPRDLRLQSLARGDEGFLLALAYSTQRGYGRTHP
FT                   FVGEIRIGEVEVELDVPELGFSVSLGDIKVTECQMVNQFKGSAKAPPQFTRGYGLVFGQ
FT                   SERKAMAMSLVDRALRAGEFGEDVVAPAQDEEFVISHADNVQATGFVEHLKLPHYVDFQ
FT                   AELGLVRKMRADFEAINANGAEWMSDAAE"
FT   gene            complement(183869..184480)
FT                   /gene="phnH"
FT                   /locus_tag="Atu0180"
FT                   /old_locus_tag="AGR_C_302"
FT   CDS_pept        complement(183869..184480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="Atu0180"
FT                   /old_locus_tag="AGR_C_302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86000"
FT                   /db_xref="GOA:A9CKL8"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL8"
FT                   /protein_id="AAK86000.1"
FT                   /translation="MMGVKAEALTGGFSSAVFDSQRIFKKLMDGMARPGTPQTIETAVA
FT                   PPLPLAAATGAVLLALCDHDTPVWLNGALRKTAVPGWIGFHTGAPATEEKGAAHFAVIE
FT                   AGSAIASFGLFAQGSQEYPDRSTTLIIELSDLDGGRELLLSGPGIRHVNIISPSGLPDI
FT                   FPMLWAENNAIFPRGVDVILTAGDKFVCLPRTTRIKPVEA"
FT   gene            complement(184477..184938)
FT                   /gene="phnG"
FT                   /locus_tag="Atu0181"
FT                   /old_locus_tag="AGR_C_303"
FT   CDS_pept        complement(184477..184938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="Atu0181"
FT                   /old_locus_tag="AGR_C_303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86001"
FT                   /db_xref="GOA:A9CKL7"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL7"
FT                   /protein_id="AAK86001.1"
FT                   /translation="MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRG
FT                   PETGLVMVKGRIGGGGAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDA
FT                   LWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAATRVDFFTMVRGED"
FT   gene            185021..185758
FT                   /locus_tag="Atu0182"
FT                   /old_locus_tag="AGR_C_306"
FT   CDS_pept        185021..185758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0182"
FT                   /old_locus_tag="AGR_C_306"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86002"
FT                   /db_xref="GOA:A9CKL6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL6"
FT                   /protein_id="AAK86002.1"
FT                   /translation="MSPVAAMKRKNGVALWRQIADRIRGEIAAGDHDETGMLPPEMTLA
FT                   EKFGVNRHTVRSAIAALASEGILEPMQGRGTMIARKERLSFPISLRTRFTAGIGDQVKE
FT                   MEALLLSHTTEPASADLAARLQLPSGAPLVRLETLRKADTRPVSRSTTWFPADRFAGIG
FT                   EAYRKSGSITAAFKALGVADYVRISTVISAIHADTQDLADLELSPGAILLVTQALNADM
FT                   DGVPVQYAVSRFSADTVEFTVEN"
FT   gene            complement(185768..186595)
FT                   /gene="dapB"
FT                   /locus_tag="Atu0183"
FT                   /old_locus_tag="AGR_C_307"
FT   CDS_pept        complement(185768..186595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="Atu0183"
FT                   /old_locus_tag="AGR_C_307"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86003"
FT                   /db_xref="GOA:Q8UIV8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIV8"
FT                   /protein_id="AAK86003.2"
FT                   /translation="MGSSGMKLVVVGAAGRMGQALIRLIHQTPGVQLHAAVAREGSAFV
FT                   GRDAGEIAGLGPIGIEITSDPLQAFLHAEGVIDFTSPATSITFAGLAAQARIVHVVGTT
FT                   GCSPQDEEKFKAASRHARIVKSGNMSLGVNLLSVLTQQAAQALDAQNWDIEILEMHHKH
FT                   KVDAPSGTALLLGEAAAAGRKVDLTAASVRVRDGHTGAREAGTIGFATLRGGSVIGEHS
FT                   VIFAGEGERVELSHYAGDRSIFARGAITAAVWAFDKKPGFYSMLDVLGLSQAE"
FT   gene            complement(186737..187759)
FT                   /gene="glk"
FT                   /locus_tag="Atu0184"
FT                   /old_locus_tag="AGR_C_310"
FT   CDS_pept        complement(186737..187759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="Atu0184"
FT                   /old_locus_tag="AGR_C_310"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86004"
FT                   /db_xref="GOA:Q8UIV7"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIV7"
FT                   /protein_id="AAK86004.2"
FT                   /translation="MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTA
FT                   EYPGIDDAIQQAVLDKTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKD
FT                   VIVINDFEAQALAIAALDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFP
FT                   VPGEGGHIDIGPRSARDYVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGIEPVF
FT                   SDPADITSQGLSGQNAQAKETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIIPA
FT                   LKSPEFRAAFEDKAPHSALMRTIPTFVVTHPQAALSGLATYARTPADFGLALDGRRWRA
FT                   "
FT   gene            complement(187787..188170)
FT                   /gene="mgsA"
FT                   /locus_tag="Atu0185"
FT                   /old_locus_tag="AGR_C_311"
FT   CDS_pept        complement(187787..188170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="Atu0185"
FT                   /old_locus_tag="AGR_C_311"
FT                   /product="methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86005"
FT                   /db_xref="GOA:Q8UIV6"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIV6"
FT                   /protein_id="AAK86005.1"
FT                   /translation="MEGQRCIALIAHDEKKDDMADFARHHQKVLASFRIVATGTTGGRV
FT                   QEACPGLEVIRLKSGPLGGDQQIGAMIATGEVDMLIFFTDPLTAMPHDVDVKALTRLAT
FT                   VYDIPMALNRATAENLIDFNSAD"
FT   gene            complement(188270..189325)
FT                   /gene="mepA"
FT                   /locus_tag="Atu0186"
FT                   /old_locus_tag="AGR_C_314"
FT   CDS_pept        complement(188270..189325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="Atu0186"
FT                   /old_locus_tag="AGR_C_314"
FT                   /product="penicillin-insensitive murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86006"
FT                   /db_xref="GOA:A9CKL5"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL5"
FT                   /protein_id="AAK86006.1"
FT                   /translation="MTAGSPRVLKAALLAMSVVSALQLQIETASAEDRPAKEVFGHMAL
FT                   PSAAASQPIGSYAKGCQSGAIAMPTDGPGWQAMRLSRNRRWGQPQLISFLERFSQDAQK
FT                   IGWPGLLLGDISQPRGGPMLTGHASHQIGLDVDVWWRPMPSPRLTVEQRETVPFISMLD
FT                   KSKFLTVDDRKWSPLNARLVMMAASYPQVERVFVNPAIKQKLCQTWTGDRTFMGKIRPI
FT                   YGHDEHFHIRLECPPGAPNCKPQAEVGKGDGCDKSLAWWFTKEPWAPPKKDPNAKPVKP
FT                   RQVMVSDLPAACAAVAAAPSANPEGIAAQAYSSSPAQAVRQQNVEQVIQNAPAIQPPSD
FT                   IPLPTQRPTLN"
FT   gene            189528..191372
FT                   /locus_tag="Atu0187"
FT                   /old_locus_tag="AGR_C_316"
FT   CDS_pept        189528..191372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0187"
FT                   /old_locus_tag="AGR_C_316"
FT                   /product="ABC transporter, substrate binding protein
FT                   (peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86007"
FT                   /db_xref="GOA:A9CKL4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL4"
FT                   /protein_id="AAK86007.1"
FT                   /translation="MILAPLKSRILIALAASALLIPAVASAQSTDVWRKGISTVGELKH
FT                   PDGFDHFDYVNTKAPKGGTLRLSTSGTFDTLNPLLAKGERATGLSLVYDTLMKSTEEEL
FT                   SASYGLLAEGVSYPDDIEKATFRLRQDAKWADGKPVTPEDVVFSFEKAKDLSPQLATYY
FT                   THVTKAEVSGERDITFTFDEKNNRELPQIVGQLLIVPKHWWEGTGPDGKPRDISRGTLE
FT                   PVMGSGPYKIAAVSPGSSVTYERRDDYWGKDVNVNVGMNNFKTIAYTFFADQDVEFQAF
FT                   KSGTVDFRQEASSSRWVTGYDFPAVKEGRVKKEELPNIYRSVGIMQAFVPNMRREKFQN
FT                   PKLRKALNYAFDFEELNRTLAYGQFQRITSFFMGSELASSGLPTGRELEILQELKDQVP
FT                   PEVFTTEYRNPVAGDPAKQRDNLREAVKLMKEAGYELRGNRMVNAATGQQLDMEFLIDS
FT                   SGMERTILPYVQNLKKIGINATIRTVDASQYTNRTRSFDFDVTIKLWATSANPGNEQAD
FT                   FWGSAAADRQGSNNLAGIKNPAVDALVRKVIFAPNRDEQVAAARALDRVLLANSYVIPQ
FT                   FYRGEMFIAYWNTLIRPENLPEYGVGFPDAWWSGKAGN"
FT   gene            191514..192608
FT                   /locus_tag="Atu0188"
FT                   /old_locus_tag="AGR_C_318"
FT   CDS_pept        191514..192608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0188"
FT                   /old_locus_tag="AGR_C_318"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86008"
FT                   /db_xref="GOA:A9CKL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL3"
FT                   /protein_id="AAK86008.1"
FT                   /translation="MGAYILRRLALMIPTIVGIMGISFLVIQFAPGGPVEQVVAQLTGQ
FT                   GDSASDRLSGGGDLMGQSGGFDESGSKYRGAQGLDPELIKKLEKQFGFDKPPLTRFLEM
FT                   MWNYIRFDFGDSFFRNSSVIDLIIDKLPVSASLGFWILIISYVISIPLGIKKAVSDGST
FT                   FDVWTSGIIIIGYAVPSFLFGILLIVLFAGGSFFDWFPLRGLVSDNFDQLNWWQKIIDY
FT                   FWHLTLPLIALSLSAFATTTLLTKNSFIDEIKKQYVVTARAKGLSERKVLYGHVFRNAM
FT                   LIVIAGFPGAFISAFFTGSLLIENIFSLDGLGRLGYLSVVNRDYPIVFGTLFIFSLMGL
FT                   VVGLLSDLIYTWIDPRIDFERRDV"
FT   gene            192608..193753
FT                   /locus_tag="Atu0189"
FT                   /old_locus_tag="AGR_C_319"
FT   CDS_pept        192608..193753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0189"
FT                   /old_locus_tag="AGR_C_319"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86009"
FT                   /db_xref="GOA:Q7D203"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D203"
FT                   /protein_id="AAK86009.2"
FT                   /translation="MSLAQPAGTETLVKPKRPWFSPTTKRRWQNFKANRRGYWSFWLFL
FT                   ILFFLSLIAEFIANDKPILASYKGEILVPVMVDYPEEKFGGFLAQTDYKSSFIQDEINA
FT                   NGWMIWPPIRYSYQTVNSNIPHSAPTAPFWLMDEKERCSAYPQGNADPGCTLGNLNWLG
FT                   TDNQARDVTARMIYGFRISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRFIEIW
FT                   SSMPVLYILLIIAAILPPGFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVRAARALG
FT                   VGNWTIMFRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQGK
FT                   NNLQAPWLGLTAFFTMSIMLSLLIFVGEAVRDAFDPRKTFR"
FT   gene            193759..195399
FT                   /locus_tag="Atu0190"
FT                   /old_locus_tag="AGR_C_320"
FT   CDS_pept        193759..195399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0190"
FT                   /old_locus_tag="AGR_C_320"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86010"
FT                   /db_xref="GOA:A9CKL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL2"
FT                   /protein_id="AAK86010.2"
FT                   /translation="MKETNTQPLLSVRDLSVAFHQGGATSVAVDHVSFDLMPGEVVALV
FT                   GESGSGKSVTANSILKLLPYPAASHPSGKILFDGKDMLTLPERALRAVRGNDITMIFQE
FT                   PMTSLNPLHTIERQIGEILELHQAITGAEARQRTLELLLQVGIREPEKRLKAYPHELSG
FT                   GQRQRVMIAMALANRPKLLIADEPTTALDVTVQAQILELLGDLKTQHGMSMLFITHDLG
FT                   IVRKFADRVCVMTKGKIVETGTVEQVFTDPQHAYTRHLLAAEPKGEPPHSDASKPVVMQ
FT                   GDDIKVWFPIKAGLMRRVIDHVKAVDGIDITLRAGQTVGVVGESGSGKTTLGLALSRLI
FT                   ASKGRISFIGQSIDSYSYEMMKPLRNRLQVVFQDPYGSLSPRMSVGEIIAEGLKVHERS
FT                   LSADERDTRVATALEEVGLDPATRWRYPHEFSGGQRQRIAIARAMVLKPRFVMLDEPTS
FT                   ALDMSVQAQVVDLLRDLQAKHELAYLFISHDLRVVKALANDLIVMRHGKVVESGPAAEI
FT                   FANPQQDYTKALLAAAFNIEAVETKAVSQ"
FT   gene            195499..196738
FT                   /pseudo
FT                   /gene="dadA"
FT                   /locus_tag="Atu0192"
FT                   /old_locus_tag="AGR_C_323"
FT                   /note="D-amino acid dehydrogenase; Frameshift (pseudogene)"
FT   gene            196923..198281
FT                   /gene="glnA"
FT                   /locus_tag="Atu0193"
FT                   /old_locus_tag="AGR_C_326"
FT   CDS_pept        196923..198281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="Atu0193"
FT                   /old_locus_tag="AGR_C_326"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86012"
FT                   /db_xref="GOA:Q7D200"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D200"
FT                   /protein_id="AAK86012.1"
FT                   /translation="MYDIENAKKFFADNPDIEILEAFVIDANGVPRGKWIPRERAIDVL
FT                   EKGMAIPRSVYALDIWGRDVHAAGLAEGTGDPDGFCFPVPGTLSRVTWLGRPTAQVLLA
FT                   MKNADGTGFYGDPRHVLSQVLNAYKKAGLTPVVATELEFYLIDPVRSALDPVRPPHSRE
FT                   GRWHTGQTQVLSISELQDFEDVFHDIATACRAQGVLADTTLRENGPGQYEINLNHVPDA
FT                   LQAADFAVFLKRIVKGVARRHELDATFMAKPYGLQAGNGMHVHFSVLDRDGRNIYAGEN
FT                   GPSDALMHSVGGLLENMGESMAIFAPHANSYRRLTPSEHAPTYASWGIDNRSAAVRVIV
FT                   ASKAATRIEHRVAGADTNPYLVLAMILSAAIAGMKEKRQPGGAIAGDSHAINHEPLPTN
FT                   WDYALQRFTRSSFAYATLGQKYRTLFSACKQQELSEFSLRVTDVEYDAYIRTV"
FT   gene            198256..199584
FT                   /gene="ordL"
FT                   /locus_tag="Atu0194"
FT                   /old_locus_tag="AGR_C_328"
FT   CDS_pept        198256..199584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="Atu0194"
FT                   /old_locus_tag="AGR_C_328"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86013"
FT                   /db_xref="GOA:A9CKL1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL1"
FT                   /protein_id="AAK86013.1"
FT                   /translation="MTPISGRCEMAEVTNIPNPGHTSSWYAASANVKSVRPTLEGALEA
FT                   DVCIIGGGFTGISAALELSERGYAVIVLEGVRVGFGASGRNGGQIVNGYSRDLETIARR
FT                   YGHEKAVKLGEMSLEGGTIIRSRVAKYGIDCDLVDGGFFAAFTPKQIREMEAHKAHWEK
FT                   HGHGGLEMVSEADVGQYVKTNRYAGGMIDRFGGHIHPLNLVQGEAAAAESLGARIFENS
FT                   RVIAVEQGANPIVRTAMGSVKAKYVLVCGNAYLGTLLPEIGERMMPVSSQVMATEPLDA
FT                   DLIEALLPANYCVEDANYILDYYRRTSDNRLLYGGGIGYGGSDPADLTGVIRPNMLKTF
FT                   PQLEKTKIEFAWSGNFALTLTRIPHMGRLSDNIYFSHGDSGHGVTTTHLLGKILGEAVA
FT                   GHAERFDIWSSLPNYPFPGGKTFRVPLTMLGAWWYGLRDKLGL"
FT   gene            complement(199684..200175)
FT                   /gene="gntK"
FT                   /locus_tag="Atu0195"
FT                   /old_locus_tag="AGR_C_329"
FT   CDS_pept        complement(199684..200175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="Atu0195"
FT                   /old_locus_tag="AGR_C_329"
FT                   /product="gluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86014"
FT                   /db_xref="GOA:A9CKL0"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKL0"
FT                   /protein_id="AAK86014.1"
FT                   /translation="MMGVSGSGKSTVAEGLAEKLGIAFIEGDKLHPKSNVDKMSEGIPL
FT                   TDDDRWPWLDLIGAELRNGSEGKGVLVSCSALKKIYRDRLREATGGPLAFVYLDGSLEL
FT                   LSRRMGERKGHFMPLSLLQTQLATLEVPTGEPGVVTVSIDSTPEEIVANALAGLKTLKF
FT                   "
FT   gene            complement(200281..201021)
FT                   /locus_tag="Atu0196"
FT                   /old_locus_tag="AGR_C_332"
FT   CDS_pept        complement(200281..201021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0196"
FT                   /old_locus_tag="AGR_C_332"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (proline/glycine/betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86015"
FT                   /db_xref="GOA:Q7D1Z7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Z7"
FT                   /protein_id="AAK86015.2"
FT                   /translation="MKNAFSFLSLGLLVLALIIFLAAPQIFAPIFRPLVQANAPAIYTQ
FT                   ANLFSLTLSHLTIVAIATGLATLTAGALAVLVTRPFGADFLPLSRSIVNIGQTFPPVAV
FT                   LALAVPMIGFGEKPTLIALFLYALLPVFENTLTGLTTLPATVMDAARGSGMTGWQRLTK
FT                   VELPLALPAILAGVRLSAVISLSTATIGSTVAARTLGEVIIAGLQSNNLAFILQGGLIV
FT                   AALAILIHAGFSALERSAARKTGH"
FT   gene            complement(201018..201956)
FT                   /locus_tag="Atu0197"
FT                   /old_locus_tag="AGR_C_334"
FT   CDS_pept        complement(201018..201956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0197"
FT                   /old_locus_tag="AGR_C_334"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (proline/glycine/betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86016"
FT                   /db_xref="GOA:A9CKK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK9"
FT                   /protein_id="AAK86016.1"
FT                   /translation="MIEIDTITKRYGDTTVVDQVSLTVAPRTVTVIVGTSGSGKTTLLR
FT                   MINRLVEPTSGTIRIDGEDISAIPGFKLRRQIGYAIQGHGLFPHRTVAENIATVPQLIG
FT                   WDRQRIKAKIDALMHLFQLDPALYADRFPHELSGGQQQRVGVARALAAEPNILLMDEPF
FT                   GALDPVIRAKAQNDLLDIQKKLGVTIVLVTHDMDEAFHLADRIAVMDKGRIVQDCPPAE
FT                   LVLKPATDFVRTMIGENERALKLLSVLTVADIVEPGSAEGAPLTEGTSQRDALSAMLWA
FT                   GRDVLPVIKDDGQPIGRVRRDVLLQRATGAP"
FT   gene            complement(201953..203098)
FT                   /locus_tag="Atu0198"
FT                   /old_locus_tag="AGR_C_335"
FT   CDS_pept        complement(201953..203098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0198"
FT                   /old_locus_tag="AGR_C_335"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (proline/glycine/betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86017"
FT                   /db_xref="GOA:A9CKK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK8"
FT                   /protein_id="AAK86017.2"
FT                   /translation="MGVLISCLLLYALFASPFMTFRANRIVQGETRTIFEALPSAAATL
FT                   LAAIILLAVFFAFFRFPAWLKLAAALAGLAALAVFVGQAASFLTPDGNSFARVSPSSGF
FT                   WFLFVGLALLATDCIARLEPKPAIRILLLLLAIAALSAILASGLWNDLSIIKEYTGRAD
FT                   IFWIEAVRHVELAIGSLIAATVAGIPLGILCYKVERLRAGVLNSLNIVQTIPSIALFGL
FT                   LIAPLGWIAATVPGAARIGIAGIGMAPAFVALFLYSLLPVVSNTVVGLAGVSHAIREAA
FT                   RGLGMTPVQRLLRVEFPLAMPVILTGIRIVLVQNIGLATIAALIGGGGFGVFVFQGIGQ
FT                   TAMDLVLLGTVPTVLLGFAAAITLDALIDSNLFSAGGRQKP"
FT   gene            complement(203203..204114)
FT                   /locus_tag="Atu0199"
FT                   /old_locus_tag="AGR_C_337"
FT   CDS_pept        complement(203203..204114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0199"
FT                   /old_locus_tag="AGR_C_337"
FT                   /product="ABC transporter, substrate binding protein
FT                   (proline/glycine/betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86018"
FT                   /db_xref="GOA:A9CKK7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="PDB:4ND9"
FT                   /db_xref="PDB:4NE4"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK7"
FT                   /protein_id="AAK86018.1"
FT                   /translation="MNRLMTLTGAGLALAFSVSIAQAQVVVSSKIDTEGGVLGNIILAV
FT                   LNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYE
FT                   EAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAAS
FT                   SEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGG
FT                   IAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARV
FT                   QVGGEQAKTVAMDFLTKNGFAK"
FT   gene            complement(204265..205311)
FT                   /locus_tag="Atu0200"
FT                   /old_locus_tag="AGR_C_342"
FT   CDS_pept        complement(204265..205311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0200"
FT                   /old_locus_tag="AGR_C_342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86019"
FT                   /db_xref="GOA:Q7D1Z3"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Z3"
FT                   /protein_id="AAK86019.2"
FT                   /translation="MIIKPEFHTFALTALVGSMGALLASLLHIPAPFLSGPALAVTITG
FT                   LAGVKLGIPAFIRNACFVVVGISMGTSVTPSVIDAAKTWPLSFIVVLVAVVIMLYVAYW
FT                   ILHYGFGYDRTTAMLGASPGHLSYIISLGAETKSDLATVSIVQSVRVLALTLSVPLIVE
FT                   YFDLVSTEPLITNPPMGFFTLALTIAASLLTGWLFLRWKFPAALLLGGVAISIGTHITG
FT                   LTEGGVPSWLSLPVYVLIGCLIGTRFSNVSLMEVRKGFLAGFVVTIAVMVIAGTIAWLI
FT                   SRVTGVPLNAVMIAYAPGGLETMAAMAVMMHADTAYVGSHHVIRLLFLSVLMPLVMGKD
FT                   ARKRDGDT"
FT   gene            complement(205480..205950)
FT                   /gene="aau3"
FT                   /locus_tag="Atu0201"
FT                   /old_locus_tag="AGR_C_344"
FT   CDS_pept        complement(205480..205950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aau3"
FT                   /locus_tag="Atu0201"
FT                   /old_locus_tag="AGR_C_344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86020"
FT                   /db_xref="GOA:A9CKK6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK6"
FT                   /protein_id="AAK86020.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANEGKLSRIPEIARAYGVSELFLFKIL
FT                   QPLNKAGLVETVRGRNGGVRLGKPAEKISLFDVVRVTEDSFAMAECFEDGAVECPLVDS
FT                   CGLNSALRKALNAFFDVLAEYSIDDLVKARPQINFLLGIDTEMPKIAALPAA"
FT   gene            206109..207173
FT                   /locus_tag="Atu0202"
FT                   /old_locus_tag="AGR_C_346"
FT   CDS_pept        206109..207173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0202"
FT                   /old_locus_tag="AGR_C_346"
FT                   /product="ABC transporter, substrate binding protein
FT                   (iron)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86021"
FT                   /db_xref="GOA:Q7D1Z1"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Z1"
FT                   /protein_id="AAK86021.2"
FT                   /translation="MEAFIMASLKSRFSAAVFSGLTILSLAPAALAEGEVNVYSYRQPE
FT                   LIQPLLDAFTKETGIETNVLFLDKGLVERIQAEGVNSPADVLLTVDIARLVEAKEGKVT
FT                   QPVLADPVIEKDIPANLRDPEGEWFGLTTRGRVVYASKERVTQKDITYEELADPKWKGK
FT                   ICIRDGQHSYNIALIASMIAHHGVDYTRTWLTGLKNNLARKPDGTDRSQAKSIFSGECD
FT                   IALGNTYYVGLMLTNDQEPDEKIWAGSVRVIFPNAGDRGTHVNISGMALTKYAPNRDNA
FT                   LKLMEFLASREAQEIYAKQVFEYPVLSGAEPSDVVKGFGPINPDKLPLTDIAAHRKQAS
FT                   ELVDEVGFNDGPTN"
FT   gene            complement(207198..208115)
FT                   /locus_tag="Atu0203"
FT                   /old_locus_tag="AGR_C_347"
FT   CDS_pept        complement(207198..208115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0203"
FT                   /old_locus_tag="AGR_C_347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86022"
FT                   /db_xref="GOA:Q7D1Z0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Z0"
FT                   /protein_id="AAK86022.2"
FT                   /translation="MEISHRVGTIPREIHFPDGSLFETSDNEGVDRLLGLYLPKRAGFV
FT                   HRLEQFRPRLIGITAAAVLLAYGTYKLALPAVVELAVAMTPPIVPKIMSASTMQALDQT
FT                   VFSASELPLEEQNAIRVQFSRIAAHAEGSPEDYKLNFRKGGYIGPNAFALPDGTLVLTD
FT                   ELVELAGGDRQMIIGVLAHEIGHVEYEHSLRQLYRAAGVAGLVMLIAGDVGSAMEDILT
FT                   QGGGLLALSHSRDAERQADQRSVELMRKADLDPTAIERFFALLEEKLGDKGGTSIISTH
FT                   PGTPQRRKAIIDYNASLDNKPAGN"
FT   gene            complement(208258..209361)
FT                   /locus_tag="Atu0204"
FT                   /old_locus_tag="AGR_C_349"
FT   CDS_pept        complement(208258..209361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0204"
FT                   /old_locus_tag="AGR_C_349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86023"
FT                   /db_xref="GOA:A9CKK5"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK5"
FT                   /protein_id="AAK86023.1"
FT                   /translation="MNDISVSADRHAIERGSFNGNAKEYFGIWIVNILLTIMTLGIYSA
FT                   WAKVRRKRYFNGNTLLAGRAFGYHATGGQIFKGRLIAFAFIVFSQLVGLIHPFLVFAPT
FT                   ILLLIFLPWVITRSIRFNARVTSYRNVRFDFVGTAWGAFVSILLGSFVALLSIGILAPL
FT                   ASRWANRYIVSNLHYGDRRFSTDPKIGALYRAWIIPALLVVVGGVLAVFLLIFLAMVLV
FT                   QAAGIGSRELATAPENYEIVTLFGLGQILINLLVAMLIYGFASTVYKAGVRNVVVSSTL
FT                   LDGKHELHSDLHRGRYLWIVFSNLIVTIFTFGLMRPWAAVREAQYAVERMGISFKGDMG
FT                   EVLSSMEATGAAVSAEYMDMEGFEFGF"
FT   gene            complement(209585..211141)
FT                   /gene="mmsA"
FT                   /locus_tag="Atu0205"
FT                   /old_locus_tag="AGR_C_351"
FT   CDS_pept        complement(209585..211141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="Atu0205"
FT                   /old_locus_tag="AGR_C_351"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86024"
FT                   /db_xref="GOA:A9CKK4"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK4"
FT                   /protein_id="AAK86024.1"
FT                   /translation="MLCTNSSAMLHPSKNRGGLPMKEIGHFINGKHVPGASGRTSNVYN
FT                   PATGEVQATVALASDAELRAAVESAKAAQPKWAATNPQRRARVFFKFVELLNRDLNELA
FT                   VLLSSEHGKTVEDSKGDIIRGLEVCEFVCGIPHLQKGEFTEGAGPAIDMYSIRQPVGIG
FT                   AGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSLPIRLAELMIEAGLPAGMLNVV
FT                   NGDKGAVDAILTDPDIGAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDAD
FT                   LDQAVNALMGAGYGSAGERCMAVSVAVPVGEDTANRLVEKLIPQIESLRIGPYTDDKAD
FT                   MGPLVTKEAQTRVRGLIDSGVEQGAKLLVDGRDFKLQGYEDGYFVGGCLFDHVTPDMDI
FT                   YKTEIFGPVLSVVRAKNYEDALELPMKHEYGNGVAIYTRDGDAARDFASRINIGMIGIN
FT                   VPIPVPLAYHSFGGWKASSFGDLNQHGTDSIKFWTKTKTITSRWPSGIKSGAEFVMPTM
FT                   K"
FT   gene            211253..211570
FT                   /locus_tag="Atu0206"
FT   CDS_pept        211253..211570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41229"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIT6"
FT                   /protein_id="AAL41229.1"
FT                   /translation="MASDEPVVRMAEIEIDPTHLEAYRRLLAEEIEASVRLENGVLALN
FT                   AVAIKGSPEKLRILEVYANQAAYEAHLQTPHFLKYKEGVAGMVTSLTLIEVEPVMMRSK
FT                   P"
FT   gene            211567..212448
FT                   /locus_tag="Atu0207"
FT                   /old_locus_tag="AGR_C_354"
FT   CDS_pept        211567..212448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0207"
FT                   /old_locus_tag="AGR_C_354"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86025"
FT                   /db_xref="GOA:A9CKK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK3"
FT                   /protein_id="AAK86025.1"
FT                   /translation="MNWDDVRIFLAVARSGQILAASKRLGLNHATLSRRLTLLEQALKT
FT                   QLFIRRTNGCEMTEEGQRFLGAAERMETEMLNAQANLGRVDTAVAGTVRIGAPDGLGVS
FT                   FLAPRLGRLTARYPDLKIQLVPVPRSFSLSQREADIAITIERPEQGRLMFSKLTDYSLG
FT                   LYASADYLADHGTPDDVEALKRHRRIGYVEDLIFSPSLNYTGEIMRDWDAAFEISSATG
FT                   QTEAVRSGAGIGILHNYIAGQYPELMRIMPHLGISRSYWTAYHESARQLVRVRTVVDFL
FT                   QELVAEERRIFI"
FT   gene            212655..213491
FT                   /locus_tag="Atu0208"
FT                   /old_locus_tag="AGR_C_357"
FT   CDS_pept        212655..213491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0208"
FT                   /old_locus_tag="AGR_C_357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86026"
FT                   /db_xref="GOA:Q7D1Y6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Y6"
FT                   /protein_id="AAK86026.2"
FT                   /translation="MGKWLVSTYSQGQVILIRSAAALVILVPIVWRAGLSGLVNVERPG
FT                   LQVARVFFSTAELFCFYFAVASLPLADVMTYWLAAPIYVAALAPFLLGEKVGWRRWTAI
FT                   AIGFVGVLIALKPSSASLTSAALFSILGSAAFAFMMLSGRQLRNTPDTVLAFWQIIGAG
FT                   LAGIVAVFMTPSGWLPVQSSFDLAFLSLLGVVAMAAHVLVNRALKLADAATVAPLQYTL
FT                   LLWAVIFGWLFFNDVPQTSIVVGAGLIVFSGLYIFFRENTLKRRRDAADRLAAEQV"
FT   gene            213782..214888
FT                   /locus_tag="Atu0209"
FT                   /old_locus_tag="AGR_C_359"
FT   CDS_pept        213782..214888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0209"
FT                   /old_locus_tag="AGR_C_359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86027"
FT                   /db_xref="GOA:A9CKK2"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK2"
FT                   /protein_id="AAK86027.1"
FT                   /translation="MSAAQKTTLSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIFF
FT                   ICAVLAVLEISLSFDNAIVNANKLKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVA
FT                   ANVGPWTALVMAATQPERYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWI
FT                   EEKAATYSSVKGIEIAFVLIVMLVFSRIIGASDNPELGPVAANTFFHSAIWGLLTFLLV
FT                   EVVGGILDRSQEMLEGAAKGGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGI
FT                   GAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATL
FT                   IGISLWSSIRHNRQQSAGTADAARGAEI"
FT   gene            215253..215597
FT                   /locus_tag="Atu0210"
FT                   /old_locus_tag="AGR_C_361"
FT   CDS_pept        215253..215597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0210"
FT                   /old_locus_tag="AGR_C_361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86028"
FT                   /db_xref="GOA:Q7D1Y4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Y4"
FT                   /protein_id="AAK86028.2"
FT                   /translation="MPAQLSPTEALGLWHRVSTAQVIDDQPDLTLRQTAILLQIYLVPP
FT                   PHTVRGLAAMLGVTKPVITRALDSLGALGLVDRVRDERDRRNVVIKRTVAGALYLEKFG
FT                   DLIIDQARKI"
FT   gene            215616..216467
FT                   /locus_tag="Atu0211"
FT                   /old_locus_tag="AGR_C_363"
FT   CDS_pept        215616..216467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0211"
FT                   /old_locus_tag="AGR_C_363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86029"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK1"
FT                   /protein_id="AAK86029.1"
FT                   /translation="MMLDRRLNVFRPDLADAKLQGVVEAERFVSGSPAQVTAPVIGLRP
FT                   TPDLATGIDTELLCGETVRVFDRANGWAWVQADVDGYAGYVPETAIGNVVAATHQIIAP
FT                   RTFLYPSAELRKPPVAALSMGSLIRIVGEAETRGTRYLMTEKGEGIIAAHCRALDAALE
FT                   EDYVAVALRFIETPYLWGGRSGFGIDCSGLVQLSMAMTGRRVLRDTDMQVKSLGVEIER
FT                   DELRRGDFVFWKGHVGLMENEETLLHANGHTMNVARENLDAAIERIGWLYEKPTAFRRR
FT                   EG"
FT   gene            216563..216922
FT                   /locus_tag="Atu0212"
FT                   /old_locus_tag="AGR_C_365"
FT   CDS_pept        216563..216922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0212"
FT                   /old_locus_tag="AGR_C_365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86030"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Y2"
FT                   /protein_id="AAK86030.2"
FT                   /translation="MKTRTATRLAAILTAALLNTSAEAQTVFQNGFAPAPDAYANLPGV
FT                   KDPRTLQPKVRYNCHSELGVTGYSRGPYRDVFGSRGLPVQGYRCTDENGISSFGGKNPI
FT                   SKDWYPGINPVDPTF"
FT   gene            217114..218418
FT                   /gene="pncB"
FT                   /locus_tag="Atu0213"
FT                   /old_locus_tag="AGR_C_367"
FT   CDS_pept        217114..218418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="Atu0213"
FT                   /old_locus_tag="AGR_C_367"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86031"
FT                   /db_xref="GOA:Q8UIS9"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="PDB:1YBE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIS9"
FT                   /protein_id="AAK86031.2"
FT                   /translation="MTKTDIATRVHNHTWKLDPIVRSLIDTDFYKLLMLQMIWKLYPEV
FT                   DATFSLINRTKTVRLAEEIDEMELREQLDHARTLRLSKKENIWLAGNTFYGRSQIFEPE
FT                   FLSWLSSYQLPEYELFKRDGQYELNFHGRWMDTTLWEIPALSIINELRSRSAMRSLGYF
FT                   TLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTG
FT                   TSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEELAAAPYQVLKDWNRLYGGNLLIVL
FT                   PDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTKMLIFSDGL
FT                   DVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASLKPISIVCKVSDANGRPAV
FT                   KLSDNPQKATGDPAEVERYLKFFGEEDHKEQKVLV"
FT   gene            complement(218477..219871)
FT                   /locus_tag="Atu0214"
FT                   /old_locus_tag="AGR_C_368"
FT   CDS_pept        complement(218477..219871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0214"
FT                   /old_locus_tag="AGR_C_368"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86032"
FT                   /db_xref="GOA:A9CKK0"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKK0"
FT                   /protein_id="AAK86032.1"
FT                   /translation="MAPYQFIERPTPFSSKAGSTLPVFAVTPAHIEQGAIDPVALDWAK
FT                   KAGFKAEAGAVLLVPSSDGSLGGVLLGLGGNPSEVPFITGKLARELPEGEWHIETAPLT
FT                   ANRLALGFGLGSYRFDKYKTTKTSGAKLLIPQDAEDGEIKRVLAGVFLARDLINVPAND
FT                   MGPDELEIAFRALAAHYKAKVNVTTGDDLLKENFPLIHAVGRASESAPRLLEMNWGKKG
FT                   NPRLTLVGKGVCFDTGGLDIKPAASMALMKKDMGGAANVLGLALMIMDAKLPVDLRVLV
FT                   PAVENSISANAFRPGDIYKSRKGLTVQIDNTDAEGRLVLADALAYADEDAPDLMIDMAT
FT                   LTGAARVALGPDLPPFYTDDADLAHDIAEASIDTDDPLWRMPLYMGYDKDIRSRAADIT
FT                   NAPSGGMGGSITAALFLKRFVTNTKRWAHFDIYGWSLSERHHSSIGGEAQGIRALFHYI
FT                   AHQFAK"
FT   gene            220014..220838
FT                   /locus_tag="Atu0215"
FT                   /old_locus_tag="AGR_C_369"
FT   CDS_pept        220014..220838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0215"
FT                   /old_locus_tag="AGR_C_369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86033"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ9"
FT                   /protein_id="AAK86033.2"
FT                   /translation="MTAFSLGETRRTGLLRGACLAALVLAVSGCASTNKPDRMSTGSIP
FT                   AATRSYDHLNMEQLRQAEETAGKAYERNPKDRSVGMNYASVLMMTGKNTQALAVMQQIA
FT                   IANPADREVLAAYGKSQAAAGQLEQALSTIQRAQTPDRPDWRLYSAEGAVLDQLGRSNE
FT                   ARSRYRQALDLKPNDPSVLSNLGMSYVLSSDPRTAETYLQSAISQPGADSRVRQNLALV
FT                   VGLQGRFAEAERIAVQELSAQQAQANLTYLRAMLSQQNSWQQLAKKDRKPAG"
FT   gene            complement(220902..221888)
FT                   /gene="ctpI"
FT                   /locus_tag="Atu0216"
FT                   /old_locus_tag="AGR_C_371"
FT   CDS_pept        complement(220902..221888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpI"
FT                   /locus_tag="Atu0216"
FT                   /old_locus_tag="AGR_C_371"
FT                   /product="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86034"
FT                   /db_xref="GOA:A9CKJ8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ8"
FT                   /protein_id="AAK86034.1"
FT                   /translation="MTGDLFSRLTDPQTIIAILVTLAVFATLYTLIMPFLERKDLAKRM
FT                   KAVSSERELIRSRERERLATVTRDGRTSLRGNNNKSARRIVEKFNLREALADQNTMNKL
FT                   RAAGFRSQNALNTFLAARFVLPFIFLAVAFTWVFVLGNLADKAFVVRLMAVLVFGYIGF
FT                   YAPNIYVSNRMTKRQASIKRAWPDALDLMLICIESGVSMESAMRRVAEEMGEQSPELAE
FT                   EMILTTAELSFLQDRRTALENFGMRTQLDGVKSVVQALIQAERYGTPLAQALRVLAQEG
FT                   RDERMNEAEKKAAALPPKLTVPMIIFFLPVLIAVILGPAGIRVADTF"
FT   gene            complement(221898..222902)
FT                   /gene="ctpH"
FT                   /locus_tag="Atu0217"
FT                   /old_locus_tag="AGR_C_372"
FT   CDS_pept        complement(221898..222902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpH"
FT                   /locus_tag="Atu0217"
FT                   /old_locus_tag="AGR_C_372"
FT                   /product="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86035"
FT                   /db_xref="GOA:A9CKJ7"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ7"
FT                   /protein_id="AAK86035.1"
FT                   /translation="MDPTIVLLAVLVAISAGALAYAFLFQQIEVEKKTTSRFKRVQAAE
FT                   TDHTNIKAARDRVQELSKRRKSMQDSLRDMEKKQNEKAKKAKNVSLRDKLVQAGLTISV
FT                   RQFHLLSAGAAACAAFISLIYGLSLLTALPIAVVAALGLPRWVLAFLLKRRQKKFLEEF
FT                   PNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGIGIPQGIERMMLT
FT                   MPLFEVSFFSIVINIQAQAGGNLSEALSNLSRVLRDRRKMRAKVNALSMEAKASAVIIG
FT                   ALPFIVMLLVHFTSPDYLSILFTDTRGHLILGASAIWMLIGIFIMRQMINFDI"
FT   gene            complement(222917..224392)
FT                   /gene="ctpG"
FT                   /locus_tag="Atu0218"
FT                   /old_locus_tag="AGR_C_373"
FT   CDS_pept        complement(222917..224392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpG"
FT                   /locus_tag="Atu0218"
FT                   /old_locus_tag="AGR_C_373"
FT                   /product="component of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86036"
FT                   /db_xref="GOA:Q7D1X7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1X7"
FT                   /protein_id="AAK86036.2"
FT                   /translation="MFGKRGPEGPARSTKLEPVAPAVSMQVATASEPRSPATDTLEPGQ
FT                   SPVTRQVTTGAPLSQKKRARTEDYYNTKSQVFSALIDTIDLSQLAKLDAESAREEIRDI
FT                   VNDIITIKNFAMSIAEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGSGQTFIEVG
FT                   GKTIESDIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDG
FT                   PALTIRKFKRDKLTLDQLVRFGAITPEGATLLKIIGRVRCNVVISGGTGSGKTTLLNCL
FT                   TSFIDKDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERI
FT                   VVGEVRGPEVFDLLQAMNTGHDGSMGTLHANTPRECLSRIESMIAMGGFTLPAKTVREI
FT                   ISGSIDVVIQAARLRDGSRRITQITEVIGMEGDVIVTQDLMRYEIEGEDAQGRLIGRHV
FT                   STGISKPHFWDRARYYGEDKRLAAALDEMEKSS"
FT   gene            complement(224426..225709)
FT                   /gene="ctpF"
FT                   /locus_tag="Atu0219"
FT                   /old_locus_tag="AGR_C_376"
FT   CDS_pept        complement(224426..225709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpF"
FT                   /locus_tag="Atu0219"
FT                   /old_locus_tag="AGR_C_376"
FT                   /product="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86037"
FT                   /db_xref="GOA:Q7D1X6"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1X6"
FT                   /protein_id="AAK86037.2"
FT                   /translation="MSAVEYDIKLSGGAEAEPPLRASDMDRLRPLPRISIHAFCVSDTM
FT                   QAVMEALSSDRRLSRVTLRVTKGDINAAATMFSASPTPNLIILETASATASLLNDLAPL
FT                   AEVCDPSTRVIIIGRHNDITLYRDLIRNGISEYLVAPVNMADLLGSIAAIFVDPEAEPL
FT                   GRNIAFIGAKGGVGSSTIAHNCAFGISSLFSTETILADMDLAYGTANIDFDQDPAQGMA
FT                   EAVFSPERLDEVFLDRLLTKCSDHLSLLAAPSLLDRTYDLDRQAFLPILEVLQRSAPVA
FT                   VLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKLRPNDKLPHLVLNQ
FT                   VGMPKRPEITPADFLEPLEIEPIAIIPFDAQLFGNAANSGRMISEMDEKSQTAETFSQI
FT                   AHTITGRSVLRKNRRGGLEKLKNILKRK"
FT   gene            complement(225744..226325)
FT                   /gene="ctpE"
FT                   /locus_tag="Atu0220"
FT                   /old_locus_tag="AGR_C_378"
FT   CDS_pept        complement(225744..226325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpE"
FT                   /locus_tag="Atu0220"
FT                   /old_locus_tag="AGR_C_378"
FT                   /product="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86038"
FT                   /db_xref="GOA:A9CKJ6"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ6"
FT                   /protein_id="AAK86038.2"
FT                   /translation="MTTNAIPDDYRTRHPITLSEAEHSLDIPVSAGDSRLTTAMADNVR
FT                   GFAQNYASMSTGIVNIQMPSGSPNSATAARMAKQIRSTLSGAGVAQGKIMETRYAASPN
FT                   GDSAPIRLSYVAVTAMTGQCGQWPEDLSDNTFANKNWYNFGCASQSNLAAQIANPMDLV
FT                   GPRGMSPIDAERRAVVIDTYRSGTATAPTN"
FT   gene            complement(226493..228076)
FT                   /gene="ctpD"
FT                   /locus_tag="Atu0221"
FT                   /old_locus_tag="AGR_C_379"
FT   CDS_pept        complement(226493..228076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpD"
FT                   /locus_tag="Atu0221"
FT                   /old_locus_tag="AGR_C_379"
FT                   /product="component of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86039"
FT                   /db_xref="GOA:A9CKJ5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ5"
FT                   /protein_id="AAK86039.1"
FT                   /translation="MTGGLMTKRFKHHLRSSMAGGLAFCLTFSGVPGRHSPDFLRTSEA
FT                   EAQSASIVRITESGTGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADAVTRTSRRIY
FT                   LFGKMVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVEIVSDNIVL
FT                   TGSVRTPQDSARAVQLADAFLKGGEATTRNISLTGGNNGGDAAIFAERRQVSQIVNMLT
FT                   IEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSGNGFEFANPSNLGNAIDGASRIAS
FT                   GAIGSGSLRFASYLNAMEQAGVMRTLAEPSLTAISGEQAKFYVGGDFRLAAEQEVDIDK
FT                   ETGRPTITRTTNTVDYGITLNFKPVVLSPGRISLKIETNVSEPTYEGNVVTGNGGRTIP
FT                   GSTYMSVRKRETSTTVELPSGGSIVIAGLVQDNVRQAMSGLPGMSKIPIFGTLFRSKEF
FT                   LRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYGRKDQVQAAP
FT                   YQGSVGFIYK"
FT   gene            complement(228073..228879)
FT                   /gene="ctpC"
FT                   /locus_tag="Atu0222"
FT                   /old_locus_tag="AGR_C_380"
FT   CDS_pept        complement(228073..228879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpC"
FT                   /locus_tag="Atu0222"
FT                   /old_locus_tag="AGR_C_380"
FT                   /product="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86040"
FT                   /db_xref="GOA:A9CKJ4"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ4"
FT                   /protein_id="AAK86040.1"
FT                   /translation="MKPSRIVILSVALVAAGLAGLVAMQISGAKQVIEKAETIIQKEPT
FT                   VNVLISSVNLPVGSRLNDSSMRWTPWPQGNVVDSFITQAKRPDAITELAGTVVRLPLFE
FT                   GEPIRPEKVVDSSTRIMSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKGENG
FT                   NFLTENVLNNVRVLAIDQQIKEGEDGIAAVVGATATLELTPEQAKIITVAQQMADRLTL
FT                   ALRSVADAQENDTLSAGHLLSGSSGQPEIQVIKSGSIVKSGQGASQ"
FT   gene            complement(229013..229525)
FT                   /gene="ctpB"
FT                   /locus_tag="Atu0223"
FT                   /old_locus_tag="AGR_C_382"
FT   CDS_pept        complement(229013..229525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="Atu0223"
FT                   /old_locus_tag="AGR_C_382"
FT                   /product="components of type IV pilus, prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86041"
FT                   /db_xref="GOA:A9CKJ3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ3"
FT                   /protein_id="AAK86041.1"
FT                   /translation="MIVAAIFLILPLCLCFAALNDLFSMTIPNVITVVLLLSFAFIAPF
FT                   AGMDFQTFGLSLAGGLIVFLGCFALFAANVMGGGDAKLLTGAAVWYGFNISLVEFLLAV
FT                   TLVGGALTVGILLLRSRSQEIMAFGIPIPDSLMVAQKIPYGIGIAIAGLLTYGEAPLVK
FT                   AAIASIL"
FT   gene            complement(229627..229818)
FT                   /gene="ctpA"
FT                   /locus_tag="Atu0224"
FT                   /old_locus_tag="AGR_C_383"
FT   CDS_pept        complement(229627..229818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="Atu0224"
FT                   /old_locus_tag="AGR_C_383"
FT                   /product="components of type IV pilus, pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86042"
FT                   /db_xref="GOA:Q7D1X1"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1X1"
FT                   /protein_id="AAK86042.2"
FT                   /translation="MTKIFARFLKDESGATAIEYGLIAALISVAIIGGASTLGGKLKDT
FT                   FTFIGKSFTDSKASTGGV"
FT   gene            complement(229889..230143)
FT                   /locus_tag="Atu0225"
FT   CDS_pept        complement(229889..230143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIR7"
FT                   /protein_id="AAL41248.1"
FT                   /translation="MRMIVTCNEMVFSSLFNRLKTEHVRLHETALLKKRKVIRLKIHLF
FT                   IRKYKNAENTFNFYLPRGTHPSVYFELIVFFKRLEIARL"
FT   gene            230262..230645
FT                   /locus_tag="Atu0226"
FT                   /old_locus_tag="AGR_C_384"
FT   CDS_pept        230262..230645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0226"
FT                   /old_locus_tag="AGR_C_384"
FT                   /product="PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86043"
FT                   /db_xref="GOA:Q7D1X0"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1X0"
FT                   /protein_id="AAK86043.2"
FT                   /translation="MVGLSVFLGAAAQPVFAQDDILRVSMNHARVLRLDRPVSKVIVGN
FT                   SKVADATVADATTIVLTGRSFGTTNLVLLDAEGNPIVDERILVSIDEGNTVRVFRQTER
FT                   TVLSCTPNCEQHSQNSGDKDAQP"
FT   gene            complement(230832..230918)
FT                   /locus_tag="Atu0227"
FT   tRNA            complement(230832..230918)
FT                   /locus_tag="Atu0227"
FT                   /product="tRNA-Leu"
FT   gene            complement(231038..231343)
FT                   /locus_tag="Atu0228"
FT                   /old_locus_tag="AGR_C_387"
FT   CDS_pept        complement(231038..231343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0228"
FT                   /old_locus_tag="AGR_C_387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86045"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2FA8"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ2"
FT                   /protein_id="AAK86045.1"
FT                   /translation="MTETKPRIAIRYCTQCNWLLRAGWMAQEILQTFASDIGEVSLIPS
FT                   TGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRDLIDPERDLGHVDRTKHEGLDT"
FT   gene            231481..231930
FT                   /locus_tag="Atu0229"
FT                   /old_locus_tag="AGR_C_388"
FT   CDS_pept        231481..231930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0229"
FT                   /old_locus_tag="AGR_C_388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86046"
FT                   /db_xref="GOA:A9CKJ1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ1"
FT                   /protein_id="AAK86046.2"
FT                   /translation="MAQFENNRQRLFVPAVAPLYNSTHDLVETILRVAAGLLLVTHGFG
FT                   KIVNPFGAVGMVESLGFHPGVFWSPLLAATEFFGGILVAIGLFTRPASFAAMIVLLVTV
FT                   YFHGIVKAEGLGGAEKSILWAAIFLFFAVRGGNRHSVDAKLTREF"
FT   gene            complement(231934..232092)
FT                   /locus_tag="Atu0230"
FT   CDS_pept        complement(231934..232092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41252"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIR3"
FT                   /protein_id="AAL41252.2"
FT                   /translation="MFSMIATRIRPLGDDDGLNRQKLPIESSFTTGKNDFQERGIVFEA
FT                   VADGAAF"
FT   gene            232091..232765
FT                   /gene="guaA"
FT                   /locus_tag="Atu0231"
FT                   /old_locus_tag="AGR_C_389"
FT   CDS_pept        232091..232765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="Atu0231"
FT                   /old_locus_tag="AGR_C_389"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86047"
FT                   /db_xref="GOA:Q7D1W7"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1W7"
FT                   /protein_id="AAK86047.2"
FT                   /translation="MAGTPHGQIGVALREAAADIHIIRAYAGDPLPEDADDHDALVVLG
FT                   GEQNAVDDVLYPYLPDLALLMKAFGDAGKAVMGVCLGSQLLARAYGGENILSGPPEFGW
FT                   QDVSLTPEGLSDPLLAGQQQNFPIFQWHCDTFTLPPDATRLATNAATQNQAFRIGRAAY
FT                   GTQFHFEASTEVVDEWCRRFPGSVERMSPGWLENYGDHRGTRAQMADMTGLEIARAWIR
FT                   LI"
FT   gene            232853..233041
FT                   /locus_tag="Atu0232"
FT                   /old_locus_tag="AGR_C_390"
FT   CDS_pept        232853..233041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0232"
FT                   /old_locus_tag="AGR_C_390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86048"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="PDB:2K7I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIR1"
FT                   /protein_id="AAK86048.1"
FT                   /translation="MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESI
FT                   KRNSAGADTVDLTTMTA"
FT   gene            233224..234321
FT                   /locus_tag="Atu0233"
FT                   /old_locus_tag="AGR_C_393"
FT   CDS_pept        233224..234321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0233"
FT                   /old_locus_tag="AGR_C_393"
FT                   /product="lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86049"
FT                   /db_xref="GOA:Q7D1W5"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1W5"
FT                   /protein_id="AAK86049.2"
FT                   /translation="MRSSAVPALLFGCLLLGGCTSSSGPESLMAGLPSKETTSSVKPSA
FT                   PVPQASVGTQPITAQPRQEVLAWGGPVPDEPKAFSAVTPKASLPQNAPEIRLPVPSQTG
FT                   MVRPAERPMERPVQLAMAAAPAASAGAQIRSRIFRSSFSDAKPINFGRVQPRHFQVHGV
FT                   DVSRWQANIDWPQLRTRGANFAFIKATDGGDHLDPMFRTNWQRAKEAGIRRGAYHFFYW
FT                   CRNASEQADWFIRNVPRDPDALPPVIDVEYNGESSCKMRHSRERVLEKMRVFMDKLERH
FT                   YGQRPIIYTAPDFYKDNLQGEFHDYPFWLRAVAQHPSAVYPGRKWLFWQYSGSGLSHGV
FT                   DGRIDLNVFNGSEESWHRWVDRRSS"
FT   gene            complement(234325..235200)
FT                   /locus_tag="Atu0234"
FT                   /old_locus_tag="AGR_C_394"
FT   CDS_pept        complement(234325..235200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0234"
FT                   /old_locus_tag="AGR_C_394"
FT                   /product="conserved hypothetical protein, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86050"
FT                   /db_xref="GOA:A9CKJ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKJ0"
FT                   /protein_id="AAK86050.1"
FT                   /translation="MDKTTSGWLNGLTGVVIFSGSLPATRLAVTGFDPVFLTAARASIA
FT                   GLLALALLFLFRQKRPARGDLTSLIIVSIGVVVGFPLLTALALRHVTSAHSIIFVGLLP
FT                   LATAIFAVMRGGERPRPVFWLFSCLGSALVAGFSLSNSFAARIEASLAGDLLMLGAIIV
FT                   CGLGYAEGAALSRKLGGWQVISWALVLSLPVMLPLAFFTGPETLGGIDPQAWGGLAYVS
FT                   LFSMLIGFIFWYRGLALGGIAAVGQLQLLQPFFGLALAATLLHEEVSPAMIGVTLVVVL
FT                   CVAGARKFAR"
FT   gene            235332..236705
FT                   /locus_tag="Atu0235"
FT                   /old_locus_tag="AGR_C_398"
FT   CDS_pept        235332..236705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0235"
FT                   /old_locus_tag="AGR_C_398"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86051"
FT                   /db_xref="GOA:Q7D1W3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1W3"
FT                   /protein_id="AAK86051.2"
FT                   /translation="MAGTRIEKVMANIRQRITSRSLVPGARLPSVRALAKTMQLSTSTI
FT                   VEAYDRLVADGTISSRPGSGFFVAGPLAPLSLADIEPRLDRAVDPLWVSRQALDDGSAL
FT                   AKPGCGWLPASWMPQEALRRAMRGLARADDALLTDYGSPMGLLPLRQLLSRRLAEHGVQ
FT                   AGASQIMLTDSGTQAIDLLCRFLLQPGDTVVVDDPCYFNFHALLRAHRVKIVGVPYTPA
FT                   GPDLPLFEQALKEHQPRLYITNSAIHNPTGARLSAVSAHRLLMLAEQPGLTIIEDDIFA
FT                   DFETQAAPRLAAFDGLNRVVQIGSFSKTLSASVRCGFIAAPRAWVEALTDLKIATAFGG
FT                   THFSAALVLSLLTDGSYRKHVEALRQRLAAAVPEAATRLRSIGCMPWIEPQAGMFLWCR
FT                   LPEGTDAADVAQRALARQVVLAPGNVFSSSQNASGFMRFNVSQMVGPQVMTVLADALR"
FT   gene            236801..237118
FT                   /locus_tag="Atu0236"
FT                   /old_locus_tag="AGR_C_401"
FT   CDS_pept        236801..237118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0236"
FT                   /old_locus_tag="AGR_C_401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86052"
FT                   /db_xref="GOA:A9CKI9"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI9"
FT                   /protein_id="AAK86052.1"
FT                   /translation="MTFDPNNPRPDRDLRPELNISNEPQARTSSSWVPWLAIIVVVLVG
FT                   VFAWSQMSGPTTDPATTSSTTPPAATDQAPAPMAPTTPATPPVNNTAPASPNTGGTQTQ
FT                   P"
FT   gene            complement(237190..237648)
FT                   /locus_tag="Atu0237"
FT                   /old_locus_tag="AGR_C_402"
FT   CDS_pept        complement(237190..237648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0237"
FT                   /old_locus_tag="AGR_C_402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86053"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI8"
FT                   /protein_id="AAK86053.1"
FT                   /translation="MRHDTRLSRVLHILIHMEKHEGAATSENIAAMLQTNPVVVRRTMA
FT                   GLREHGYVSSEKGHGGGWVLAQPLTEITLLDIYRALGAPELFSIGLAGDNPNCVIEQAV
FT                   NAALFDAMNEAENILLSRFGSITLSTLAEESIDRWSKLSNCPSAMEQL"
FT   gene            237803..238696
FT                   /locus_tag="Atu0238"
FT                   /old_locus_tag="AGR_C_405"
FT   CDS_pept        237803..238696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0238"
FT                   /old_locus_tag="AGR_C_405"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86054"
FT                   /db_xref="GOA:A9CKI7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:3FBS"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI7"
FT                   /protein_id="AAK86054.1"
FT                   /translation="MKFDVIIIGGSYAGLSAALQLGRARKNILLVDAGERRNRFASHSH
FT                   GFLGQDGKAPGEIIAEARRQIERYPTIHWVEGRVTDAKGSFGEFIVEIDGGRRETAGRL
FT                   ILAMGVTDELPEIAGLRERWGSAVFHCPYCHGYELDQGKIGVIAASPMAIHHALMLPDW
FT                   GETTFFTNGIVEPDADQHALLAARGVRVETTRIREIAGHADVVLADGRSIALAGLFTQP
FT                   KLRITVDWIEKLGCAVEEGPMGSTIVTDPMKQTTARGIFACGDVARPAGSVALAVGDGA
FT                   MAGAAAHRSILFPEMR"
FT   gene            complement(238693..239589)
FT                   /locus_tag="Atu0239"
FT                   /old_locus_tag="AGR_C_407"
FT   CDS_pept        complement(238693..239589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0239"
FT                   /old_locus_tag="AGR_C_407"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86055"
FT                   /db_xref="GOA:Q7D1V9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1V9"
FT                   /protein_id="AAK86055.2"
FT                   /translation="MTAILVSNMRTQSGCGYEREAILAPRGSNDLERSCKFEGIVQARS
FT                   SEGIERIDARFHGNAYAPHRHDTYALGVTLSGVQTFSYRGTSHFSMPGNVIVLHPDEIH
FT                   DGGAGTDEGLHYRMLYLPPEKTTEAGYNTLPFARSAVIEDEEFRQCLTEALGNLDGEPD
FT                   SLLLTDWQSRLSDLLWKHSNGSARSIKWIDRAAVLLCRDYLLENSADTVVSQELEQISG
FT                   LDRFTLFRHFRCVFGTSPHRYLIMRRLQKCKDMMRAGASLAETAFACGFADQAHFTRHF
FT                   KNAFGMPPGRWLSLVSH"
FT   gene            239564..239971
FT                   /locus_tag="Atu0240"
FT                   /old_locus_tag="AGR_C_408"
FT   CDS_pept        239564..239971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0240"
FT                   /old_locus_tag="AGR_C_408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86056"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="PDB:2GAX"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI6"
FT                   /protein_id="AAK86056.1"
FT                   /translation="MFDTKIAVILRDDLAVWQKLNVTAFLMSGIVAQTGEIIGEPYRDG
FT                   AGNVYNPLSIQPIVVMATDQEALRKIHQRSLERDITTSLYIEEMFATGHDAANRQVFSH
FT                   FSPDTAKVVGMALRADRKIVDKITKGAKLHA"
FT   gene            complement(240039..241865)
FT                   /gene="lepA"
FT                   /locus_tag="Atu0241"
FT                   /old_locus_tag="AGR_C_411"
FT   CDS_pept        complement(240039..241865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="Atu0241"
FT                   /old_locus_tag="AGR_C_411"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86057"
FT                   /db_xref="GOA:Q8UIQ2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIQ2"
FT                   /protein_id="AAK86057.1"
FT                   /translation="MSTNSTRTPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLAERDM
FT                   SEQVLDSMDIERERGITIKAQTVRLHYKANNGETYVLNLIDTPGHVDFAYEVSRSLSAC
FT                   EGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPERIKEQIEEVIGID
FT                   ASDAVMISAKTGLGIPDVLEAIVNRLPPPKSDVGENGPLKALLVDSWYDTYLGVMVLVR
FT                   VIDGVLTKGQQIRMMGSGAKYGVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADTRV
FT                   GDTITDDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFSFEME
FT                   SSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLVATAPSVVYEMTLTDGTEKELHNPA
FT                   DMPDVVKIKEIREPWIKATILTPDEYLGGILKLCQDRRGLQTELTYVGNRAMITYELPL
FT                   NEVVFDFYDRLKSISKGYASFDYNIIDYREGDLVKMSILVNGDPVDALSMLVHRSAADR
FT                   RGRGMCEKLKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDATRKRKLL
FT                   DKQKEGKKRMRQFGKVEIPQEAFIAALKMNDE"
FT   gene            complement(241938..242807)
FT                   /locus_tag="Atu0242"
FT                   /old_locus_tag="AGR_C_413"
FT   CDS_pept        complement(241938..242807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0242"
FT                   /old_locus_tag="AGR_C_413"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86058"
FT                   /db_xref="GOA:A9CKI5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI5"
FT                   /protein_id="AAK86058.1"
FT                   /translation="MTRLAASQYAIELIETWEAYAAHLSAIVREAKEKGAELLLLPEYS
FT                   AMALTGQLPPDARSDLHRSIEEIQPLIPSWVELCEELARQHQILFQPGSAPVKDPDGRF
FT                   RNRAWLFGPDGLIGYQDKQIMTRFEREQWNIHAGVEGLKAFETSIGRLGILICYDNEFP
FT                   MLGRKLAELGVELVLAPSCTDTLAGAYRVRIGAQARALENQYAVLSSPTAGEAPWSPAV
FT                   DENRGRAALYVPSDYGMPASGILAESESDAVTESLMLIADIDLATVARLRTEGQVATRR
FT                   DWPEQFAV"
FT   gene            complement(242804..243415)
FT                   /locus_tag="Atu0243"
FT                   /old_locus_tag="AGR_C_414"
FT   CDS_pept        complement(242804..243415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0243"
FT                   /old_locus_tag="AGR_C_414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86059"
FT                   /db_xref="GOA:A9CKI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI4"
FT                   /protein_id="AAK86059.2"
FT                   /translation="MPMTVEIKSLSGIDAEPYFDDLARLRIEVFRAFPYLYDGSLDYER
FT                   KYLATYADTDGAVFVLALDDGRVVGMSTGMPMIAETDEVKTPFLKTGYDPNRIFYFGES
FT                   VLLHDYRGHGIGVRFFEEREAHAKRLGFDWCTFCAVERPADHPRRPADYVPLNEFWEKR
FT                   GYRHHPELRTSFTWQDLDESSESAKPLSFWMKTIAGDVNE"
FT   gene            243482..243883
FT                   /locus_tag="Atu8117"
FT                   /old_locus_tag="AGR_C_416"
FT   CDS_pept        243482..243883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8117"
FT                   /old_locus_tag="AGR_C_416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8117"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86060"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5N3"
FT                   /protein_id="AAK86060.1"
FT                   /translation="MTAAETIRAYYDAFNRQDMDAFLALLHDEVVHDINQGERQTGKAA
FT                   FASFMDHMNRCYRENLTDMVIMASEDGKRASAEFVVNGEYLKTDEGLPEANGQKYVLPA
FT                   GAFFDLKDGKVSRVTNYYNLNDWIAQVGA"
FT   gene            243980..244561
FT                   /locus_tag="Atu0245"
FT                   /old_locus_tag="AGR_C_418"
FT   CDS_pept        243980..244561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0245"
FT                   /old_locus_tag="AGR_C_418"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86061"
FT                   /db_xref="GOA:Q7D1V5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1V5"
FT                   /protein_id="AAK86061.2"
FT                   /translation="MMETEDRILERSIGERIKVLRAESGLTLERLASESGVSRAMISRI
FT                   ERGEASPTASLLARICAALGLSLSGFFAENEEAVSPLVKKRDQQLWKDPETGYVRRAIS
FT                   PPRVGSDVDIVEVEFPAGARVGFPPHAASRGMTQYVWLFEGVLEMTSGGVVHLMDPGDC
FT                   LFMPVGEGHVFHNPSQKPARYAVVLDQRQR"
FT   gene            244579..245097
FT                   /locus_tag="Atu0246"
FT                   /old_locus_tag="AGR_C_420"
FT   CDS_pept        244579..245097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0246"
FT                   /old_locus_tag="AGR_C_420"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86062"
FT                   /db_xref="GOA:A9CKI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI3"
FT                   /protein_id="AAK86062.1"
FT                   /translation="MATIRVLNGQETIDALPELCDVLAECVKGGASVGFMLPFSPRDAE
FT                   PYWRSVAENVGEGGTIHVVAEVDGRVVGTVQVGLASKPNQPHRGDLMKLLVHPEARGLG
FT                   LARKLMEKAEQEAAARGRTLLVLDTATGSDAEAIYPRLGWQRVGVIPDYALFPDGRYCG
FT                   TTLFYKRIG"
FT   gene            complement(245112..246185)
FT                   /locus_tag="Atu0247"
FT                   /old_locus_tag="AGR_C_423"
FT   CDS_pept        complement(245112..246185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0247"
FT                   /old_locus_tag="AGR_C_423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86063"
FT                   /db_xref="GOA:A9CKI2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI2"
FT                   /protein_id="AAK86063.2"
FT                   /translation="MRTFTTITTFLFSALAIQPLFAGEAVGVSDIAIHSPDRGKDLAVT
FT                   IWYPSDGKGTQVLSGEDRIFQGTPAFKDAAVQPGRLPLVLLSHGSGSRVSGMAWIAEKL
FT                   ASEGFIVAGTNHPGTTSGDSTPADTPKIWERTSDLSAIVTALTTQGKWSASIDAGRIGV
FT                   LGFSLGGSAAMEISGARADLEAYARYCEKEAAMMDCQWFDGGQAYVNNEPVSVPKLDLR
FT                   TLDKARFEQQNRDPRIRSAVLVDPGLALAFQPESLRKIDIPLTFINLGSKGKIPPAVLA
FT                   DRLAAEVPGATYRQVDEADHFSFLPLCKEGASAFLKSVGERDPICEPTGPRDRSDIHAE
FT                   LEKMIVAAFNRTLKPGQ"
FT   gene            246323..247420
FT                   /locus_tag="Atu0248"
FT                   /old_locus_tag="AGR_C_425"
FT   CDS_pept        246323..247420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0248"
FT                   /old_locus_tag="AGR_C_425"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86064"
FT                   /db_xref="GOA:A9CKI1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI1"
FT                   /protein_id="AAK86064.1"
FT                   /translation="MFVLFIPLPFVVGLLLVVMFIVFLRSGDDVRTNRAFLASIALCAV
FT                   QSVLVGLRWGYGISEMRYALPILAACLPPLIYIAFRGLMGAGVESRRVMLASLALSPLL
FT                   IVVLEFAFPAAIDIALITIFVGHAVALLLLGRKGPDGLDEAQFASVASAHRALIIAAVA
FT                   LCVSALFDLLVFFDFEWAQGQNVAALVSNANLFGLLLIGLMAALAGKSKAPQTAAEPIS
FT                   DLSSPAEPSEQDRDIVARVDRLMEVQALYRDENLNLSRLARRLGLPSRQISGAINRSLG
FT                   VNVSQYVNQLRIREACRLLEETEQSVTAIMLSAGFQTKSNFNREFRRVTGMSPVDWRER
FT                   EVWKLVSNTKTATWQMPDGRLRILK"
FT   gene            complement(247424..248527)
FT                   /locus_tag="Atu0249"
FT                   /old_locus_tag="AGR_C_426"
FT   CDS_pept        complement(247424..248527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0249"
FT                   /old_locus_tag="AGR_C_426"
FT                   /product="ABC transporter, substrate binding protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86065"
FT                   /db_xref="GOA:A9CKI0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKI0"
FT                   /protein_id="AAK86065.1"
FT                   /translation="MDRRSFIRKAGAVGAGVTATALAAPAIAQENPKITWRMTSSFTKG
FT                   LDILFGAGQIVADHVKEASGGNFVIQHFAGGEIVPALQAADAVTAGTVEMAHTCSYYYV
FT                   GKDPTFALGTSVPFGLNARQTNAWFNQAGGNELLNEFLAQHNIYSILLGNTGAQMGGWF
FT                   RKEINTIDDLKGLKMRIAGLTGQVMQKVGVTPQQIAGGDVYAALEKGTIDATEFVGPYD
FT                   DQKLGFYKVAKYYYYPAWWEGGPAVHAFVNLQKFNDLPENYKRILKDACAAGSASMLER
FT                   YDARNPKALKELVAQGAILRPFSQEILDVCHKAAQDTYAEISAKNESFKKIYESQQAFK
FT                   KDAYLWAQIAEYTYDTYMMIQQRNGTL"
FT   gene            complement(248655..249062)
FT                   /locus_tag="Atu0250"
FT                   /old_locus_tag="AGR_C_428"
FT   CDS_pept        complement(248655..249062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0250"
FT                   /old_locus_tag="AGR_C_428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86066"
FT                   /db_xref="GOA:Q7D1V0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1V0"
FT                   /protein_id="AAK86066.2"
FT                   /translation="MAEIGVDAAFIDLLVETFYGRVLEHQTLGPVFDARLAGRWPEHMA
FT                   RMKQFWTAIAFKNGSYGGKPVQAHLGVQGMSAELFPQWLALFSVTLDDIAPSRKAHDWF
FT                   METAERIARSLTLSLFYNPAMDDPAVKRSRS"
FT   gene            249269..250252
FT                   /locus_tag="Atu0251"
FT                   /old_locus_tag="AGR_C_430"
FT   CDS_pept        249269..250252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0251"
FT                   /old_locus_tag="AGR_C_430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86067"
FT                   /db_xref="GOA:A9CKH9"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH9"
FT                   /protein_id="AAK86067.1"
FT                   /translation="MFRSLFSLSKRPFSSLGEQEILALAISSEEDDSRIYRSYADHLRA
FT                   QYPQSAKVFEDMAEVEQQHRNVLIDMHRRRFGETIPLIRREHVRGFYERTPDWLVKNLS
FT                   LEKIRAQAELMEAQAIRFYDEAVKRTTDASTRKLLGDLAEAERGHEDIAQMLEEKHLDE
FT                   GGRTEEEETAKRQFLLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLIGLSASV
FT                   GAGISMGFTEAAHDDGKLSGRGSPLKRGLASGIMTAVGGLGHALPYLIPHFWTATAIAA
FT                   IVVFVELWAIAFIQNRFMETPFLRAVFQVVLGGSLVLAAGIIIGNA"
FT   gene            complement(250317..250832)
FT                   /locus_tag="Atu0252"
FT                   /old_locus_tag="AGR_C_433"
FT   CDS_pept        complement(250317..250832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0252"
FT                   /old_locus_tag="AGR_C_433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86068"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH8"
FT                   /protein_id="AAK86068.2"
FT                   /translation="MVTGGITSQPIGHYEFCQKYADECNIRSKVTPPPRVTDYGWGVIR
FT                   EINTSVNTTIVAMTDQEIYGKDEVWEYPTTAGDCEDFVLLKRKKLIERGFSVADLLITV
FT                   VRKPDGEGHAVLTLRTTDGDYILDNLTDDVKLWTDTNYTYLKRQASFNTGRWISIEDGR
FT                   DVLVGALR"
FT   gene            complement(251051..251839)
FT                   /locus_tag="Atu0253"
FT                   /old_locus_tag="AGR_C_435"
FT   CDS_pept        complement(251051..251839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0253"
FT                   /old_locus_tag="AGR_C_435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86069"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1U7"
FT                   /protein_id="AAK86069.2"
FT                   /translation="MTEQAAEFLHIGMGEDARNIAFLHRPATSQPDAPTLVWLGGYRSD
FT                   MTGTKAVELDRFAAENGLACLRLDYSGHGASGGDFNKGTISRWLEEALAVVRAKASSRV
FT                   VLVGSSMGGWIALRMIEELRKSGGAPSVAGLVLIAPAPDFTQELIEPSLSDAEKTSLAE
FT                   RGYFEEHSDYSPEPNIFTRALMEDGKQNRVLTGIITTGCPVHVLQGMRDPDVPYQHALK
FT                   LIEHLPSDDVVLTLIRDGDHRLSRPQDIERMLAAVKALAI"
FT   gene            252141..252563
FT                   /gene="infC"
FT                   /locus_tag="Atu0254"
FT                   /old_locus_tag="AGR_C_436"
FT   CDS_pept        252141..252563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="Atu0254"
FT                   /old_locus_tag="AGR_C_436"
FT                   /product="translation initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86070"
FT                   /db_xref="GOA:A9CKH7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH7"
FT                   /protein_id="AAK86070.1"
FT                   /translation="MPTDQALKMAEEAGLDLVEISPNAEPPVCKILDLGKLKYSTQKKA
FT                   AEARKKQKIVEVKEIKMRPNIDTHDYDVKMKAMNRFFDEGDKVKVTLKFRGREMAHQEL
FT                   GMKLLLQVKEDTQAIAKVEAEPKLEGRQMMMVLAPR"
FT   gene            252753..252956
FT                   /gene="rpmI"
FT                   /locus_tag="Atu0255"
FT                   /old_locus_tag="AGR_C_437"
FT   CDS_pept        252753..252956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="Atu0255"
FT                   /old_locus_tag="AGR_C_437"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86071"
FT                   /db_xref="GOA:Q8UIN8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIN8"
FT                   /protein_id="AAK86071.1"
FT                   /translation="MPKMKTKSAAKKRFKITATGKVVAAAAGKRHGMIKRTNKFIRDAR
FT                   GTMVLAEADGKKVVKNYLPNGL"
FT   gene            252997..253401
FT                   /gene="rplT"
FT                   /locus_tag="Atu0256"
FT                   /old_locus_tag="AGR_C_439"
FT   CDS_pept        252997..253401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Atu0256"
FT                   /old_locus_tag="AGR_C_439"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86072"
FT                   /db_xref="GOA:Q8UIN7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIN7"
FT                   /protein_id="AAK86072.1"
FT                   /translation="MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQY
FT                   AYRDRKVNKRNFRALWIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPA
FT                   AFGALVEAAKKALEYLKDAGTTNEFETAVK"
FT   gene            253566..254444
FT                   /locus_tag="Atu0257"
FT                   /old_locus_tag="AGR_C_441"
FT   CDS_pept        253566..254444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0257"
FT                   /old_locus_tag="AGR_C_441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86073"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1U5"
FT                   /protein_id="AAK86073.2"
FT                   /translation="MLVNKSEVVETEGFRVHLDDDDIATVMRVLLKSDRRIQKVELSQL
FT                   TVWIKRQGTERVTWWMKMQKLLSKLLPYTFLRPSEPLDGAGLMQRELETLQQFQQRGFP
FT                   VPPLIYSSRTAVVLGDVGPTLMERMDALKSSDPVEHDALLVKSAEALGELHAAGLCHGR
FT                   PHVRDFFLKDGRVGFMDFEERPQEVMPLETAQARDIWLLFLQVATRACDAPKTRDAAFS
FT                   RWLENTPPRAVEELSRLTGILGRFLPLARLIGRVRMGSDLRRFIMATDYLMNAVNTDAA
FT                   VKKSGKAGKDD"
FT   gene            254470..255519
FT                   /gene="pheS"
FT                   /locus_tag="Atu0258"
FT                   /old_locus_tag="AGR_C_443"
FT   CDS_pept        254470..255519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Atu0258"
FT                   /old_locus_tag="AGR_C_443"
FT                   /product="phenylalanyl-tRNA synthetase, alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86074"
FT                   /db_xref="GOA:Q8UIN5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIN5"
FT                   /protein_id="AAK86074.2"
FT                   /translation="MSEIAAAADEPAIEAVRVSALGKKGSVSELLKTLGSMTPEERQTR
FT                   GAAINQLKTEITDLIGERKNALKDAAIAARLKAETVDVSLPVRQSPTERGRIHPISQIV
FT                   DEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFQPDEKGERKVLR
FT                   THTSPVQIRTMESQKPPIRIVIPGKTYRQDSDATHSPMFHQVEGLVIDKKAHVGNLRWV
FT                   LEEFCKTFFEVDSVVMRFRPSFFPFTEPSFEVDIQCDRSGPIVKFGEGKDWMEILGCGM
FT                   VHPNVLRAGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRWMNHYGFRPLDM
FT                   PTLFGGLSV"
FT   gene            255544..257967
FT                   /gene="pheT"
FT                   /locus_tag="Atu0259"
FT                   /old_locus_tag="AGR_C_445"
FT   CDS_pept        255544..257967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="Atu0259"
FT                   /old_locus_tag="AGR_C_445"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86075"
FT                   /db_xref="GOA:Q8UIN4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIN4"
FT                   /protein_id="AAK86075.1"
FT                   /translation="MKFTLSWLKEHLETDATLDEICERLTAIGLEVEDVDDKAAYKPFV
FT                   IAKVVSAEKHPEADRLKVLMVDAGDGKPVQIVCGAPNARAGLVGALARPGVYVPGIDVT
FT                   LAVGKIRGVESHGMMCSEKELNISDDHDGIIDLPEDAPVGTSFATYAGLDDPVIEINLT
FT                   PNRPDCTSIYGIARDLAASGLGKLKTKAAPSFKVEGATPVDVKLELDDAALCPGFSLRI
FT                   VRGVKNGPSPKWMQQRLMAIGLRPINALVDITNYMTFDQGRPMHVFDAAKVKGDLTVRR
FT                   AKDGETILALDQREYKLGPNNVVIADEKGLESIGGVMGGEHSGCDENTIDVLIESALWD
FT                   PINIAKTGRSLGIITDARYRFERGVDPEYMVPGLERTTELVLELCGGIAGEAKIVGYKG
FT                   HQPKVVDFPLSEVKRLTGLEVSSEESLAILKGLGFGVEGTGERVSVTVPSWRPDVDGKA
FT                   DLVEEVMRIHGVDNIKPEPLENFGAVNGRILTTLQIRTRTARRALASRGMLEAVTWSFI
FT                   PEAQAKLFSGGSPALKLANPIAADMSDMRPSLLPGLLTAAQRNADKGHGDVAIFEVSGT
FT                   YEGDTPEKQRRVAGGIRRGTASLAGSGRMWSNAAKGGGKPVDVYDAKADALSVLEACGL
FT                   PMANVQIEAGAPAWYHPGRSGTIKMGPKVVLGYFGEFHPKTLSELDVSGTYCGFEIYLD
FT                   AMPEPKKKATRTKPALELSPFQAVKRDFAFVVDKSVEAGAIIKAATSADRKLITGVNVF
FT                   DIFEGASLGENRKSVAIEVQIQPVDKTLTDEDFEALTAKIVGNVEKSTGGVLRA"
FT   gene            complement(258027..259028)
FT                   /locus_tag="Atu0260"
FT                   /old_locus_tag="AGR_C_447"
FT   CDS_pept        complement(258027..259028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0260"
FT                   /old_locus_tag="AGR_C_447"
FT                   /product="aldo-keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86076"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5N2"
FT                   /protein_id="AAK86076.2"
FT                   /translation="MKKRTLGNNLSVSALGLGCMGMTHAYSPTGDENSAIATLHRAVEL
FT                   GVTFFDTAEVYGPYNNEILVGKGLKPYRDKVVIATKFGFRIDPSKPAGQMMVGTDSRPE
FT                   NVRAVAEASLKRLGVDVIDLFYQHRVDPNVPIEDTLGAMAELVQQGKVKYLGLSEASAE
FT                   TLRKAHAVHPIAAIQSEYSLWTRDVEENGVLETCRELGIGFVPFSPLGRGALTGALKSL
FT                   DGLAADDFRRGLPRFQSENFDANLALIKLLEDMAAEKGVTAGQLALAWVLAQGDFIVPI
FT                   PGTTKIANLEKNVAATDVSLTADEVASLGALLSPAKVAGERYPERMSQMANR"
FT   gene            259145..260035
FT                   /locus_tag="Atu0261"
FT                   /old_locus_tag="AGR_C_448"
FT   CDS_pept        259145..260035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0261"
FT                   /old_locus_tag="AGR_C_448"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86077"
FT                   /db_xref="GOA:A9CKH6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH6"
FT                   /protein_id="AAK86077.1"
FT                   /translation="MNRVQLSQLAVLAAVAEGRSFRKAAAELAIAPSAVSHAVSSLEAS
FT                   LGLRLLHRTTRSVSPTEEGRQLLETLGPALADIDAVIETLAEHGGRPAGPLRITLPRLA
FT                   AEDLIVPRLGEFLRLYPDISLEISTDDRFEDIVAKGFDAGLRLGEHLDADMIAVKASGA
FT                   WRGAIVGAPAYFAENAPPREPRDLIRHRCIRRRFSSGLIYRWELEKNGKPLVVDVQGPL
FT                   ILSDQSLIRRAAIDGAGLAFVFEQRVEEDIAEGRLIRVLEDWCAPFDGFYIYYPSRRQM
FT                   RPALRAFVDFFRFRG"
FT   gene            complement(260036..260479)
FT                   /locus_tag="Atu0262"
FT                   /old_locus_tag="AGR_C_449"
FT   CDS_pept        complement(260036..260479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0262"
FT                   /old_locus_tag="AGR_C_449"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86078"
FT                   /db_xref="GOA:A9CKH5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH5"
FT                   /protein_id="AAK86078.1"
FT                   /translation="MELTIRDTKPADRAEWLRLWNDYLAFYKVDLAEDVTEHTWARILD
FT                   PTSRVSMRVAMLGERMAGFAIHHFHDSTWVKTPDCYLEDLFVDGTIRGKGTGRALMDDL
FT                   ITICKDRGWSRLYWNTDEGNHRAQKLYDNYVKSDGHIRYRITF"
FT   gene            complement(260481..261431)
FT                   /locus_tag="Atu0263"
FT                   /old_locus_tag="AGR_C_452"
FT   CDS_pept        complement(260481..261431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0263"
FT                   /old_locus_tag="AGR_C_452"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86079"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH4"
FT                   /protein_id="AAK86079.2"
FT                   /translation="MEKRSLGRTGLSIAPIVFGGNVFGWTADEKTSFALLDAFFDVGFN
FT                   AIDTADVYSAWVDGHVGGESEAIIGKWLKQSSVKREDAVIVTKVGFDNRGQKTGLSAKW
FT                   IAEAVEASLKRLQTDYIDLYLAHKPDPEVPLEETLAAFAKLKEQGKIRAIGCSNYSASQ
FT                   LQEALDVATKNNLPRYDVLQPEYNLYNRADFEGPIADLCVKEEIGVINYYSLAAGFLTG
FT                   KYRAKADTEGVARSYRVGDYVNTRGLAVLGAMDAVAVQTGAKLADIALAWLLRKKAVTA
FT                   PIASATSLSQLESFKRAVDLKLTDEMMTLLDKAGA"
FT   gene            complement(261540..262523)
FT                   /locus_tag="Atu0264"
FT                   /old_locus_tag="AGR_C_453"
FT   CDS_pept        complement(261540..262523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0264"
FT                   /old_locus_tag="AGR_C_453"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86080"
FT                   /db_xref="GOA:A9CKH3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH3"
FT                   /protein_id="AAK86080.1"
FT                   /translation="MDKGGTRVIPFYTLVPPHALLLDIAGPLQVIRYANNEQNDVFFDC
FT                   RYIAAQEKQQSSIGLGICGLETLPATLPENAFLLISGSTSRSESEPETRRERQALAAWL
FT                   RRVVGLDTTVISICSGALLAGEAGLFDGRSCTTHSDCIETLRRVAPLSQVAENRLFVED
FT                   GNRFSSAGISTGIDLMLHVVSRLTSLAVAARIAQTMVVYLRRNGNDPQISPWLTGRNHM
FT                   HPAIHRVQDRVMAEPARDWSLERLADIAALSERHLSRLFREHTGISVIDYVNLMRVNLA
FT                   RDILSNSRLDMEAIAERAGFASARHLRRVWQQHNRYPPSHYRGFQA"
FT   gene            complement(262523..263083)
FT                   /locus_tag="Atu0265"
FT                   /old_locus_tag="AGR_C_456"
FT   CDS_pept        complement(262523..263083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0265"
FT                   /old_locus_tag="AGR_C_456"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86081"
FT                   /db_xref="GOA:Q7D1U0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1U0"
FT                   /protein_id="AAK86081.2"
FT                   /translation="MSSSNTALLVIDVQESFRHAPYFEESGLAAYLEKQQALIDGAKAA
FT                   GIPVVQIFHVDGDRAFSKDSGYIRALEGVRITPDVTFHKSRHSAFAGTGLEIWLTQRGI
FT                   NRLIVSGIRTEQCCETTTRHASDLGYSVDYITEATLTFPMTHPSGTVFSADDIRKRTEL
FT                   VLAGRFARIATVSEALAPLKAAA"
FT   gene            263264..264247
FT                   /locus_tag="Atu0266"
FT                   /old_locus_tag="AGR_C_457"
FT   CDS_pept        263264..264247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0266"
FT                   /old_locus_tag="AGR_C_457"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86082"
FT                   /db_xref="GOA:Q7D1T9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1T9"
FT                   /protein_id="AAK86082.2"
FT                   /translation="MLRFGIISTAKIAQDHVIPAIQDAENCVVSAIASRDHARARAVAE
FT                   RFSVPHAFGSYEEMLASDVIDAVYIPLPTAQHVEWTIKAANAGKHVLCEKPIALKAEEI
FT                   DTLIAARDRNGVIVSEAFMVTYSPVWAKVKELLASGAIGTLKHVQGAFSYFNRDPGNMR
FT                   NIPELGGGALPDIGVYPTIVTRFATGAEPRRVQATVERDREFGTDIYSSVRADFGTFEL
FT                   SFYLATQLASRQLMVFHGTDGYIEVKSPFNANRWGAEEIELTNQAHNQSQVFRFQDSRQ
FT                   YKLEAEAFARAVRGEGEVVTLENSRKNQLFIDAIYRAAEKDGWETV"
FT   gene            complement(264244..264597)
FT                   /locus_tag="Atu0267"
FT                   /old_locus_tag="AGR_C_459"
FT   CDS_pept        complement(264244..264597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0267"
FT                   /old_locus_tag="AGR_C_459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86083"
FT                   /db_xref="GOA:A9CKH2"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH2"
FT                   /protein_id="AAK86083.1"
FT                   /translation="MRLPHFALTEICGLAVDLAVTCVLIFYLRVDPLVARLPGAAAGLA
FT                   TSWQLNRSNGAELNGFLKNAVTLISRIVGVGLFALLLWRNPLLQPFIPLALSAIAALVL
FT                   ALYGYFRLQKQRT"
FT   gene            complement(264609..264851)
FT                   /locus_tag="Atu0268"
FT                   /old_locus_tag="AGR_C_460"
FT   CDS_pept        complement(264609..264851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0268"
FT                   /old_locus_tag="AGR_C_460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86084"
FT                   /db_xref="GOA:A9CKH1"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH1"
FT                   /protein_id="AAK86084.1"
FT                   /translation="MIFLTATVLGVTAVALRSVFSIVFICMMIIGAYGVAMVLSSTAVP
FT                   LMSLLLALAGYNFGVVGVVIGLLVLQRPRSTQPTL"
FT   gene            265041..266639
FT                   /gene="xseA"
FT                   /locus_tag="Atu0269"
FT                   /old_locus_tag="AGR_C_461"
FT   CDS_pept        265041..266639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="Atu0269"
FT                   /old_locus_tag="AGR_C_461"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86085"
FT                   /db_xref="GOA:Q8UIM4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIM4"
FT                   /protein_id="AAK86085.2"
FT                   /translation="MSDIFSHTALSNLAEFSVSELSGSIKRTVETAFEQVRVRGEISGY
FT                   RGPHSSGHAYFSLKDDRARIDAVIWKGTFSRLKFRPEEGMEVIATGKITTFPGSSKYQI
FT                   VIESLEPAGAGALMALLEDRRRRLAAEGLFDSARKRPLPFMPRVIGVVTSPTGAVIRDI
FT                   LHRISDRFPVHVVVWPVKVQGEGSGEEVANAIRGFNALKPGGDIARPDVLIVARGGGSL
FT                   EDLWSFNDEIVVRAAAESEIPLISAVGHETDTTLIDYAADVRAPTPTGAAEMAVPVRAE
FT                   LEAQLSGLAARLSGSVSRQMDNRRQGVRALVRALPSLDQLLALPRRRFDEAASGLGRGL
FT                   ELTTLNKRRAFERSASGLRPETLLNGLKHHRQRITERMHRAETLVERRLLQGKGRVDSF
FT                   DSALRSLPARLLGQLERQKERVVTAARRADTAVLHRMAQNRSGLAAHDRILQSLSYKNV
FT                   LNRGYAVIRDEENRPLTRAAAIASGAAVSMEFADGRVSAITTGEGTPAPETAAAPKKKP
FT                   AKPASSDPGNQGNLF"
FT   gene            complement(266640..267842)
FT                   /locus_tag="Atu0270"
FT                   /old_locus_tag="AGR_C_463"
FT   CDS_pept        complement(266640..267842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0270"
FT                   /old_locus_tag="AGR_C_463"
FT                   /product="mandelate racemase / muconate lactonizing enzyme
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86086"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:4DX3"
FT                   /db_xref="PDB:4DXK"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1T6"
FT                   /protein_id="AAK86086.2"
FT                   /translation="MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYV
FT                   HEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIA
FT                   QLLGGFSRREIRTYNTCAGTEYIKKATGQQTANYGLSGGKDYDDLNGFLHRADELAHSL
FT                   LEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQ
FT                   LLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLE
FT                   TGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHDCTGPVVLCASTHLSLNAPNAL
FT                   VQESVRAFYKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAAS
FT                   I"
FT   gene            complement(267893..268600)
FT                   /locus_tag="Atu0271"
FT                   /old_locus_tag="AGR_C_464"
FT   CDS_pept        complement(267893..268600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0271"
FT                   /old_locus_tag="AGR_C_464"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86087"
FT                   /db_xref="GOA:A9CKH0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKH0"
FT                   /protein_id="AAK86087.1"
FT                   /translation="MLNAISHDSGLVSSTIGAITRHIRENELAPGAKLPSELSLSQQLG
FT                   VSRTVVREAFRSLSAMRLIDVNAGKRATVATLDHGAMSLMFEHGIHTEQINIQQIYDVR
FT                   RTIEVRTVTLAALRRTDAEALTILDHANNMERDFSDNDRVMEHDLAFHLAVARASKNPV
FT                   FELILGAFQNVTRQTWPIGWKSRTSDAQRLAACELHIAIGQAIAAGDPQTASTLMARHF
FT                   DESVHALLAAGIA"
FT   gene            complement(268711..269196)
FT                   /gene="pecS"
FT                   /locus_tag="Atu0272"
FT                   /old_locus_tag="AGR_C_466"
FT   CDS_pept        complement(268711..269196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pecS"
FT                   /locus_tag="Atu0272"
FT                   /old_locus_tag="AGR_C_466"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86088"
FT                   /db_xref="GOA:Q7D1T4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1T4"
FT                   /protein_id="AAK86088.2"
FT                   /translation="MDHVDHILAQWRKERPDLDVGPMGLLGRLHRLSTYLGREVEAVLL
FT                   KHGLSSSAFDVLATLRRAGSPYQLSPGDLLAMTMVSSGTMTNRIDQLEKAGLVERIHNP
FT                   QDRRSVLISLTERGFAIVEEAVGAHVDNQHRLVAHLSEEERDTLDGLLKRFLQDFEE"
FT   gene            269293..270156
FT                   /gene="pecM"
FT                   /locus_tag="Atu0273"
FT                   /old_locus_tag="AGR_C_468"
FT   CDS_pept        269293..270156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pecM"
FT                   /locus_tag="Atu0273"
FT                   /old_locus_tag="AGR_C_468"
FT                   /product="regulator protein pecM"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86089"
FT                   /db_xref="GOA:A9CKG9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG9"
FT                   /protein_id="AAK86089.1"
FT                   /translation="MKKNMTYAADVLVTALAPAIWGTTYFVTTEFLPQGYPLHVAMLRA
FT                   LPAGILLLLLVRKLPQGIWWPRSFILGALNFSFFWAMLFVSAYRLPGGVAATVGAVQPL
FT                   IVIGLSRLFLSTPVRPLAIGAGFLGIAGVALLVLTPGAALDGIGVAAGLAGAVSMAFGT
FT                   VLTRKWRPPVSNLTFTAWQLTAGGILLLPVAYALEPALPAPTAVNVMGMAYLGLIGAAL
FT                   TYLLWFRGLARIEPSAAASLGFLSPVVATLLGWLALGQSLAPAQIAGFIAVLFSIWLSQ
FT                   RSQLPR"
FT   gene            complement(270165..271403)
FT                   /gene="ampS"
FT                   /locus_tag="Atu0274"
FT                   /old_locus_tag="AGR_C_470"
FT   CDS_pept        complement(270165..271403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="Atu0274"
FT                   /old_locus_tag="AGR_C_470"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86090"
FT                   /db_xref="GOA:A9CKG8"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG8"
FT                   /protein_id="AAK86090.1"
FT                   /translation="MTVSPIDPVKLEKLAEVAIKVGLQLQKDQDLVITAPLAALPLVRL
FT                   LTKHAYIAGGGLVTTFYSDEETTLSRYRHASDANFDRASGWLYEGMAKAYANGAARLAI
FT                   AGDNPMLLAEEDPAKVARANKANSTAYKPALEKISNFDINWNIISYPNPSWAKQVFPGL
FT                   TEDEAVRKLADAIFAASRVDVADPVAAWAQHNANLAKRSAWLNGERFSALHFTGPGTDV
FT                   KIGLADGHEWHGGASMAKNGVTCNPNIPTEEVFTTPHALRVDGYVSSTKPLSHQGTLID
FT                   DIQVKFEAGRIVEAKASKGEAVLNKVLDTDEGARRLGEVALVPHSSPISASGILFYNTL
FT                   FDENASCHIALGQCYSKCFLDGASLSQDQIKAQGGNSSLIHIDWMIGSNKVDIDGVKPD
FT                   GSTVPVMRKGEWA"
FT   gene            complement(271492..271968)
FT                   /locus_tag="Atu0275"
FT                   /old_locus_tag="AGR_C_472"
FT   CDS_pept        complement(271492..271968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0275"
FT                   /old_locus_tag="AGR_C_472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86091"
FT                   /db_xref="GOA:A9CKG7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG7"
FT                   /protein_id="AAK86091.1"
FT                   /translation="MSKTTRATQMLTKAGIAFATVTYDYDPNADRIGLQAAEAIGEAPH
FT                   LVLKTLMAELDGKPVCVVVPSDREVSMKKLAAAFGGKSANMMKPADAERATGYHVGGIS
FT                   PFGQKKQVPTAIEADAMVHDYVYMNGGQRGLQVRLSPRDAQKVLDAIVAPLVAE"
FT   gene            complement(271981..272328)
FT                   /locus_tag="Atu0276"
FT                   /old_locus_tag="AGR_C_473"
FT   CDS_pept        complement(271981..272328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0276"
FT                   /old_locus_tag="AGR_C_473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86092"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG6"
FT                   /protein_id="AAK86092.1"
FT                   /translation="MTVTIYGIKNCDTMKKARSWLELNGIDYSFHDYKAAGIDRAHLET
FT                   WCDAAGWETVLNRAGTTFKKLDDSQKADLTREKAIGLMLDQPSMIKRPVLEAKGKITVG
FT                   FKPEIYQTVFA"
FT   gene            272422..272817
FT                   /locus_tag="Atu0277"
FT   CDS_pept        272422..272817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIL6"
FT                   /protein_id="AAL41299.2"
FT                   /translation="MMPEPCKIEVADIRTSASKAAWLPCYIMSCRTRWKSPLFRHQRWR
FT                   EKCVRLQRHRVTSSVKLSPFSVQRSRFRPLFAHIASPLAPISKLSVSTARLSTRSSSKL
FT                   VIVCSEATSPRLRLAPESTSVFRRRLG"
FT   gene            complement(272904..273791)
FT                   /locus_tag="Atu0278"
FT                   /old_locus_tag="AGR_C_477"
FT   CDS_pept        complement(272904..273791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0278"
FT                   /old_locus_tag="AGR_C_477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86093"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG5"
FT                   /protein_id="AAK86093.1"
FT                   /translation="MRDTYQLVGRLSMVPCHKAIDLSGMRRGHRNSFSFCSFNFSLAMI
FT                   MSRAWNRPWSIVMGLELTDKEGLRQLFLEGFELEKQRRINPRFSSKVLIVVKPPAALAE
FT                   RIFTDASSHAAGRTKREAYPAELLHITLLCVGCFDTVPRGLANRLKEALGEIRARPVPI
FT                   TFDGSSLFGNRNCLVLNSRREMLELRALAKVVQRALWRANLPYIAASSFMPHLTMIYGC
FT                   GKIETMPVEKPYSWLAGSFEVIFSHNGETRHESLGRFALSAKADRYEQPESQLYLPQKV
FT                   FGPSKRPTHKIAAR"
FT   gene            273790..274368
FT                   /locus_tag="Atu0279"
FT                   /old_locus_tag="AGR_C_478"
FT   CDS_pept        273790..274368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0279"
FT                   /old_locus_tag="AGR_C_478"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86094"
FT                   /db_xref="GOA:A9CKG4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2G7S"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG4"
FT                   /protein_id="AAK86094.1"
FT                   /translation="MKNPQSKADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIHH
FT                   HFPSKSDLVCKLVSQYRQEAEAGIAELEKNISDPLEQLRAYIGYWEGCIADATHPFCVC
FT                   ALLASEIPVLPETVVLEVRAHFRSLSDWLTAVLERGIAQGRLVLTGTARANAEIFMATV
FT                   HGAMLSARAHGDAATFGAITRPMLERITA"
FT   gene            274510..274998
FT                   /locus_tag="Atu0280"
FT                   /old_locus_tag="AGR_C_479"
FT   CDS_pept        274510..274998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0280"
FT                   /old_locus_tag="AGR_C_479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86095"
FT                   /db_xref="GOA:A9CKG3"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG3"
FT                   /protein_id="AAK86095.1"
FT                   /translation="MFGISPLGWVHTLGSLPAIPVAIYMFARHGRIVPRSTPGAIYFVS
FT                   MLIGAATAFLVAHQPVSYAIGALTILFLLAGYGIERILGSTRVARYVETICLSVSAFLL
FT                   MVPTATETLRRVPDGHPFVTDLKSPLLLGVQAGLLAILVVGLAAQIIYLARQNRNAAN"
FT   gene            complement(275073..276650)
FT                   /gene="guaA"
FT                   /locus_tag="Atu0281"
FT                   /old_locus_tag="AGR_C_480"
FT   CDS_pept        complement(275073..276650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="Atu0281"
FT                   /old_locus_tag="AGR_C_480"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86096"
FT                   /db_xref="GOA:Q8UIL2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIL2"
FT                   /protein_id="AAK86096.1"
FT                   /translation="MTQIAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEA
FT                   FEKLQPKGVIFSGGPASVTAEGSPRAPQAVFDSKVPILGICYGQQTLCTQLGGVVEGGH
FT                   AAEFGRADIDIKKASPLFEGFWEQGKSYPVWMSHGDRVTKLPEGFEVIATSENAPFAIA
FT                   ADEKRHYYTTMFHPEVVHTPDGGKLLSNFVHKIVGLKSDWTMAAYRAEMIRKIREQVGT
FT                   GRVLCALSGGVDSSVAAILIHEAIGDQLTCVYVDHGLMRLGESEQVVGMFRDHYNIPLV
FT                   HVDAADLFLGELSGVSDPEVKRKTIGRLFIEVFEAEAAKIAADGKGAPKFLAQGTLYPD
FT                   VIESVSFSGGPSVTIKSHHNVGGLPERMNMQLVEPLRELFKDEVRALGRELGLPESFIG
FT                   RHPFPGPGLAIRCPGAITREKLDILRKADAIYLDEIRKAGLYDTIWQAFAVLLPVQTVG
FT                   VMGDYRTYDFVCALRAVTSVDGMTADFYPYDMNFLGRAATRIINEVRGINRVVYDVTSK
FT                   PPGTIEWE"
FT   gene            complement(276734..277372)
FT                   /gene="pfs"
FT                   /locus_tag="Atu0282"
FT                   /old_locus_tag="AGR_C_482"
FT   CDS_pept        complement(276734..277372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="Atu0282"
FT                   /old_locus_tag="AGR_C_482"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86097"
FT                   /db_xref="GOA:A9CKG2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG2"
FT                   /protein_id="AAK86097.1"
FT                   /translation="MSYRLSHVADKSVLFVMAASAEYGPHLQARIAPLMTGVGPVEAAI
FT                   SVTAILAGLDAADNLPDLVVSLGSAGSRTLQQTGIYQAVSVSYRDMDASAFGFEKGRTP
FT                   FLDLPAEVALPLRIPDIAEARLSTGGNVVSGEAYGLIDADMVEMETFAVLRACQRFGVP
FT                   LISLRGISDGKADVNHVDDWTAYLDIIDEKLANAVDRLCRAIEDGVIAL"
FT   gene            complement(277369..277818)
FT                   /locus_tag="Atu0283"
FT                   /old_locus_tag="AGR_C_483"
FT   CDS_pept        complement(277369..277818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0283"
FT                   /old_locus_tag="AGR_C_483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86098"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG1"
FT                   /protein_id="AAK86098.1"
FT                   /translation="MEITDPGDFRQRIETSFARQGVVQAINAEISRIEHRLVEIELPFH
FT                   EKLTQQHGILHAGVIAAGLDTACTYAAYTIIEPEASLLTIEFKVNLMSPGRGERFLFRG
FT                   EIIKPGNNLIVADGRAYALSDGPAKLIASMTGTMMVVKGREDITG"
FT   gene            complement(277897..278349)
FT                   /gene="tspO"
FT                   /locus_tag="Atu0284"
FT                   /old_locus_tag="AGR_C_485"
FT   CDS_pept        complement(277897..278349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="Atu0284"
FT                   /old_locus_tag="AGR_C_485"
FT                   /product="tryptophan-rich sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86099"
FT                   /db_xref="GOA:A9CKG0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKG0"
FT                   /protein_id="AAK86099.1"
FT                   /translation="MKNLAVYIIFVVVVVAIGALIGVNNVPGEWYQSLQKPFFNPPNWI
FT                   FGPVWTALYVLIGIAGARTWIRKPMGTRMRLWFTQMVLNFLWSPIFFGMQSPAGALVII
FT                   IPMLICIIAFMALTYRRDRISMWLFAPYALWVAFATVLNASIGMLN"
FT   gene            complement(278400..279494)
FT                   /locus_tag="Atu0285"
FT                   /old_locus_tag="AGR_C_487"
FT   CDS_pept        complement(278400..279494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0285"
FT                   /old_locus_tag="AGR_C_487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86100"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF9"
FT                   /protein_id="AAK86100.1"
FT                   /translation="MISGSKRMLIDRRSFIKAAGIPFLAALAPRSLHALERTDAVFASA
FT                   FRARDGSYGIATVSERGEIIDRVALPARAHGMATSHATGRTVAFARRPGTFFMAFDPVQ
FT                   RQEPVVMHAPENRHFYGHGQFSPDGAILYASENDFDGNRGVIGLYDARNGFARIGEYDA
FT                   HGVGTHDMTVSDDGRLIVIANGGIETHPDFGRTKLNIDSMEPSLVLLDAATGQLIQKHV
FT                   MPEQLRQLSTRHVDLGDNGRIWFACQYEGPRNNLPPLVGHFSKGEDVAFVDLPEETTVR
FT                   LANYVGAIAVNRREGLVGLTSPSGNAAVTLDAKTGSVVSEVTVREAAGVATAAGGIAVS
FT                   SYDGFFEAIRSDVAWDQHIVRLSG"
FT   gene            complement(279498..280619)
FT                   /locus_tag="Atu0286"
FT                   /old_locus_tag="AGR_C_489"
FT   CDS_pept        complement(279498..280619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0286"
FT                   /old_locus_tag="AGR_C_489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86101"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF8"
FT                   /protein_id="AAK86101.1"
FT                   /translation="MNFAMRKISGVISVLLLLTTPPARAQDVELLPPPPLDPAQVRGVM
FT                   EKAVNGFIRPGYDHFRQSAETLEGSMKAFCAAPSKTTEAAAQAAFIETVLNWSTIEIVR
FT                   VGPVIEKNRFERVLYYPDKKGLGLKQVQRYLSDKDESVTTADGLKGKSVAAQGLGALEF
FT                   VLYGTGAEELLDKKGDFRCRFGAAIAGNIANVATELSNSWNAPDGAQKNWTQPGPDNPV
FT                   FRDEREALVALLGILVHGAEAIRDQRIETFYKGPDKAKFPRTAIYWRSGLTWKSISTNI
FT                   KAVQTLLHTADMVELVPPDQRSIVNSIDFIAKSMIRVAATIDTDVEKALDKDDQRAKVD
FT                   YLLLNGKDLIYRLNDQYGGAIGLSSGFSFADGD"
FT   gene            complement(280619..282160)
FT                   /locus_tag="Atu0287"
FT                   /old_locus_tag="AGR_C_491"
FT   CDS_pept        complement(280619..282160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0287"
FT                   /old_locus_tag="AGR_C_491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86102"
FT                   /db_xref="GOA:A9CKF7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF7"
FT                   /protein_id="AAK86102.1"
FT                   /translation="MCLPTPMELSLSPIRKPFFFAGAACLVASVTLAAPLRDDLTEKDR
FT                   SRVLAVTAPTTDFTKPNPFEAMSGGATTSTGTAGGNAFSQPSATMPFERKQDFKLGNAL
FT                   FQKLWVSSPSSTQASDGLGPFYNARSCQTCHVKDGRGRPPLAGEDAVSLFLRLARPARD
FT                   ETERAAIARHEVLNFPDETYGRQLQNLAIPGLAAEGRPVITYTERPVRLSDGEVVSLRK
FT                   PTYAATALRYGPLGTDTTVSARIAMPTLGLGLIEAIADADILAGADPDDKNGDGIAGRP
FT                   AWVKDHRTGEIKLGRFGWKAQNASVRDQSASAFSHDIGISTPDAPNAYGDCTDAQKDCL
FT                   AMPTGVQPRLGPVEAPDPVLDLVTFYTENLAVPQRRNAGDRTVLEGKQLFYTSGCTACH
FT                   TPKFVTRRDAGDPMHSFQLIWPYSDFLLHDMGEELADGQQVGEASGRHWRTQPLWGIGL
FT                   TQRVNGNGFYLHDGRARSLTEAILWHGGEGQKARNAFAALQKSDRQALLAFLESL"
FT   gene            complement(282202..283479)
FT                   /locus_tag="Atu0288"
FT                   /old_locus_tag="AGR_C_493"
FT   CDS_pept        complement(282202..283479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0288"
FT                   /old_locus_tag="AGR_C_493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86103"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1S0"
FT                   /protein_id="AAK86103.2"
FT                   /translation="MIRKTILSASFVLLAASAAFTALPAQAATDAAAVIKHYADVAHAK
FT                   YEDSLTTAKALDKAIDALIATPSEETLKAAREAWIKARVPYQQSEVYRFGNPLVDAWEG
FT                   KVNAWPLDEGLIDYVDASYGTESDENELYVANIIANPKIKISGEEVDASKITPELIESL
FT                   HEAGDVEANVTTGYHAIEFLLWGQDLNGTGPGAGNRPYTDYDKAKCTNGNCDRRADYLK
FT                   SASSLLVKDLQEMVDAWAPEGEATKTVEADPKAGLTAILTGMGSLSYGELAGERMKLGL
FT                   LLHDPEEEHDCFSDNTYNSHLNDAIGIASAYTGDYTRVDGTKMTGASLAELVGAKDKAL
FT                   NDEMTAKLNKTLNAMHAMEKRAQTVEAYDQMIGEGNKEGNAVVQAAIDGLIDQTKTVER
FT                   VIAALDLGKIELEGSASLDNPNAVFK"
FT   gene            complement(283635..284924)
FT                   /gene="sun"
FT                   /locus_tag="Atu0289"
FT                   /old_locus_tag="AGR_C_495"
FT   CDS_pept        complement(283635..284924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="Atu0289"
FT                   /old_locus_tag="AGR_C_495"
FT                   /product="Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86104"
FT                   /db_xref="GOA:A9CKF6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF6"
FT                   /protein_id="AAK86104.1"
FT                   /translation="MRLGGRLAGAIEVLADIEGRRRPVADALKDWGLAHRFAGSGDRAA
FT                   IGNIVYDALRMKLSHAWLMDDDSAASLAYAVLLRQWGKSFAELTAEFDGDKFAPAAPDA
FT                   ERQQAFLSRSLSDAPAYIQGDVPEWVQSSLETAFGERWLAEAQALNERPTLDLRANTLK
FT                   ATRDKVLKALEESGAEATRIARQGLRIPAGEGPSRLPNVTAELSFQKGWFEVQDEGSQI
FT                   VADLAGAREGEQVLDYCAGGGGKTLAMAASMNNKGQVHAFDADRKRLAPIIERLKRAGT
FT                   RNVQVHDRAAGLAPFQEKFDRVLVDAPCTGTGTWRRRPDTKWRLTARNLEERVQQQGEA
FT                   LSQAKGFVRPGGELLYVTCSVLPEENEQQVRRFCEENPEFAIGSALERWQSIFSGNANK
FT                   PHSSDGKTVTLTPATTDTDGFFFCLMKRKA"
FT   gene            complement(284986..285354)
FT                   /locus_tag="Atu0290"
FT                   /old_locus_tag="AGR_C_498"
FT   CDS_pept        complement(284986..285354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0290"
FT                   /old_locus_tag="AGR_C_498"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86105"
FT                   /db_xref="GOA:A9CKF5"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF5"
FT                   /protein_id="AAK86105.1"
FT                   /translation="MLNIRRITFTAATIAACSIIAPLQANAANGCGGASWYALSSKTAS
FT                   GERMNAANLTAAHRSLRFGTKVKVTNARNGKAVVVRINDRGPFIKGRVLDLSKAAAKNI
FT                   GMISSGTAKVCYEIVKAD"
FT   gene            complement(285781..286653)
FT                   /locus_tag="Atu0291"
FT                   /old_locus_tag="AGR_C_499"
FT   CDS_pept        complement(285781..286653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0291"
FT                   /old_locus_tag="AGR_C_499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86106"
FT                   /db_xref="GOA:A9CKF4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF4"
FT                   /protein_id="AAK86106.1"
FT                   /translation="MHVMIFGAGYSGKAIANALKTKAASVCGTTRSADKFANLAAAGMT
FT                   PLLFDGVHLDDDLIAAMRNVTHLVQSIAPGKDGDPLFALLGGDLKKLLPNLKWLAYLST
FT                   VGVYGDHHGAWVNETTPCRPVSARSVERVAAEAAWTEAAQSADVPLSILRLSGIYGPGR
FT                   NTFMNFEKGTARRLVKKDQVFNRIRVEDIGAAIAFLALKNERGIFNVTDDEPCPPQDVV
FT                   SFAADLMGVVPPAEQDFGTADLTPMARSFYGENKRVSNAKIRELGFDFRFPEYRQSLKQ
FT                   LWESSLWRG"
FT   gene            complement(286657..287637)
FT                   /locus_tag="Atu0292"
FT                   /old_locus_tag="AGR_C_502"
FT   CDS_pept        complement(286657..287637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0292"
FT                   /old_locus_tag="AGR_C_502"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86107"
FT                   /db_xref="GOA:A9CKF3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF3"
FT                   /protein_id="AAK86107.1"
FT                   /translation="MAWMEETEARRAEPKTLWGDVRSIVMFGLNYGPDEDPRGLLSKPD
FT                   KAAISVYARNRDYHDIIKGRLKEIATRFAARAGEDVKVFVDTAPVMEKPLAAAAGLGWQ
FT                   GKHTNLVSRSHGSWLFLGSMFTTAELCVDEAERDHCGSCRACLDACPTAAFPAPYQLDA
FT                   RRCISYLTIEHKGPIPHEFRPMIGNRIYGCDDCLAACPWNKFAASASEMKLKAREDLKE
FT                   PSIAFLLTLDDAAFRSFFSGSPVKRIGRNRFIRNVLIAAGNSADRHFVEQCKALAEADP
FT                   SAEVRGMAAWALSRLMDRDEFRTYSAGRAPETDPEAEMEWQLAEA"
FT   gene            complement(287938..288630)
FT                   /locus_tag="Atu0293"
FT                   /old_locus_tag="AGR_C_503"
FT   CDS_pept        complement(287938..288630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0293"
FT                   /old_locus_tag="AGR_C_503"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86108"
FT                   /db_xref="GOA:A9CKF2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF2"
FT                   /protein_id="AAK86108.1"
FT                   /translation="MPTLYHSPMSTASRFVRLILAEYGFQTDLVEEQPWERRREFLALN
FT                   PAGTLPVYLDDNMRSLSGPYVLAEFLDETHGVLKRDRRLLAEDPFQRAEIRRLTEWFLQ
FT                   KMENDVTRPLVRERVYKLQMTAAQGGGPPDSKLLRTARNNIRQHIKYLEWLAGSRTWLA
FT                   GDRLSYADLAAAAGVSVLDYLGEINWLEAPIAKEWYQRVKSRPSFRPFLSERIPRLAPS
FT                   SHYADLDF"
FT   gene            288790..289596
FT                   /gene="bacA"
FT                   /locus_tag="Atu0294"
FT                   /old_locus_tag="AGR_C_505"
FT   CDS_pept        288790..289596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="Atu0294"
FT                   /old_locus_tag="AGR_C_505"
FT                   /product="undecaprenyl pyrophosphate phosphatase, possible
FT                   bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86109"
FT                   /db_xref="GOA:P58740"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58740"
FT                   /protein_id="AAK86109.1"
FT                   /translation="MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNT
FT                   FAVLIQLGAILAILLVYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHDFI
FT                   KTVLFETPMLICVVLIIGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAMIPG
FT                   TSRSGATIVGALLMGTDKRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSALIAVG
FT                   FVAAFVSGLFVVRSLLDFVSRRGFAPFAWWRIVIGALGLVALLVIG"
FT   gene            289836..290066
FT                   /locus_tag="Atu0295"
FT   CDS_pept        289836..290066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIJ9"
FT                   /protein_id="AAL41317.1"
FT                   /translation="MIAFQTFVRADRAAVCELRVRDMFGMWRISIKELAEYRVNAKSFP
FT                   QLRLCHACPFQRSTVNHAVSVLIFPPHPIWQ"
FT   gene            complement(290155..291135)
FT                   /locus_tag="Atu0296"
FT                   /old_locus_tag="AGR_C_511"
FT   CDS_pept        complement(290155..291135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0296"
FT                   /old_locus_tag="AGR_C_511"
FT                   /product="NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86111"
FT                   /db_xref="GOA:Q7D1R4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1R4"
FT                   /protein_id="AAK86111.2"
FT                   /translation="MTLANLPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAG
FT                   FLQPLGNVGQISFAQANLRYRDSIIKAVEDADHVVNCVGILAESGRNTFDAVQEFGAKA
FT                   IAEAARDTGATLTHISAIGADANSQTGYGRTKGRAEAAIHSVLPGAVILRPSIIFGPED
FT                   DFFNKFAKMARNLPFLPLIGGGKTKFQPVYVEDVAEAVARSVDGKLKPGAIYELGGPDV
FT                   MTFRDCLEAVLAATYRERSFVNLPFGVASMIGKLASLVPLITPPLTPDQVTMLKKDNVV
FT                   SAEAEKKGLTLEGIGITPVRVASVLPSYMVQYRQHGQFSNAGKAA"
FT   gene            complement(291257..291544)
FT                   /locus_tag="Atu0297"
FT                   /old_locus_tag="AGR_C_513"
FT   CDS_pept        complement(291257..291544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0297"
FT                   /old_locus_tag="AGR_C_513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86112"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="PDB:2FIU"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF1"
FT                   /protein_id="AAK86112.1"
FT                   /translation="MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVTE
FT                   LEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGI"
FT   gene            complement(291565..292272)
FT                   /gene="pyrF"
FT                   /locus_tag="Atu0298"
FT                   /old_locus_tag="AGR_C_515"
FT   CDS_pept        complement(291565..292272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="Atu0298"
FT                   /old_locus_tag="AGR_C_515"
FT                   /product="orotidine 5"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86113"
FT                   /db_xref="GOA:P58638"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58638"
FT                   /protein_id="AAK86113.2"
FT                   /translation="MTAREKLIVGLDVPTVQQAEDIVSKIGDEVLFYKIGYQLVFAGGL
FT                   EFARDLVQSGKKVFLDMKLLDIDNTVASGVENIARMGMSMLTLHAYPKAMRAAVKAAEG
FT                   SGLCLLGVTVLTSMDDSDLVEAGYASDARSLVLRRAEQAREAGMGGIVCSAEESTAVRE
FT                   ILGPDLAVVTPGIRPAGADLGDQKRVMTPYDAIKAGSSHLVVARPIVRAEDPKAAARAI
FT                   LDDMLRASFPANQ"
FT   gene            complement(292277..292873)
FT                   /locus_tag="Atu0299"
FT                   /old_locus_tag="AGR_C_517"
FT   CDS_pept        complement(292277..292873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0299"
FT                   /old_locus_tag="AGR_C_517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86114"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PDB:2QNI"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKF0"
FT                   /protein_id="AAK86114.1"
FT                   /translation="MHALYITHPQVKIDPAVPVPEWGLSERGAERAREASRLPWAKALR
FT                   RIVSSAETKAIETAHMLAETSGAAIEIIEAMHENDRSATGFLPPPEFEKAADWFFAHPE
FT                   ESFQGWERAIDAQARIVEAVKAVLDRHDARQPIAFVGHGGVGTLLKCHIEGRGISRSKD
FT                   QPAGGGNLFRFSIAEFSLAAASPTCDWTAMETWQG"
FT   gene            complement(292970..293563)
FT                   /locus_tag="Atu0300"
FT                   /old_locus_tag="AGR_C_518"
FT   CDS_pept        complement(292970..293563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0300"
FT                   /old_locus_tag="AGR_C_518"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86115"
FT                   /db_xref="GOA:A9CKE9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE9"
FT                   /protein_id="AAK86115.1"
FT                   /translation="MALNLKQRLEQKFEEEIRFFKGMVSQPKKVGAIVPTSSITAKKMA
FT                   SVINPHSGLPVLELGPGTGVITKAILARGIKPESLTAIEYSTDFYNQLLRSYPGVNFVN
FT                   GDAFDLDATLGEHKGQMFDSVISAVPMLNFPMAARIKLLDELLKRVPHGRPVVQISYGP
FT                   ISPIVAQPHLYHIRHFDFIVRNIPPAQLWTYTRA"
FT   gene            complement(293757..294875)
FT                   /gene="dnaN"
FT                   /locus_tag="Atu0301"
FT                   /old_locus_tag="AGR_C_520"
FT   CDS_pept        complement(293757..294875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Atu0301"
FT                   /old_locus_tag="AGR_C_520"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86116"
FT                   /db_xref="GOA:Q7D1R0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1R0"
FT                   /protein_id="AAK86116.2"
FT                   /translation="MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDMK
FT                   ATDLDLEITEATPAMVEQAGATTVPAHLLYEIVRKLPDGSEVLLATNPDGSSMTVASGR
FT                   SKFSLQCLPEADFPDLTAGTFSHTFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHT
FT                   IESNGELKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPELEVTV
FT                   EVSDAKIRLAIGSVVLTSKLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDRVSTISS
FT                   ERGRAVKLALTDGQLTLTVNNPDSGSATEEVAVGYDNDSMEIGFNAKYLLDITSQLSGE
FT                   DAIFLLADAGSPTLVRDTAGDDALYVLMPMRV"
FT   gene            295140..296081
FT                   /locus_tag="Atu0302"
FT                   /old_locus_tag="AGR_C_523"
FT   CDS_pept        295140..296081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0302"
FT                   /old_locus_tag="AGR_C_523"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86117"
FT                   /db_xref="GOA:Q7D1Q9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Q9"
FT                   /protein_id="AAK86117.2"
FT                   /translation="MIGSRVTQEISSSDARQAAKEFRIGTATIPARPLEPALYLVATPI
FT                   GNLGDITIRALETLASADVLACEDTRVTRILLERYGIRTRPLAYHEHNANEAGPKLIAA
FT                   LEAGKSVALVSDAGTPLVSDPGYRLGQLALEAGHRVVPVPGASAPLAALVGSGMPSDAF
FT                   LFAGFLPVKDRGKRDRFAGLAKIPATLIFFESPRRIGASLKVASEVLGRDRRAVVCREL
FT                   TKTFEEFRRGTLGELADYYDGDRVVKGEIVLLVEPPSYDEIPDIEDVEKLLKDLVATMS
FT                   AAKAAGEAAKLTGLPRKELYQRLLDMKDTDGR"
FT   gene            296071..296439
FT                   /locus_tag="Atu0303"
FT                   /old_locus_tag="AGR_C_525"
FT   CDS_pept        296071..296439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0303"
FT                   /old_locus_tag="AGR_C_525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86118"
FT                   /db_xref="GOA:Q8UIJ2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIJ2"
FT                   /protein_id="AAK86118.1"
FT                   /translation="MAVDGQSNKRRKAERRGHAAEYWAALYLLLKGYRILAIRYRTRLG
FT                   EIDLIARKKDLIAIIEVKARASGGSAVDAVGFHSQQRIRAAADLWLSRRRDAGRFSLRF
FT                   DIVAVLPRRLPQHFIDAF"
FT   gene            296456..297016
FT                   /gene="nodL"
FT                   /locus_tag="Atu0304"
FT                   /old_locus_tag="AGR_C_527"
FT   CDS_pept        296456..297016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodL"
FT                   /locus_tag="Atu0304"
FT                   /old_locus_tag="AGR_C_527"
FT                   /product="nodulation protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86119"
FT                   /db_xref="GOA:A9CKE8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE8"
FT                   /protein_id="AAK86119.1"
FT                   /translation="MSTEREKMAAGEWYSCMGAELDMLRWHSRRAVHQHNTMPPDERGT
FT                   IGPLLRALFASVGEGAFIEAPFHCAYGFNITLGRNAYLNAGCTILDSAKVAIGDGAMLG
FT                   PAVQIYCAEHHLDPVPRAQGIEIAKPVTIGRDVWIGGGAIILAGITIGDGAIVGAGSVV
FT                   TRNVPARATVVGNPARPINRIAG"
FT   gene            297125..298423
FT                   /gene="ugpA"
FT                   /locus_tag="Atu0305"
FT                   /old_locus_tag="AGR_C_529"
FT   CDS_pept        297125..298423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="Atu0305"
FT                   /old_locus_tag="AGR_C_529"
FT                   /product="ABC transporter, substrate binding protein
FT                   (sn-glycerol 3-phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86120"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE7"
FT                   /protein_id="AAK86120.1"
FT                   /translation="MLKKISMAAVAVSISATSSMAATNITWWHGMGGRNGEVINEVSQK
FT                   FNEAQKECALTPVSKGSYEEALASGIAAFRSGEQPNILQVFDAGAATIINAKGAVIPAE
FT                   DLINKAGYKFDRDAFINGVRYFYAAADGKFVGMPFNSSAPIMYINDEALKKAGVEAPKT
FT                   WEEFEKVAPKLKEAGYIPLVQSQLTWQFTENFFSRNNIQFATNNNGYDSVTDTKLKVTD
FT                   PNLVMMFEKLKDWKDKGLFAYYGAGWNDNQKPFEEGKVALWIGSSGSFGGLQKTATMPF
FT                   SATFLPYWGSIKGAGTNSFIGGAALFAMSGKSEAENKCVADFFQFLTSPEIQVFYHKAT
FT                   GYVAITKAAYEKAKTEGYYKEKPVAEVGIQQLSLPGGEWSKGYRLGFYPQIRAVMEREY
FT                   NRIFSGEVTPKAAFEIIEKEGNDLLARFAKTAG"
FT   gene            298594..299475
FT                   /gene="ugpA"
FT                   /locus_tag="Atu0306"
FT                   /old_locus_tag="AGR_C_531"
FT   CDS_pept        298594..299475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="Atu0306"
FT                   /old_locus_tag="AGR_C_531"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (sn-Glycerol-3-phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86122"
FT                   /db_xref="GOA:A9CKE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE6"
FT                   /protein_id="AAK86122.1"
FT                   /translation="MKRVQFSSSYVPYLFLAPQLAVIFIFFYWPSVQAVQSSFYIEDPF
FT                   GFAASFVGFANYSDAIFNPEYLSIAKFTVVFTVLVTFFSLALGLLLAVKADAVIRGSST
FT                   YKTLLISVYAIAPPVAGLIGMMLFDQHIGPFVKLAAVFGWDMKVGLNYFDTATAMIVVA
FT                   VWKQIPYNFIFFLSGLQGVSVSVREAAAIDCRSGFRRFWTVIMPLLAPTAFFLLIINIT
FT                   YALFDTFGVIDVMVKDKAADNPITLVYKVFLDGFRGNDIGGSSAQSVILMLVVFVLTVI
FT                   QFRFIEKRVHYN"
FT   gene            299487..300329
FT                   /gene="ugpE"
FT                   /locus_tag="Atu0307"
FT                   /old_locus_tag="AGR_C_532"
FT   CDS_pept        299487..300329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="Atu0307"
FT                   /old_locus_tag="AGR_C_532"
FT                   /product="ABC transporter, membrane spanning protein
FT                   (sn-Glycerol-3-phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86123"
FT                   /db_xref="GOA:Q7D1Q5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Q5"
FT                   /protein_id="AAK86123.2"
FT                   /translation="MYKTRPLDHLVLILGALFLILPVVVAFMTSTHTAAEIHRSGLTIV
FT                   PGDNFVETYEKVLTQKGGFTGQVTGLNMVINSLVLGIGFAVGKIVLSMTAAYAIVYFRF
FT                   RFATLAFWIIFTTLLLPLEVRIMPSYEVMSKLGLLNSYTGLIVPLLASATGTFYFRQFF
FT                   KSVPEELLEAARIDGAGPVKFFIDILIPLSRTMMSAIFIIMFVYGWNQYLWPMLMTTDE
FT                   RFFTLMRGIKSILQVWVGSQIPDYNEAFALAVLAMLPPVLIVVIFQRWFIKGLTESDK"
FT   gene            300340..301440
FT                   /gene="ugpC"
FT                   /locus_tag="Atu0308"
FT                   /old_locus_tag="AGR_C_533"
FT   CDS_pept        300340..301440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="Atu0308"
FT                   /old_locus_tag="AGR_C_533"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (sn-Glycerol-3-phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86124"
FT                   /db_xref="GOA:Q8UII7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UII7"
FT                   /protein_id="AAK86124.1"
FT                   /translation="MAAIEISQVCKDYHGGVRAVHHVDIDIRDGEFIVLVGPSGCGKST
FT                   LLRMVAGLEDISEGTVKIGDRVVNQTDPADRDIAMVFQNYALYPHMSVRENLEYGLKNR
FT                   KTAKTEIDARVAEAARMLQLEPYLERKPRALSGGQRQRVAMGRAIVRKPAAFLFDEPLS
FT                   NLDAKLRVSMRGEIKRLQKRLGTTSIYVTHDQLEAMTLADRLVVLNGGRIEQIGAPLDV
FT                   YHTPASTFVASFIGSPAMNLLNAELHGDSLAIGPSLFALNGFAPTSGPVTVGMRAEDFR
FT                   LAAAGEQGFAFRVDYIEELGSQRLIHGMIGDQNLTIAFPPDVDVPAALSITIASEKLHF
FT                   FSSETGKRIAGKAEQLGVQSAQMATA"
FT   gene            301550..302062
FT                   /locus_tag="Atu0309"
FT                   /old_locus_tag="AGR_C_536"
FT   CDS_pept        301550..302062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0309"
FT                   /old_locus_tag="AGR_C_536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86125"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE5"
FT                   /protein_id="AAK86125.1"
FT                   /translation="MSFKMMFAAAATMAIRTVPILPAYLRRQKDEAVVSASCTDLRLQP
FT                   APINPEWIISGNPQARAADHSRSGDRASSTAMWDCTAGEFRWFFGWDETVYILEGEVHV
FT                   TAEDGSVSILRVGDVAYFRAGTWATWRVDDYVRKVAFMRRPFPTALALAYRVKNKLFAG
FT                   RSYKLAA"
FT   gene            302305..303264
FT                   /gene="gshB"
FT                   /locus_tag="Atu0310"
FT                   /old_locus_tag="AGR_C_538"
FT   CDS_pept        302305..303264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="Atu0310"
FT                   /old_locus_tag="AGR_C_538"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86126"
FT                   /db_xref="GOA:Q8UII5"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UII5"
FT                   /protein_id="AAK86126.2"
FT                   /translation="MAKIKNVAIQMDHVSGINIAGDSTFAISLEAQARGYRLFHYTPER
FT                   LSMRDGKIYATVEQMELRDIKGDHFSLSEPERVDLSTMDVIHLRQDPPFDMAYITSTHL
FT                   LERIHPKTLVVNDPAWVRNSPEKIFVTEFADLMPKTLITKDVSEIARFRNEMGDIILKP
FT                   LYGNGGAGVFHSARDDRNFSSLLEMFGQMFREPYIAQEYLPDVRKGDKRILLVDGEPVG
FT                   AINRVPAENDARSNMHAGGRPEPTELTAREQEICRRIGPALRERGFLFVGIDVIGDYMT
FT                   EINVTSPTGIREVRKFGGADVASLLWDAIEKKRDAQDF"
FT   gene            303448..304980
FT                   /locus_tag="Atu0311"
FT                   /old_locus_tag="AGR_C_541"
FT   CDS_pept        303448..304980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0311"
FT                   /old_locus_tag="AGR_C_541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86127"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Q2"
FT                   /protein_id="AAK86127.2"
FT                   /translation="MVARVNTVAFQGIEGVPVEVQVMVAPGKIGIQIVGLPDKAVAESR
FT                   ERVQAALHASGLALPAKKVTVNLAPADLPKEGSHFDLPIALGLMAALGAIPAEALSQYV
FT                   VLGELNLDGTIGTVSGALPAAIGANALGKGLICPAESGPEAAWAGAGIDILAPRSLIAL
FT                   ANHFRGTQLLSRPTPAIRANPVNLPDLADIKGQESARRAMEVAAAGGHNLLMVGPPGSG
FT                   KSMLAARLPSILPPLEVAELLEVSMVHSIAGQLSGGKLSDRRPFRTPHHSATMAALIGG
FT                   GLRARPGEASLAHHGVLFLDEFPEFSPQVLDALRQPLETGECIIARANHRVSYPAEIQL
FT                   VAAMNPCRCGMAGEPGFTCARGPRCVTDYQSRISGPLLDRIDIRIDVPAVSATDLIRPV
FT                   VSEPSAVVAARVARARLAQQERYAAAGFPAIRTNARCTTTLIEKYAEPDASGLQLLRDA
FT                   AERLKFSARGYHRILKVARTLADLDGKQTVGRIHVAEAVSYRIAGERLTVAA"
FT   gene            complement(305093..306061)
FT                   /gene="cysK"
FT                   /locus_tag="Atu0312"
FT                   /old_locus_tag="AGR_C_543"
FT   CDS_pept        complement(305093..306061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="Atu0312"
FT                   /old_locus_tag="AGR_C_543"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86128"
FT                   /db_xref="GOA:A9CKE4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE4"
FT                   /protein_id="AAK86128.1"
FT                   /translation="MPEARKPGRGRVYSSITETIGDTPIVRLDKLAKEKGVKANLLAKL
FT                   EFFNPIGSVKDRIGVAMIEALEAQGKITPGKTTLVEPTSGNTGIALAFAAAAKGYKLIL
FT                   TMPETMSVERRKMLALLGAELVLTEGPKGMKGAIAKAQELAETLPDAVIPQQFENPANP
FT                   DIHRRTTAEEIWNDTDGTVDILVSGIGTGGTITGTGQVLKSRKPEVKVIAVEPADSPVL
FT                   SGGNPGPHKIQGIGAGFAPAILDTGVYDEIVTVTNDEAFEIARLAARLEGVPVGISSGA
FT                   ALAAAIKVGAREENAGKNIVVIIPSFAERYLSTALFEGLGL"
FT   gene            complement(306202..306819)
FT                   /locus_tag="Atu0313"
FT                   /old_locus_tag="AGR_C_546"
FT   CDS_pept        complement(306202..306819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0313"
FT                   /old_locus_tag="AGR_C_546"
FT                   /product="RhtB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86129"
FT                   /db_xref="GOA:Q7D1Q0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1Q0"
FT                   /protein_id="AAK86129.2"
FT                   /translation="MTLTTLLAYATALFIAAAIPGPGMTAIVARALGSGFRETFFMGLG
FT                   LVLGDMIYLTGVILGLAFVAQTFQEAFMVLKFAGAAYLLYIAWKLWTAGLLPQDLKARK
FT                   STSIPMSFLSGLLITLGNPKTMLFYVALVPTLIDIRMIGPSEYATLLALTFVVLMAVLL
FT                   PYILLAAKARNLLKRPSALTILNRTAAGILAGTATMIAIRST"
FT   gene            complement(306897..307367)
FT                   /gene="dut"
FT                   /locus_tag="Atu0314"
FT                   /old_locus_tag="AGR_C_548"
FT   CDS_pept        complement(306897..307367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="Atu0314"
FT                   /old_locus_tag="AGR_C_548"
FT                   /product="deoxyuridine 5"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86130"
FT                   /db_xref="GOA:Q8UII1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UII1"
FT                   /protein_id="AAK86130.1"
FT                   /translation="MTVQNDNRPLLRLVRLANGADLELPSYETRGAAGMDLRAAVPADE
FT                   PLNLQPGERALVPTGFIFEVPQGYEAQIRPRSGLAIKNGITCLNSPGTVDSDYRGEVKV
FT                   ILANLGQDDFTIERGMRIAQMVIAPVTQVTVSEVTETSETARGAGGFGSTGV"
FT   gene            307457..309040
FT                   /gene="prfC"
FT                   /locus_tag="Atu0315"
FT                   /old_locus_tag="AGR_C_549"
FT   CDS_pept        307457..309040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="Atu0315"
FT                   /old_locus_tag="AGR_C_549"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86131"
FT                   /db_xref="GOA:A9CKE3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE3"
FT                   /protein_id="AAK86131.1"
FT                   /translation="MAETLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEV
FT                   KAKKDRIQTRSDWMKIERERGISVVTSVMTFEYNDRVFNILDTPGHEDFADDTYRTLTA
FT                   VDAAIMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEKLAL
FT                   DTAPITWPVGRAKSFCGAYNLAENTFRGNDTQVDGLSVNGPQAVADRLPENERKVFVEE
FT                   TELALEACRPFDRQAFLEGHMTPVFFGSALRNFGVRDLINALGDFAPPPRDQVADTRVV
FT                   HAAEDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLSRTGKLMGLTAPQFF
FT                   FASQRQLADTAFAGDVVGIPNHGTLRIGDTLTEGENLVFQGVPNFSPEILRRVRLEDAM
FT                   KAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMGEYGLPVSFEMS
FT                   RFSVCRWISSDQPAEMDKFLNVKRGDIARDLDGDPVFLAQDAFSLRYESERFPAIKMVA
FT                   IKEYHVAKAA"
FT   gene            309110..310315
FT                   /gene="dfp"
FT                   /locus_tag="Atu0316"
FT                   /old_locus_tag="AGR_C_552"
FT   CDS_pept        309110..310315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="Atu0316"
FT                   /old_locus_tag="AGR_C_552"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86132"
FT                   /db_xref="GOA:Q7D1P8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1P8"
FT                   /protein_id="AAK86132.2"
FT                   /translation="MTLSGKHILLIISGGIAAYKSLDLIRRLKERGAKVTPVMTKGAQE
FT                   FVTPLAVGALSASNVFTEIFSRQDEQDVGHIRLARDCDLVLVAPATADLMAKMANGLAD
FT                   DLASAVLLATDRKVLVAPAMNPKMWSAKPTMRNVETLKRDGVFFIGPMAGEMAETGEAG
FT                   LGRMAEPLQIVEAVLSLLDGSSKPLKGKTAIVTSGPTHEPIDPVRYIANRSSGKQGHAI
FT                   AAALAALGAEVTLVSGPVTIADPAGVTTIHVERAEEMRDAVISRLPADIAVMVAAVADW
FT                   RVTGSSEQKIKKQPGDAPPALQLTENPDILKTVGHHEKRPRVVVGFAAETQDVEKNGRA
FT                   KLERKGADYIIANDVSAETGIMGGDRNSVKIISADGVEAWPDLDKAEVAKRLAALIAEK
FT                   LA"
FT   gene            310312..310686
FT                   /locus_tag="Atu0317"
FT                   /old_locus_tag="AGR_C_555"
FT   CDS_pept        310312..310686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0317"
FT                   /old_locus_tag="AGR_C_555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86133"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE2"
FT                   /protein_id="AAK86133.1"
FT                   /translation="MTLFDRKTFDRVLGEWPGVRFVDQWDSHVAKVGDKVFAVLGERED
FT                   WRLVVKCSEESFEILTSLEGIAQAPYFAKRKWISIGDHSPLEQEELEHYVRRSYELVAA
FT                   GLTKKLRGELGIVIDNAPRL"
FT   gene            complement(310694..311608)
FT                   /locus_tag="Atu0318"
FT                   /old_locus_tag="AGR_C_556"
FT   CDS_pept        complement(310694..311608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0318"
FT                   /old_locus_tag="AGR_C_556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86134"
FT                   /db_xref="GOA:Q7D1P6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1P6"
FT                   /protein_id="AAK86134.2"
FT                   /translation="MAKAQVIKQALSYSSWPLVFGGGLAGSYFAFAGSHPIAAFLAVYA
FT                   GAVLSLFLLERYIPYEVEWLEGDGETMTSIGHTLLTKGLVQLAAAAAAIFPMLAANVLQ
FT                   PLAAMRFDLWPSHLPVIVQVALAVTIAEFGLYWAHRIAHETVFFWRFHALHHSVVRLWV
FT                   VNTGRFHVADSLFKITLSQIPLYFMGAPLQVFWWLGAVTAFIGILTHCNVDMKTGLLDY
FT                   IFSTPRLHRWHHSKQLPEGNTNYGENLVIFDILFGSYHNPDRPSSTDIGIKGEIAKGFV
FT                   PQLLQPFTKEGVRQIIGKDKKVS"
FT   gene            complement(312080..313654)
FT                   /gene="aarF"
FT                   /locus_tag="Atu0319"
FT                   /old_locus_tag="AGR_C_558"
FT   CDS_pept        complement(312080..313654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="Atu0319"
FT                   /old_locus_tag="AGR_C_558"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86135"
FT                   /db_xref="GOA:A9CKE1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE1"
FT                   /protein_id="AAK86135.1"
FT                   /translation="MSTLGAYFRLARVGWVLVREGVVLALPSDDLPAPAQLLKAALKPF
FT                   ARSKAKRAQRSDRLAVAVERLGPSYVKMGQFLATRPDVVGADFADDLASLQDRMAFFPA
FT                   AAAKANIEGSLGRSISELYREFGDPIAAASIAQVHPAMVDTPKGPRKVAVKVIRPGVRQ
FT                   RFQNDLEAMYLIADLQQRFVRSARRLRPVEVTRTLEQTTKIEMDLRLEAAALSELAENT
FT                   RQDPGFRVPEVDWERTGRDVVTMEWIDGVKMSDIEGLKAAGHDLNKLADTLIQSFLRHT
FT                   LRDGFFHADMHPGNLFVDAKGEIVAVDMGIAGRLGKKERRFLAEILYGFITRDYMRVAE
FT                   VHFEAGYVPGHHDKASFAQAIRAIGEPIHGQPAETISMGKLLTLLFEVTELFDMETRPE
FT                   LVMLQKTMVVVEGVSRMLNPRFNMWKAADPVVGGWIRDNLGPKRIATDLKDGVKAALKL
FT                   AEAVPEIAAKTEKLHSELMYMSENGLRFDAQTAEAIGKAEARHTKWGRIALWVIALTLL
FT                   YIAIRIS"
FT   gene            complement(313691..314467)
FT                   /gene="ubiE"
FT                   /locus_tag="Atu0320"
FT                   /old_locus_tag="AGR_C_559"
FT   CDS_pept        complement(313691..314467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="Atu0320"
FT                   /old_locus_tag="AGR_C_559"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86136"
FT                   /db_xref="GOA:Q8UIH5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIH5"
FT                   /protein_id="AAK86136.2"
FT                   /translation="MTDARTTAEGGMETSYGFHKVDEGKKQGLVNEVFHKVAKRYDIMN
FT                   DVMSAGLHRLWKDAMVSALSPRKDPSYKILDVAGGTGDVAFRIIEASNRLAHATVLDIN
FT                   GSMLAVGEERAAKKKLSDNLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVALKEA
FT                   YRVLKRGGRLLVLEFSEVDMPLLDRVYDAWSFNAIPQFGKMITGDAEPYQYLVESIRKF
FT                   PNQEDFATMIRTAGFSRVTYTNYTGGIAALHSGWKL"
FT   gene            314611..315507
FT                   /gene="mutM"
FT                   /locus_tag="Atu0321"
FT                   /old_locus_tag="AGR_C_561"
FT   CDS_pept        314611..315507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="Atu0321"
FT                   /old_locus_tag="AGR_C_561"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86137"
FT                   /db_xref="GOA:Q8UIH4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIH4"
FT                   /protein_id="AAK86137.2"
FT                   /translation="MPELPEVETVRRGLAPAMEGARVRKLHLGRPDLRFPFPADFAGLI
FT                   EGKTIISLGRRAKYLLIELEDGLTIVSHLGMSGSFRIEAEKGEGGEAPGAFHYARSKDG
FT                   KHDHVVFHLDKGEERVCVIYNDPRRFGFMHLVERNKLDLYPAFAELGPEPTGNALSADY
FT                   LASRFEGKSQPLKSTLLDQKIIAGLGNIYVCEALWRAHLSPLRAAGTLVTTRGKPKAQL
FT                   IDLTEKIRDVIADAIAAGGSSLRDHIQTDGTLGYFQHSFSVYDQEGQPCRTPGCGGTVE
FT                   RVVQAGRSTFYCAACQK"
FT   gene            315554..316315
FT                   /gene="fadB"
FT                   /locus_tag="Atu0322"
FT                   /old_locus_tag="AGR_C_562"
FT   CDS_pept        315554..316315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="Atu0322"
FT                   /old_locus_tag="AGR_C_562"
FT                   /product="enoyl CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86138"
FT                   /db_xref="GOA:Q7D1P4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1P4"
FT                   /protein_id="AAK86138.2"
FT                   /translation="MILVEKRDEVGVITLNRPKVLNALNSVLLKELRHILSSFSADDSI
FT                   GAIIITGSEKAFAAGADIKEMQGLDFVDAYVGDFLGGWDEVAATRKPVIAAVSGFALGG
FT                   GCELAMMCDFIIASDTAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDA
FT                   AEAERAGLVSRIVPAADLMEVAVEAATRIASLSRASVLMAKESVNRSFEVPLAEGLRYE
FT                   RRAFQSLFATEDQKEGMAAFVEKRKPAFRNR"
FT   gene            316511..316777
FT                   /gene="rpsT"
FT                   /locus_tag="Atu0323"
FT                   /old_locus_tag="AGR_C_563"
FT   CDS_pept        316511..316777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="Atu0323"
FT                   /old_locus_tag="AGR_C_563"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86139"
FT                   /db_xref="GOA:Q8UIH2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIH2"
FT                   /protein_id="AAK86139.1"
FT                   /translation="MANTTSAKKATRKIARRTAVNKARRSRVRGFIRKVEEAIATGDLA
FT                   VATEALKAAQPEIQRAATRGVLHGNTASRKVSRLAQRVKALSA"
FT   gene            317547..319109
FT                   /gene="dnaA"
FT                   /locus_tag="Atu0324"
FT                   /old_locus_tag="AGR_C_566"
FT   CDS_pept        317547..319109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Atu0324"
FT                   /old_locus_tag="AGR_C_566"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86141"
FT                   /db_xref="GOA:Q8UIH1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIH1"
FT                   /protein_id="AAK86141.2"
FT                   /translation="MQLNLAMGAVADGDRAPKACDAACSEAAGDKSAMMHDALFERFSA
FT                   RLKAQVGPEVYASWFARLKLHTVSKSVVRFTVPTTFLKSWINNRYMDLITSLVQSEDPD
FT                   VLKVEILVRSASRPVRPAQTEERAQPVQEVGAAPRNKSFIPSQSATAPAAQPMAAQATL
FT                   RQGGSGPLFGSPLDTRFTFDTFVEGSSNRVALAAAKTIAEAGAGAVRFNPLFIHAGVGL
FT                   GKTHLLQAIANAAIDSPRNPRVVYLTAEYFMWRFATAIRDNDALTLKDTLRNIDLLVID
FT                   DMQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGMAIEIE
FT                   GPDYDMRYEMLNRRMGSARQDDPSFEISDEILTHVAKSVTASGRELEGAFNQLMFRRSF
FT                   EPNLSVDRVDELLSHLVGSGEAKRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQ
FT                   IAMYLAKMLTPRSFPEIGRRFGGRDHTTVLHAVRKIEDLISGDTKLGHEVELLKRLINE
FT                   NNA"
FT   gene            complement(319179..320378)
FT                   /gene="hemN"
FT                   /locus_tag="Atu0325"
FT                   /old_locus_tag="AGR_C_568"
FT   CDS_pept        complement(319179..320378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="Atu0325"
FT                   /old_locus_tag="AGR_C_568"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86142"
FT                   /db_xref="GOA:Q7D1P3"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1P3"
FT                   /protein_id="AAK86142.2"
FT                   /translation="MVGEHQLSAPGASLLPDTGDPGFGIYLHWPFCAAKCPYCDFNSHV
FT                   RHRPVDQERFTAAFLREMEHMRTLSGPRVVTSIFMGGGTPSLMDPQTVGALLDGISRFW
FT                   HVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADALK
FT                   AIRLAREIFPRMSFDLIYARPNQTVAEWDAELKEAVSYAVDHLSLYQLTIEEGTPFYGL
FT                   HKAGKLIVPDGEHSAVLYEATQEITERYGMPAYEVSNHARPGAESRHNLTYWRYGDYAG
FT                   IGPGAHGRLTRGASKLATATERHPETWLETVEREGHGMVDQELLGVDEQADELLLMGLR
FT                   LREGIDLARWSDLSGRDLDPEKEEFLLQHGFVERLGNSRLRCTPSGMLILDAVVADLAC
FT                   "
FT   gene            complement(320384..321028)
FT                   /gene="ham1"
FT                   /locus_tag="Atu0326"
FT                   /old_locus_tag="AGR_C_570"
FT   CDS_pept        complement(320384..321028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ham1"
FT                   /locus_tag="Atu0326"
FT                   /old_locus_tag="AGR_C_570"
FT                   /product="putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86143"
FT                   /db_xref="GOA:Q8UIG9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIG9"
FT                   /protein_id="AAK86143.2"
FT                   /translation="MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFSEPE
FT                   ETGTTFEENAAIKALASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFA
FT                   MAMQKVEDALAERGASKPEDRTARFVSVLCLAWPDGHVEYFRGEVEGTVVWPPRGTSGF
FT                   GYDPIFKPDGYDTTFGEMSADEKHGWKHGDAFALSHRARAFKKFVETCLEA"
FT   gene            complement(321046..321762)
FT                   /gene="rph"
FT                   /locus_tag="Atu0327"
FT                   /old_locus_tag="AGR_C_571"
FT   CDS_pept        complement(321046..321762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="Atu0327"
FT                   /old_locus_tag="AGR_C_571"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86144"
FT                   /db_xref="GOA:Q8UIG8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIG8"
FT                   /protein_id="AAK86144.2"
FT                   /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVKFGDTHVLVTASLEE
FT                   KTPPWLRNSGKGWVTAEYGMLPRSTNERMKREAASGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMETRNMIKVEKVLKDHIAAI
FT                   SCGIFAKQPVIDLDYLEDSSAETDANFVITGSGGIVEVQGTAEGAPFSEEEFLTLLGLA
FT                   KAGCSELVALQKQAIA"
FT   gene            321899..322990
FT                   /gene="hrcA"
FT                   /locus_tag="Atu0328"
FT                   /old_locus_tag="AGR_C_572"
FT   CDS_pept        321899..322990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="Atu0328"
FT                   /old_locus_tag="AGR_C_572"
FT                   /product="heat-inducible transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86145"
FT                   /db_xref="GOA:P0A3I8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3I8"
FT                   /protein_id="AAK86145.1"
FT                   /translation="MGFSAPLSKDQASLLDERSREIFRRIVEGYLDTGEPLGSRSLSRL
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHISAGRLPTQTGLRFFVDAFMQVGDLPADERAN
FT                   IDRQIGPVAGHEQSLEGLLTEASRMLSGMSRGAGLVLTAKNDVILKHVEFIRLEPTKAL
FT                   AVLVGDHNQVENRIIELPAGISSSQLTEAANFINAHLSGQTLQELRGQFQTQRTELQSE
FT                   LGMLAQDLVERGLAIWAGDNEEGKLGRLIVRGRSNLLEGLAGEEDIDRVRMLFDDLERK
FT                   ENLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDEENRVVGAVGVIGPTRLN
FT                   YARIVPMVDYTAQIMARLSRKQR"
FT   gene            323105..323740
FT                   /gene="grpE"
FT                   /locus_tag="Atu0329"
FT                   /old_locus_tag="AGR_C_573"
FT   CDS_pept        323105..323740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="Atu0329"
FT                   /old_locus_tag="AGR_C_573"
FT                   /product="GRPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86146"
FT                   /db_xref="GOA:P63187"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63187"
FT                   /protein_id="AAK86146.1"
FT                   /translation="MTDDTKKPGPDADVAEEFVDPAQAGEEQAETAEPDPVELLKAENA
FT                   DLRDKFLRLAAEMDNLRRRTERDVKDAKAYSLAGFARDMLAVSDNLRRALEAIPDELKT
FT                   NGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEGQKFDPNFHQAMFEVPNTAVPNNT
FT                   VLQVIQAGFTIGDRVLRPAMVGVAKGGPKAEPSASAEPGTSSLNEKDA"
FT   gene            complement(323822..324283)
FT                   /gene="ptsN"
FT                   /locus_tag="Atu0330"
FT                   /old_locus_tag="AGR_C_576"
FT   CDS_pept        complement(323822..324283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="Atu0330"
FT                   /old_locus_tag="AGR_C_576"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86147"
FT                   /db_xref="GOA:A9CKE0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKE0"
FT                   /protein_id="AAK86147.1"
FT                   /translation="MALADLLQQDAIIPALKVNSKKQLLQELAAKAARITGVSEREVFD
FT                   VILQREKLGSTGVGHGIAIPHGKLNSIHQITGVFARLETPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARALRDPELVTKLRATDSDTAIYAFLNQEQATAA"
FT   gene            complement(324366..324938)
FT                   /locus_tag="Atu0331"
FT                   /old_locus_tag="AGR_C_579"
FT   CDS_pept        complement(324366..324938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0331"
FT                   /old_locus_tag="AGR_C_579"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86148"
FT                   /db_xref="GOA:Q7D1P1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1P1"
FT                   /protein_id="AAK86148.2"
FT                   /translation="MSVRVSGKHMEIGESFRQRIEDNIGLAVTKYFDGGYSGQVTVEKS
FT                   GSRFAADCKLHLDTGVVLHAAGQANDPQASFDAAAERIEKRLRRYKRKLKDHHSGSNGA
FT                   LPEIAYTVMDAVPDEDHEVPEDYAPTIVAESSKQIKTMSVASAVMALDMTDEPVLLFRS
FT                   PGKEYLNIVYRRHDGNIGWIDAETIKS"
FT   gene            complement(325172..326716)
FT                   /gene="rpoN"
FT                   /locus_tag="Atu0332"
FT                   /old_locus_tag="AGR_C_581"
FT   CDS_pept        complement(325172..326716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="Atu0332"
FT                   /old_locus_tag="AGR_C_581"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86149"
FT                   /db_xref="GOA:Q8U5M8"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M8"
FT                   /protein_id="AAK86149.1"
FT                   /translation="MALSASLLLRQNQSLVMTPQLMQSIQLLQMTHFELTQFIAQEVER
FT                   NPLLEIAANDGDLGSDTPVDVDNFGDAEASDAAVRVTPDSDDWYGERAANLGEQLDTSF
FT                   ENVFPDDGEPRKADAPELASQWKSMPGQESGESYDLDDFVAARQSLSDHLNQQLPLAIS
FT                   AAEDRMIADALIGQLDETGYIAADAVDDVAERLGATPSAVEYVLKTLQGFDPPGIFSRS
FT                   LSECLATQLAQKDRLDPAMRAFVDNLELLAKRDFASLKKLCGVDEEDLLDMLAEIRTLN
FT                   PRPGAGYDSMVSETIVPDIIVRPSSTGGWLVEINPDTLPRVLINQSYFAEVSKHKARAG
FT                   EDQDFLSECMQTAHWLTRSLDQRARTIMKVASEIVRQQDAFLINGVDQLRPLNLKTVAD
FT                   AIKMHESTVSRVTSKKYMLTPRGLFELKYFFSVSISAVEGGDSHSAEAVRHRIKAMIAQ
FT                   EAAEAVLSDDDIVDNLKKTGIDIARRTVAKYREAMNIPSSVQRRREKKAMAKLSAF"
FT   gene            complement(326869..327678)
FT                   /locus_tag="Atu0333"
FT                   /old_locus_tag="AGR_C_582"
FT   CDS_pept        complement(326869..327678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0333"
FT                   /old_locus_tag="AGR_C_582"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86150"
FT                   /db_xref="GOA:A9CKD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD9"
FT                   /protein_id="AAK86150.1"
FT                   /translation="MKIPSISKILGGGRNRSADAASPADKTPYQGTLIAHGLTKTYDTR
FT                   RVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDSGKIAINGNDVTGMPMYRR
FT                   ARLGVGYLPQEASIFRGLTVEENIRAVLEVHEPDAAKRNRKLDELLEEFHIAQLRKSPA
FT                   VALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVSDIQNLVRHLTARGIGVLVTD
FT                   HNVRETLGLIDRAYIIHAGEVLTHGRPDDIVNNPDVRRLYLGNNFSL"
FT   gene            complement(327688..328251)
FT                   /locus_tag="Atu0334"
FT                   /old_locus_tag="AGR_C_585"
FT   CDS_pept        complement(327688..328251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0334"
FT                   /old_locus_tag="AGR_C_585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86151"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1N9"
FT                   /protein_id="AAK86151.2"
FT                   /translation="MMQISRPVSLGRTAGLTAAGLFFSCLATVAFAQNTTSSMQGVKLS
FT                   GDQPIAIESDQLEIRDQERKAYFTGNVKVVQGTTTLQAGKMTVNYKGQGSSLTSGDANI
FT                   EKIFVDNNVYLTSETQKATADHGEFDMAAQTFILTGKQVVLSEGTNVFTGCKLTVLMNT
FT                   GQAKLESCGGPVRIMLDPKSQKKQ"
FT   gene            complement(328265..328972)
FT                   /locus_tag="Atu0335"
FT                   /old_locus_tag="AGR_C_586"
FT   CDS_pept        complement(328265..328972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0335"
FT                   /old_locus_tag="AGR_C_586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86152"
FT                   /db_xref="GOA:Q7D1N8"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1N8"
FT                   /protein_id="AAK86152.1"
FT                   /translation="MRLNGAGEAFGPTPMLERLREPAPAFSLPNDQNGAYDTALRHSAR
FT                   VKRLKIILPLSAAIISLAFIAVSVIRTWAPEKVSLESARIEDGKIVMEKPAVAGRNEKG
FT                   IDYSMNADRALQDIANPNLMTLEKVLAAVPVNDSVAQVIAQEGIFDRSTNTLKMTAPFD
FT                   INLSNGIQAKFQSADVDLKAGKMSSKEPVSIKTNDGSIVAQSIDIADNGKTITFSGQVR
FT                   ARIAASNIKNEGK"
FT   gene            329164..330117
FT                   /gene="sppA"
FT                   /locus_tag="Atu0337"
FT                   /old_locus_tag="AGR_C_588"
FT   CDS_pept        329164..330117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="Atu0337"
FT                   /old_locus_tag="AGR_C_588"
FT                   /product="proteinase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86153"
FT                   /db_xref="GOA:A9CKD8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD8"
FT                   /protein_id="AAK86153.1"
FT                   /translation="MDNMAIADRRRLRRKLTFWRVAAVLLLVVGAFGLYRFFWQGPQQS
FT                   AKPHIARIEVSGLITDNTELLERLDKIAKSDNVKGLIVSISSPGGTTYGGERIFKVIRS
FT                   VAEKKPVVSDVRTLAASAGYMIASAGDVIVAGETSITGSIGVIFQYPQLGQLMEKLGVS
FT                   LQEIKSSPMKAEPSPFHEAPEEAKTMIRAMVMDSYGWFVDLVADRRKLPREEVLKLADG
FT                   SIFTGRQALANKLVDTLGGEKEVRAYFETRGVAKDLPIVEWRAPSSNSPFALFSVAQIA
FT                   KLLGYDDLIPFAGPSQLGADKLFLDGLVSVWQVEPR"
FT   gene            330144..330446
FT                   /gene="ihfB"
FT                   /locus_tag="Atu0338"
FT                   /old_locus_tag="AGR_C_589"
FT   CDS_pept        330144..330446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="Atu0338"
FT                   /old_locus_tag="AGR_C_589"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86154"
FT                   /db_xref="GOA:Q8UIF9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIF9"
FT                   /protein_id="AAK86154.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDEEDD"
FT   gene            330498..330854
FT                   /locus_tag="Atu0339"
FT                   /old_locus_tag="AGR_C_590"
FT   CDS_pept        330498..330854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0339"
FT                   /old_locus_tag="AGR_C_590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86155"
FT                   /db_xref="GOA:A9CKD7"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD7"
FT                   /protein_id="AAK86155.2"
FT                   /translation="MEYCRMSKKIINLIILLPLAIILVILCVANRQSVTLALNPFRPDD
FT                   GVLSFTAPFFVFLFLAVIFGVLMGSAATWFAQGKHRKRARIEAKEAVRWHDEANRQKAA
FT                   ATGQLPHAGQLPAK"
FT   gene            331152..332081
FT                   /locus_tag="Atu0340"
FT                   /old_locus_tag="AGR_C_592"
FT   CDS_pept        331152..332081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0340"
FT                   /old_locus_tag="AGR_C_592"
FT                   /product="SAM dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86156"
FT                   /db_xref="GOA:A9CKD6"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2IGT"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD6"
FT                   /protein_id="AAK86156.1"
FT                   /translation="MQRTGELPAEHVPVILESSGAGDFHLIDSGNGLKLEQYGDYRVVR
FT                   PEAQALWRPLVPDRVWQNADAIFTGDTDEDGMGRWRFPKEALGETWPLSLLGVEFLGRF
FT                   TAFRHVGVFPEQIVHWEWLKNAVETADRPLKVLNLFGYTGVASLVAAAAGAEVTHVDAS
FT                   KKAIGWAKENQVLAGLEQAPIRWICEDAMKFIQREERRGSTYDIILTDPPKFGRGTHGE
FT                   VWQLFDHLPLMLDICREILSPKALGLVLTAYSIRASFYSMHELMRETMRGAGGVVASGE
FT                   LVIREAGLDGKTPGRVLSTSLFSRWEPK"
FT   gene            332078..332938
FT                   /gene="trmH"
FT                   /locus_tag="Atu0341"
FT                   /old_locus_tag="AGR_C_593"
FT   CDS_pept        332078..332938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="Atu0341"
FT                   /old_locus_tag="AGR_C_593"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86157"
FT                   /db_xref="GOA:Q7D1N4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1N4"
FT                   /protein_id="AAK86157.2"
FT                   /translation="MTKDMRENITRRVGQVKEVTSLANPIIKDIKALTQKKGREETGTF
FT                   MAEGLKLVIDALELGWTIKTLVYAKAAKGKPLVEQAAVKTVASGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFEQKWKPLKDIRPEKGETYIALDRVRDPGNLGTIIRTADAAGASGVIL
FT                   VGDCTDPFSLETVRATMGSVFATPVARASVEEFLSWKKSAHVSVVATHLAGSVDYRKID
FT                   YAGKPVVILMGNEQSGLPPELAGKADQLARIPQQGRADSLNLAIATAVMLFEARRHLLE
FT                   LAPVT"
FT   gene            332938..333426
FT                   /gene="lspA"
FT                   /locus_tag="Atu0342"
FT                   /old_locus_tag="AGR_C_596"
FT   CDS_pept        332938..333426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Atu0342"
FT                   /old_locus_tag="AGR_C_596"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86158"
FT                   /db_xref="GOA:A9CKD5"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD5"
FT                   /protein_id="AAK86158.1"
FT                   /translation="MAKAALFSKFAPAFTLIAAALVLDQIVKQLVEAYLPLQEMVPVAP
FT                   FLALYRTYNLGVAFSMLEDMHGWFIVSMRLVIVVFVLWLWRKTAADRTFAHLGFAFIIA
FT                   GAAGNLLDRFFYGHVIDYILFHTQTWSFAVFNLADSFITIGAACVILDEFLHARAAKK"
FT   gene            333482..335722
FT                   /gene="barA"
FT                   /locus_tag="Atu0343"
FT                   /old_locus_tag="AGR_C_598"
FT   CDS_pept        333482..335722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="barA"
FT                   /locus_tag="Atu0343"
FT                   /old_locus_tag="AGR_C_598"
FT                   /product="two component sensor kinase/response regulator
FT                   hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86160"
FT                   /db_xref="GOA:Q7D1N2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1N2"
FT                   /protein_id="AAK86160.2"
FT                   /translation="MSELARLRQKVSDGLGLATPAADPADKTTRLANEEHASDVRAVAL
FT                   YVAISLSVGAFAAALIALAVPYAVTVVLACFFGAVLMGALFYALFGKSFPLPGTLPADY
FT                   SDVRLRQTQNRSLIAEMQESMGDIVVIRNMNRRIVEANRVFREMTGCTSPEGLSCEEIG
FT                   IAFRPGDRVHAYDVEIATPFGQRIFSWHDVVTRDLASSRLMISSIARDVTEERLALAER
FT                   EDARLRAEKADAEKARLLATVSHEIRLPLSGMLGMNHLLSQTKLNQEQRNYLDGMKQSG
FT                   QSLVQLVEDLLDYSTMEAGRFRLNPRAENLRRLIESIVEMLAHRAHEKGIEIASFVTPD
FT                   VPDYLDFDPARLRQVLFNLIGNAVKFTQVGGVVIRARMVDGELQITVEDTGPGMSEAEQ
FT                   ARIFGEFEQAGPLSQRSAGTGLGLAISARIVREFGGNLTVSSRRGEGSTFKLVFRPGRA
FT                   PAEMPDSGRSHCLQHTNVLLIAPEGVAAAVTMEAIEAFGGKCILIHQPEDLDRLRNEPV
FT                   SRTADLTDIIVDLRISALFRDALRDWPQQTIRRTLLVSPEERASTTHASFDAWLIRPLR
FT                   EKSLIDVLCGRLRGIERRDAINDNHPDVGFSSRVVERASGVEILVAEDDAVNARIIRAV
FT                   LEKSGYIVRAVDNFQALQQSVASGASRLPNLIVSDLNMPGGEGLDVLPDLLGKLKDERN
FT                   IPVIILSGDAGAGTAEILLKAGAGAVLAKPADPRRLVEEIRRLLEAKRVLSS"
FT   gene            335817..336698
FT                   /locus_tag="Atu0344"
FT                   /old_locus_tag="AGR_C_599"
FT   CDS_pept        335817..336698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0344"
FT                   /old_locus_tag="AGR_C_599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86161"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1N1"
FT                   /protein_id="AAK86161.2"
FT                   /translation="MVAEIFNHDICENNVVISPRSETAQDNEGLFGRIGTLETRLARNE
FT                   REIDAAQSVRYRVFVEEMKARLPAEAMRRKRDFDAWDSVCDHLLVLDKSIEGDSEDQIV
FT                   GTYRLLRQETALANNGFYSASEFDIAGLVARHPGKRFMELGRSCVLPEYRTKRTVELLW
FT                   QGNWAYAVKHRMDAMIGCASFPGVQPEAHALALSFLHHNCLAKGEWEAVALPELYHEMD
FT                   LVPVEALNTRKALNAMPPLIKGYMRLGAMFGSGAVVDHAFNTTDVLVVLPVSSIAGRYI
FT                   SYYGGEAERING"
FT   gene            336889..339540
FT                   /gene="mutS"
FT                   /locus_tag="Atu0345"
FT                   /old_locus_tag="AGR_C_602"
FT   CDS_pept        336889..339540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="Atu0345"
FT                   /old_locus_tag="AGR_C_602"
FT                   /product="DNA mismatch repair protein, MutS family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86162"
FT                   /db_xref="GOA:Q8UIF2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIF2"
FT                   /protein_id="AAK86162.2"
FT                   /translation="MMEQYIEIKANNPGSLLFYRMGDFYELFFDDAVEASRALGITLTK
FT                   RGQHMGHDIPMCGVPVHAADDYLQKLILRGYRVAVCEQIEDPAEAKKRGSKSVVKRDVV
FT                   RLVTPGTLTEEKLLSPTESNYLMALARIRGSAEAQFALAWIDISTGVFRLAETTLTRLL
FT                   ADIWRIDPRELIVADSLFHDEELRPVFDVLGRVAVPQPAILFDSAVAEGRIARYFNVST
FT                   LDGFGTFSRVEMAAAAAAVAYVEKTQIAERPPLGAPERESAASTLFIDPATRANLELVK
FT                   TLSGDRDGSLLHALNRTVTGGGARLLAERLMSPLTDPERINARLDAVAYLIDDVSLCDG
FT                   LRDALKHVADMPRALSRLALERGGPRDLGAIRQGLVSAEKIAVILDGGLLPDELAKALR
FT                   DLKALPGALEAMLGSMLADDLPLLKRDGGFLREGANPELDEVRALRDQSRRVIAGLQLQ
FT                   YADETGIKSLKIKHNNVLGYFIEVTAGNADVMMATDEAKARFIHRQTMAGAMRFTTTEL
FT                   ADLESRIANAAAEALTMELEAFERMVEAVVQQAEAIKAGALALAVIDVASSLAYLATEQ
FT                   AYCRPIVDASMTFSIKGGRHPVVEQALRRQSAGPFIANNCDLSAVNGGKNGAIWLLTGP
FT                   NMGGKSTFLRQNALIAILAQIGSFVPAEAAHIGVVDRLFSRVGASDDLARGRSTFMVEM
FT                   VETAAILNQATDRSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHFHELT
FT                   VLSEKLGRLSNATMRVKEWEGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVERAREV
FT                   LTKLEDADRKNPASQLIDDLPLFQIAVRREETRKAGPSKVEEALKSFNPDEMTPREALD
FT                   ALYALKKELGKA"
FT   gene            339637..342465
FT                   /gene="glnD"
FT                   /locus_tag="Atu0346"
FT                   /old_locus_tag="AGR_C_606"
FT   CDS_pept        339637..342465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="Atu0346"
FT                   /old_locus_tag="AGR_C_606"
FT                   /product="uridylyltransferase/uridylyl-removing enzyme
FT                   UTase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86163"
FT                   /db_xref="GOA:Q8UIF1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIF1"
FT                   /protein_id="AAK86163.2"
FT                   /translation="MAIKDLDFSDILDVSALKRDCDVIFKEDSKRIADIKSDLLPIFRR
FT                   ASTEGREKARELLKADGSGIDCARRISWLQDRLIETLYDLACQHVYPKDAPQIAVAAVG
FT                   GYGRGTLAPGSDIDLLFLLPAKNTPDMHKAVEFVLYLLWDLGFKVGHATRTVDECIRLS
FT                   KSDMTIRTAILEVRAICGRKSLTDDLEKRFESEVVTGTGPEFIAAKLAERDQRHRKAGD
FT                   TRYLVEPNVKEGKGGLRDLHTLFWIAKYYYHVRDTADLVKLGVLSRSELKLFEKADDFL
FT                   WAVRCQMHFITGKAEERLSFDIQREIADALNYQPRPGLSAVERFMKHYFLVAKDVGDLT
FT                   RIVCAALEDRQAKDVPGLSGVLSRFAHRVRKIPGSVEFVEDRGRIALARPDVFKNDPVN
FT                   LIRLFHIADINNLELHPDALRVVTRSLSLINDELRENEEANRLFLSILTSRRDPALTLR
FT                   RMNEAGVLGKFIPEFGKIVAMMQFNMYHHYTVDEHLIRSVGVLSEVDKGTAVDAHPLAN
FT                   QLMPGVEEREALYVAVLLHDVAKGRQEDHSIAGARVARKLCQRFRLTGKQTETVVWLIE
FT                   QHLLMSMVAQTRDLHDRKTITDFADKVQSMERLKMLLILTVCDIRAVGPGVWNGWKGQL
FT                   LRSLYYETELLLSGGFSEVSRKERAQIARQALYDALEDWGQKARRKYTKLHYEPYLLTV
FT                   ALEDQVRHTRFMREADKQEKALSTMVRTHSFHAITEITVLAPDHPRLLSIITGACAAAG
FT                   ANIADAQIFTTSDGRALDTILINREFPIDEDETRRGANVGKLIEEVLSGKQRLPEMIAT
FT                   RTKSRRKKSAFTIPPSVTISNGLSNKFTVIEVECLDRPGLLADMTAVIADLSLDIHSAR
FT                   ITTFGEKVIDTFYVTDLFGQKVTNDNRQASIAQRLKAVMSEQEDELRDRMPNGIIAHPD
FT                   VAALPAARTAKA"
FT   gene            342473..344062
FT                   /gene="mviN"
FT                   /locus_tag="Atu0347"
FT                   /old_locus_tag="AGR_C_608"
FT   CDS_pept        342473..344062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="Atu0347"
FT                   /old_locus_tag="AGR_C_608"
FT                   /product="virulence factor MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86164"
FT                   /db_xref="GOA:Q7D1M9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1M9"
FT                   /protein_id="AAK86164.2"
FT                   /translation="MSLIGKFATVGTATLGSRIFGFLRETLMAAAVGTGPVADAFNAAF
FT                   RFPNTFRRLFAEGAFNSAFVPLFAKEIEANGMEGARRFSEEVFGVLFTVLLALTILMEL
FT                   SMPFIVRTVIAPGFLEDPVKFDNTVRLATIMFPYLACMSLAAMMGGMLNSLHRYFAAAI
FT                   APVFLNIILIGVLALAWWKNYDPLQVGYALSWGVMAAGLVQLAIVWIAVRNAGMRIGLR
FT                   RPRLTKNVQRLLVLALPAAITGGITQINLLINTNIASAGEGVISSLAYADRIYQLPLGV
FT                   VGIAVATVLLPELARALRGGHMVEAGSLQNRSVEFVLFLTLPAAAALLVMAEPIVRFLY
FT                   ERGNFSPSATITVAQILGIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAVSVVVNVS
FT                   LALTLFPRLGGPGIAIAEITAGWVNAALLFGMLLWRGHWHVDIPLLTRIPRLLLAAALM
FT                   AGFVHYALTWLSFELSSASSIFVRAGTIMGLVFTAMLVYFVLAFVSGGADIGMVKRAVR
FT                   KRGKKTAETEVG"
FT   gene            344062..344466
FT                   /locus_tag="Atu0348"
FT                   /old_locus_tag="AGR_C_609"
FT   CDS_pept        344062..344466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0348"
FT                   /old_locus_tag="AGR_C_609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86165"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD4"
FT                   /protein_id="AAK86165.1"
FT                   /translation="MSFSENRRIALVTLVVDNYDRAKAFYCDVLGFECLSDKPLDDGKR
FT                   WVVVKPQGAEGGALLLAEADGEQQRLAIGNQTGGRVGFFLHTDDFARDYETMIARGVHF
FT                   LEEPRHEVYGSVAVFADPYGNRWDLLQPRG"
FT   gene            344570..345634
FT                   /gene="trpS"
FT                   /locus_tag="Atu0349"
FT                   /old_locus_tag="AGR_C_611"
FT   CDS_pept        344570..345634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="Atu0349"
FT                   /old_locus_tag="AGR_C_611"
FT                   /product="tryptophan-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86166"
FT                   /db_xref="GOA:Q8UIE8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIE8"
FT                   /protein_id="AAK86166.2"
FT                   /translation="MNAFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQEDNDCIYCVVD
FT                   MHAITAQLVHSDLKAQTRSIAAAFIAAGIDPVKHIVFNQSAVPQHAELAWVFNCVARIG
FT                   WMERMTQFKDKSGKNAEQVSLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELARDIA
FT                   QKFNIDFGGHIRNAGLGVNITVGDEPVHAYFPMVEPLIGGPAPRVMSLKDGTKKMSKSD
FT                   PSDLSRINLMDDVDAISKKIKKAKTDPDALPSEVEGLKGRPEAENLVGIYAALSDKTKA
FT                   DVLAEFGGQQFSTFKPALVELAVNVLAPVNNEMRRLLDDPTHIDAILSQGGERARTIAE
FT                   KTMNEVRDIIGFLR"
FT   gene            345749..346240
FT                   /locus_tag="Atu8118"
FT                   /old_locus_tag="AGR_C_613"
FT   CDS_pept        345749..346240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8118"
FT                   /old_locus_tag="AGR_C_613"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8118"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86167"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M6"
FT                   /protein_id="AAK86167.1"
FT                   /translation="MVSTRLSRLEGHRRKFLAVIDDTPECERAVHYAGRRAKNSNGGLV
FT                   LLYMIPEGDFQQWLGVEQIMRAEAREEAEATLAKVAQKVRETIGIEPESVIREGSATEQ
FT                   IHGLIEEDRDIAILVLAAGSTKEGPGPLVSSIAGRGAAFPIPVTVLPDTLTDEEIDALC
FT                   "
FT   gene            346383..346946
FT                   /locus_tag="Atu0351"
FT                   /old_locus_tag="AGR_C_616"
FT   CDS_pept        346383..346946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0351"
FT                   /old_locus_tag="AGR_C_616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86168"
FT                   /db_xref="GOA:A9CKD3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD3"
FT                   /protein_id="AAK86168.1"
FT                   /translation="MFIQTEATPNPATLKFLPGKVVLESGTVEFLNASQAQASPLAERL
FT                   FTIPGVTGVYFGFDFITVTKDDAEWQHLKPAILGSIMEHFMSGRPIMGTAIAAEVSDEE
FT                   GEFFEEGDETIVATIKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCPSST
FT                   ATLKHGVQNLLRHFVPEVREVEAV"
FT   gene            346963..347631
FT                   /locus_tag="Atu0352"
FT                   /old_locus_tag="AGR_C_617"
FT   CDS_pept        346963..347631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0352"
FT                   /old_locus_tag="AGR_C_617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86169"
FT                   /db_xref="GOA:A9CKD2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD2"
FT                   /protein_id="AAK86169.1"
FT                   /translation="MIVLALDTSGVDCSACIYDNASDTVLGEVCETIGKGHAERLMAVI
FT                   DGALQQAQLPLQKVERIAVTIGPGSFTGIRVGVAAARGFALSLGVEAVGVTTLETLALH
FT                   HLAENPGRPVAVGLDAKRGETYLQIFGTDGSPLNEAALLSLDDAKDALSGFDGAVIGSA
FT                   APLFAGEETGSGPDHFPIAFVARAGARKSAGQPKPAPLYLRGPDARPQTGFALARQDVA
FT                   "
FT   gene            347675..348169
FT                   /locus_tag="Atu0353"
FT                   /old_locus_tag="AGR_C_619"
FT   CDS_pept        347675..348169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0353"
FT                   /old_locus_tag="AGR_C_619"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86170"
FT                   /db_xref="GOA:A9CKD1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD1"
FT                   /protein_id="AAK86170.1"
FT                   /translation="MFDDYLSWKPYFEIVPMQHEDCAAVADLHALRFPRPWNDGEFSGL
FT                   LTQGSVFGAVARQTNAFFSKPLGGFVLAREVAGEAEILTVAVSDKFSRAGLGWRLMQSA
FT                   IREAMMRGAETMFLEVDNNNASALGLYKKLGFKTVAERKAYYTAKNGSKSTALVMRRDL
FT                   R"
FT   gene            348239..348667
FT                   /gene="fur"
FT                   /locus_tag="Atu0354"
FT                   /old_locus_tag="AGR_C_620"
FT   CDS_pept        348239..348667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="Atu0354"
FT                   /old_locus_tag="AGR_C_620"
FT                   /product="ferric uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86171"
FT                   /db_xref="GOA:A9CKD0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKD0"
FT                   /protein_id="AAK86171.1"
FT                   /translation="MIDLSKTLEELCAERGMRMTDQRRVIARVLQESADHPDVEELYRR
FT                   SSAVDPRISISTVYRTVKLFEDAGIIERHDFRDGRSRYETVPEEHHDHLIDLKNSVVIE
FT                   FHSPEIEALQEKIAREHGFKLVDHRLELYGVPLKPEER"
FT   gene            348698..349492
FT                   /gene="plsC"
FT                   /locus_tag="Atu0355"
FT                   /old_locus_tag="AGR_C_621"
FT   CDS_pept        348698..349492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="Atu0355"
FT                   /old_locus_tag="AGR_C_621"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86172"
FT                   /db_xref="GOA:A9CKC9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC9"
FT                   /protein_id="AAK86172.1"
FT                   /translation="MMWLRTAYIAIVLLIVTLILLPLQLLGLAFDWRLRRRIPRIWHRI
FT                   ACHVLGIRVHVHGEVERAKPLMLAVNHASWKDILVLGSIADVVFIAKTEVRDWPVFGWL
FT                   ARLQKSIFVQREQKRSTGQQVGEIASRMADGEIVVLFPEGTTSDGNRMLAVKSSLFGAA
FT                   STAAEQVPGKLVYVQPVAIAYTRVQGMAMGRYHRIIAAWPGSITLVPHLLGVIKAGAID
FT                   VDVTFGDSVPFHSADNRKRLATDIAAAIRSMLAFSLRGGWRK"
FT   gene            349679..351046
FT                   /gene="miaB"
FT                   /locus_tag="Atu0356"
FT                   /old_locus_tag="AGR_C_623"
FT   CDS_pept        349679..351046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="Atu0356"
FT                   /old_locus_tag="AGR_C_623"
FT                   /product="miaB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86173"
FT                   /db_xref="GOA:Q7D1M2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D1M2"
FT                   /protein_id="AAK86173.2"
FT                   /translation="MIAREGSNSRKVFIKTYGCQMNVYDSVRMSDALAKDGYVQTEDMG
FT                   EADLVLLNTCHIREKAAEKVYSALGRLRDMKKSREEQGREFMIGVAGCVAQAEGEEILR
FT                   RAPAVDVVIGPQTYHRLPDALKRVRRGERVIETEYAVEDKFEHLPVAEKATLRSRGVTA
FT                   FLTVQEGCDKFCTFCVVPYTRGSEVSRPVRQIVDEAMKLVDAGVREITLLGQNVNAWQG
FT                   EGPKGEKWGLAELLYRLAEIPGLARLRYTTSHPRDMDDRLIGAHRDLRILMPYLHLPVQ
FT                   SGSDRILKAMNRRHTGEEYIQLIEKIRSARPDIAMSGDFIVGFPGETDRDFEDTMAMVE
FT                   TVKYAQAFSFKYSTRPGTPGADLTDQVAEDVKAERLERLQALLLRQQKEFAESLVGKTM
FT                   DVLLEKPGRMPEQLIGRSPWLQSVNLDAKTLKIGDIVNVRITATGPNSLFAEVAGS"
FT   gene            351087..352142
FT                   /gene="phoH"
FT                   /locus_tag="Atu0357"
FT                   /old_locus_tag="AGR_C_625"
FT   CDS_pept        351087..352142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="Atu0357"
FT                   /old_locus_tag="AGR_C_625"
FT                   /product="phosphate starvation inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86174"
FT                   /db_xref="GOA:Q7D1M1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1M1"
FT                   /protein_id="AAK86174.2"
FT                   /translation="MNAHELVSNPSRQPRQAATDANHFVLTFENNRIAGELFGQFDQNL
FT                   KLLEQRLNIDARPRGNSVAITGDVVATNQARRALDFLYERLLKGGTAEASDVEGAIRMA
FT                   MAADDQLTLPTMERKAKISMAQISTRKKTIAARTPTQDVYMRALEQSELVFGVGPAGTG
FT                   KTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDM
FT                   MPGDKVERAIQAGVIEIAPLAFMRGRTLANAAVILDEAQNTTTMQMKMFLTRLGENGRM
FT                   IVTGDPSQVDLPRGVKSGLVEALQILPEVEGVSVVRFKDVDVVRHPMVARIVRAYESHT
FT                   AVPDESLPKGN"
FT   gene            352153..352659
FT                   /locus_tag="Atu0358"
FT                   /old_locus_tag="AGR_C_626"
FT   CDS_pept        352153..352659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0358"
FT                   /old_locus_tag="AGR_C_626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86175"
FT                   /db_xref="GOA:Q8UID9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UID9"
FT                   /protein_id="AAK86175.2"
FT                   /translation="MAALDIQISVEAEGWSSEENLAAFATKVLNAAVDFLKREEEQPFP
FT                   KMPVELSLVFTDDENIREINAEWRDKDKATNVLSFPAFPLEPGGMPGPMLGDIVIARET
FT                   VEREALELDKSFEDHLTHLLVHGFLHLFGYDHMDEEEAEEMESLETRILAVLGLSDPYA
FT                   GQEPL"
FT   gene            352675..353817
FT                   /locus_tag="Atu0359"
FT                   /old_locus_tag="AGR_C_627"
FT   CDS_pept        352675..353817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0359"
FT                   /old_locus_tag="AGR_C_627"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86176"
FT                   /db_xref="GOA:Q7D1M0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1M0"
FT                   /protein_id="AAK86176.2"
FT                   /translation="MNEHSARPANEGRENGEQSSSEEGSSHLRNDSHAKPRSTIWSRIG
FT                   RLLKPSQGERLREDLTDALMADTEIGAAFSPEERAMLNNILRFREVRVEDIMIPRVDID
FT                   GLDQNMTIGEALILFEETGRSRMPVYDETLDNPKGMIHIRDLLAYVAKQARNKRRAGSR
FT                   SVAYGEVKATTRSPRPNFDLARVDLEQTVADAGLVRKILFAPPSMLASDLLKTMQAQRT
FT                   QLALVIDEYGGTDGLVSHEDIVEMVVGDIDDEHDKDEAMFSRLSADVLVADARAELTEL
FT                   AEVIGPEFDVREHLEEIDTLGGLIFFALGRIPAKGEVVRAVPGFEFQILDADSRRIKGV
FT                   RIVRDHGSEGQDDQAPGEADGVIALPAPDVRLITHQQNAD"
FT   gene            354024..355613
FT                   /gene="lnt"
FT                   /locus_tag="Atu0360"
FT                   /old_locus_tag="AGR_C_629"
FT   CDS_pept        354024..355613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="Atu0360"
FT                   /old_locus_tag="AGR_C_629"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86177"
FT                   /db_xref="GOA:Q8UID7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UID7"
FT                   /protein_id="AAK86177.1"
FT                   /translation="MERLAGRVMLAGGMSRAVMAIAAGAVGALALPPFGFFAALFFSFT
FT                   LLVWLVDGCTGKPGGGLFSRILPAFGIGWCFGFGYFVAGLWWLGNALLLEADEFAWALP
FT                   LAILGLPALLALFYGFAVAAANLLWSDGLGRIAALAAAFGVSEWLRSFLATGFPWNAIG
FT                   YGIMPIPIMMQSAHLLGLLSITTLAVFIFASPALIGTKKGMGPGLALAGLLLAAHFGYG
FT                   FYRLQTPAETPADALTVRIVQPAIDQSRKMLNTDRAEIFAEHLRLSALPPGEGKKRPDI
FT                   IVWPETSVPFILTQNPDALAEIASTLEDGQVLFTGAVRMEDQGAGRPPRYYNSVYAIDS
FT                   QGEIIGATDKVHLTPFGEYVPFEGILREFGIDNVIALPGGFSAASSRTPLTLPSGKTFY
FT                   PLICYEIIFPGEMTPGLQGAAAILNVTNDGWFGDTPGPYQHFLQARVRAVETGVPVIRG
FT                   ANTGISAVIDPYGRIIAGLDYGRVGILDATLSGGSNDAFTYDTHRTYFWLIFSILMIVA
FT                   VFPALSFARRQN"
FT   gene            355747..356166
FT                   /locus_tag="Atu0361"
FT                   /old_locus_tag="AGR_C_630"
FT   CDS_pept        355747..356166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0361"
FT                   /old_locus_tag="AGR_C_630"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86178"
FT                   /db_xref="GOA:Q7D1L8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1L8"
FT                   /protein_id="AAK86178.2"
FT                   /translation="MTENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISGILNVPVSFFFEDAPGDQVGGTSGMAEASSSNYVVDFLSSA
FT                   EGLQLNRAFVKIADPKVRRRLVDLVKALAAEGDAE"
FT   gene            356353..357615
FT                   /gene="metK"
FT                   /locus_tag="Atu0362"
FT                   /old_locus_tag="AGR_C_632"
FT   CDS_pept        356353..357615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="Atu0362"
FT                   /old_locus_tag="AGR_C_632"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86179"
FT                   /db_xref="GOA:A9CKC8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC8"
FT                   /protein_id="AAK86179.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLIYREAAKTGVDPWT
FT                   VRIACETLATTNRVVIAGEVRVPDTLLKKDKDGKVVKDAAGHPVINPSKFKSAARKAIR
FT                   DIGYEQDGFHWKTAKIDVLLHPQSADIAQGVDNASDKQGDEGAGDQGIMFGYACKETPD
FT                   LMPAPIYYSHRILQLLATARKSGEGEAAKLGPDAKSQVTVRYVDGKASEAVSIVLSTQH
FT                   LDASWDSKKVREVVEPYIREALGELKIADDCQWYINPTGKFVIGGPDGDAGLTGRKIIV
FT                   DTYGGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLAERCTIQIAYAIGVAQP
FT                   LSIYVDLHGTGKVSEDQVEAAIRKVMDLSPSGIRRHLDLNKPIYAKTSSYGHFGRKAGR
FT                   DGSFSWEKLDLVKPLKEALSA"
FT   gene            357787..358485
FT                   /locus_tag="Atu0363"
FT                   /old_locus_tag="AGR_C_634"
FT   CDS_pept        357787..358485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0363"
FT                   /old_locus_tag="AGR_C_634"
FT                   /product="putative tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86180"
FT                   /db_xref="GOA:Q8UID4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UID4"
FT                   /protein_id="AAK86180.1"
FT                   /translation="MTEERRSRATEAFFGRRKGKPLRNQQVDTIENLLPLLKIDLESVP
FT                   PQNLVALFPADVRSIRLEIGFGGGEHLAHRAVENPETGFIGVEPFVNSMAKLLATVRER
FT                   ELMNIRLYDDDATQLLDWLPEGSIDHIDLLYPDPWPKKKHWKRRFVSDVNLARFHRVLK
FT                   PGGKFCFASDIDTYVNWTLQHCARHGGFEWTATSADDWRTPYANWPGTRYENKAKREGR
FT                   SSAYLTFIRR"
FT   gene            complement(358549..359448)
FT                   /gene="rbsK"
FT                   /locus_tag="Atu0364"
FT                   /old_locus_tag="AGR_C_637"
FT   CDS_pept        complement(358549..359448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="Atu0364"
FT                   /old_locus_tag="AGR_C_637"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86181"
FT                   /db_xref="GOA:A9CKC7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC7"
FT                   /protein_id="AAK86181.1"
FT                   /translation="MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALA
FT                   ARRAGVTVKMAGATGDDTFAAPALTLLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMI
FT                   SVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPAAAIEAALTAAKAKRITTVINTAP
FT                   LTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRTGQTLIVTLGADG
FT                   VIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLACT
FT                   RAGAQPSIPQAAEVDAAL"
FT   gene            complement(359503..360735)
FT                   /locus_tag="Atu0365"
FT                   /old_locus_tag="AGR_C_639"
FT   CDS_pept        complement(359503..360735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0365"
FT                   /old_locus_tag="AGR_C_639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86182"
FT                   /db_xref="GOA:A9CKC6"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC6"
FT                   /protein_id="AAK86182.1"
FT                   /translation="MIFRITGNLLDLIMNIDFSVLLNPALRAGSVDISFGALLVALVLG
FT                   LTITWLVTTNRTRKAGADSEISDLLKTQSELHGRIAAMAETLGTRQTEMSQTLNQRLDG
FT                   MSQRLGETLTEQTRSTHENLSRLQERLAVIDAAQGNIQDLAKDVVGLQAILSNKQTRGA
FT                   FGQARMETLIADALPAGAFQLQPTLSNGYRPDCIIKMPNNAPALVIDAKFPLEAWNAIK
FT                   ADETPETKRAAVQQFRRDMEVHIRDVAEKYLIRGETQDTAFIFVPSESIFADIHQHFEY
FT                   LVQRAHRARVVIVSPSLLMLSVQVIQSVLKDQRMREQAHLIQGEVALLMDDVRRLDDRT
FT                   RKLQAHFGLAQKDVDMMLISSDKVLARGQKIEGLDFSPTEKEASHGEIEQTRRFAENRA
FT                   GAAKLRVVDDE"
FT   gene            360846..361358
FT                   /gene="def"
FT                   /locus_tag="Atu0366"
FT                   /old_locus_tag="AGR_C_640"
FT   CDS_pept        360846..361358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="Atu0366"
FT                   /old_locus_tag="AGR_C_640"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86183"
FT                   /db_xref="GOA:Q8UID1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UID1"
FT                   /protein_id="AAK86183.1"
FT                   /translation="MTIKPLIILPDPVLRQQSKLIEQVDAEVLRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDVAREGEEKTPVVFINPEILKVSDDISTYEEGCLSIPDYYAEV
FT                   ERPASLTVQYVGRDGKQQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKRDMVIKKFT
FT                   KAARAKI"
FT   gene            361403..362338
FT                   /gene="fmt"
FT                   /locus_tag="Atu0367"
FT                   /old_locus_tag="AGR_C_642"
FT   CDS_pept        361403..362338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="Atu0367"
FT                   /old_locus_tag="AGR_C_642"
FT                   /product="methionyl-tRNA formyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86184"
FT                   /db_xref="GOA:Q8UID0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UID0"
FT                   /protein_id="AAK86184.1"
FT                   /translation="MSLRIIFMGTPDFSVPTLRALVEAGHEIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQVAELLGLPVLTPVNFKAEEDRQQFRDFNADVAVVVAYGLLLPEAILSGTRL
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVMKMEKGLDTGPVALTAKVAIDENMT
FT                   AGELHDSLMLAGARLMRQAMAKLEADDLPLVTQAEEGVLYAAKIDKGETRIDFSRPAQD
FT                   VHNHIRGLSPFPGAWLEMDIGGKPERVKVLASELASGMGEAGSALDDALTIACGSDAVR
FT                   LTRLQKAGGKPMSAADFVRGTPVPATTRLG"
FT   gene            362338..363138
FT                   /gene="truA"
FT                   /locus_tag="Atu0368"
FT                   /old_locus_tag="AGR_C_644"
FT   CDS_pept        362338..363138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="Atu0368"
FT                   /old_locus_tag="AGR_C_644"
FT                   /product="tRNA pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86185"
FT                   /db_xref="GOA:Q8UIC9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIC9"
FT                   /protein_id="AAK86185.1"
FT                   /translation="MPRFRMTVEYDGTPYYGWQRQENGPSVQGALEAAVRSLTGESVSI
FT                   RGAGRTDSGVHAVGQVAHIDLSRDWEPYKLRNALNAHLAMAGEAVAVLDAAAVTEDFDA
FT                   RFSALRRHYLYRIICRKSRLALEHKRAWWVSKDLDHERMHEAAQMLVGRHDFTTFRSVH
FT                   CQANSPVRTLDRLDVTRNGDLIEIRATAQSFLHNQIRSFAGTLKLAGEGGMTPDDVRAA
FT                   LEARDRKACGPVAPPDGLYFMQVDYPDVIPPRRRPEIEMTEDAD"
FT   gene            complement(363158..363754)
FT                   /locus_tag="Atu0369"
FT                   /old_locus_tag="AGR_C_646"
FT   CDS_pept        complement(363158..363754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0369"
FT                   /old_locus_tag="AGR_C_646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86186"
FT                   /db_xref="GOA:A9CKC5"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC5"
FT                   /protein_id="AAK86186.1"
FT                   /translation="MPTASEVRLYLTGLWLLLLGDHNGARYLDLSERGMWRSFYSALWC
FT                   LPAMLVSWLWLRAAFLASVPPGAETGFLFFFRLAMVEAICWIVPLLLIGMLLYAFGARE
FT                   KFAPLVTTVNWLSLPFSYAYAVLILIAFFLPPLQGLIAILWLALLLSLVFAFSRIVRFF
FT                   IRDQSLLVSAVVMTLLVPAMLLSEALQRFLGVYPA"
FT   gene            complement(363738..364934)
FT                   /gene="dapE"
FT                   /locus_tag="Atu0370"
FT                   /old_locus_tag="AGR_C_647"
FT   CDS_pept        complement(363738..364934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="Atu0370"
FT                   /old_locus_tag="AGR_C_647"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86187"
FT                   /db_xref="GOA:A9CKC4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKC4"
FT                   /protein_id="AAK86187.1"
FT                   /translation="MTTTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVERVM
FT                   ATEDGTPDVENLYARLGTEGPHLMFAGHTDVVPVGDEAAWSHPPFSADIAGGEMYGRGA
FT                   VDMKGGIACFVAAIARHIGKHGKPQGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWD
FT                   ACVVGEPTNPDQLGDMIKIGRRGSLSGRITVQGVQGHAAYPHLADNPIRGLLQLTHALM
FT                   HPAFDHGTDDFQPSNLEVTTVDTGNAATNVIPARATAAFNIRFNDSWTAESLRAEIIRR
FT                   LDAAANEGELRPDRAPVKYEIVWADRPSHVFLTRNNALISSLSGAIETVTGKEPKLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTRIYETFIERWFAHADGK"
FT   gene            complement(364949..365803)
FT                   /gene="dapD"
FT                   /locus_tag="Atu0371"
FT                   /old_locus_tag="AGR_C_648"
FT   CDS_pept        complement(364949..365803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="Atu0371"
FT                   /old_locus_tag="AGR_C_648"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86188"
FT                   /db_xref="GOA:Q8UIC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIC6"
FT                   /protein_id="AAK86188.2"
FT                   /translation="MSLTDLTSLETIIETAFDNRDGVNVSTKGEVRDAVNTSLQLLDSG
FT                   KVRVAEKQADGNWKVNQWLKKAVLLSFRLNDMEIVTGGPGESTWWDKVPSKFENWGENQ
FT                   FRAAGFRAVPNAVVRRSAYVAKNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNV
FT                   HLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGCIVREGAVLGMGVFIGKSTKIV
FT                   DRATGEITYGEVPPYSVVVAGTMPGKPFPNGEPGPSLYCAVIVKRVDEKTRSKTGINEL
FT                   LRD"
FT   gene            365886..366806
FT                   /locus_tag="Atu0372"
FT                   /old_locus_tag="AGR_C_649"
FT   CDS_pept        365886..366806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0372"
FT                   /old_locus_tag="AGR_C_649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86189"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1L1"
FT                   /protein_id="AAK86189.1"
FT                   /translation="MLERRQCDLGDLARQTKGMEMTRLKNGKLRRKDGAWDPLKRSAVD
FT                   KQQAEVVVKTPQSDSPSYRLAYVDTDFLCREELRPIRLQLELLKTEMALTERGINSTVV
FT                   MFGGARIPEPGGDAWAARNETQKRNLEQSSIYYEEARKFARLCTDYGAKSGHLEYVVVT
FT                   GGGPGVMEAGNRGAADVGGPSIGLNIVLPHEQAPNPYVTPELSFNFHYFAIRKMHFLMR
FT                   AKAVVVFPGGFGTLDELFEALTLIQTKRMAPIPLILFGENFWRSVVNFEFLANFGTIAP
FT                   EDMDLLHFAETADDAWKIISEYYEH"
FT   gene            366973..369300
FT                   /locus_tag="Atu0373"
FT                   /old_locus_tag="AGR_C_652"
FT   CDS_pept        366973..369300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0373"
FT                   /old_locus_tag="AGR_C_652"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86190"
FT                   /db_xref="GOA:Q7D1L0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1L0"
FT                   /protein_id="AAK86190.2"
FT                   /translation="MFNFKVKSLATKLILVTGCAITTVLIASNSFLISQTSERVHALTM
FT                   DQANTEARAIANVIAADVGELGSAARSMAGVIGRAHQAKSMDRPGIVNILKANVEQNTF
FT                   AFGSWFCEQLGLFDGQSTEIANRLDLGTNKSGAFAPYWSKTQKGDIQFSTFDNDYAAEW
FT                   YALASKSGKGAITQPYLAQGTEVPTTMTSLAYPVMSDGKMIGVAGVDISLASLTQKLQA
FT                   LHPFETGRVTLVSQGGQWLVPPTPEQNMKAYDGEGASTVQAAITSGKQGLIENLGLDTD
FT                   APYNRLVYPFAVPGLNATWVVLVDIPHQALNAPVQEQTFMMIIGAIVILAAVIAALYFA
FT                   VRYFVRNPLASLVADVRTLSEGRYDVPVSGQERQDETGAVASALEGFRAKLAGIREMEA
FT                   EAAAQRGHAETERQRSEFERSENSRMQQHIVGVLGAGLNALSQGNLTYRIEDEFPGEYA
FT                   KLRADFNSALESLEETVSTVNATVVSIGNGTGEITRAASDLSHRTEQQAASLEETAAAL
FT                   NELTAQVNSSAENAAEAAGAVSHACDDAGKSGEVVQQAVNSMQGIAQSSAEISRIIGVI
FT                   DEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKEIKGLINTSATQ
FT                   VGEGVQLVGKAGETMKKIADQVLQINQLIRQISASASEQAVGLKEINSAVTQMDQVTQQ
FT                   NAAMVEETTAASVTLNSEAETLKSLVAGFAVSGGHASQQLRATAATMRAPAAPARAQAA
FT                   APRARPRTSGANALAQDDWTEF"
FT   gene            complement(369370..370314)
FT                   /gene="iunH"
FT                   /locus_tag="Atu0374"
FT                   /old_locus_tag="AGR_C_654"
FT   CDS_pept        complement(369370..370314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH"
FT                   /locus_tag="Atu0374"
FT                   /old_locus_tag="AGR_C_654"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86191"
FT                   /db_xref="GOA:Q7D1K9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1K9"
FT                   /protein_id="AAK86191.2"
FT                   /translation="MAERRKIIIDTDPGQDDAAAIMLAFGSPEEIDILGLCAVAGNVPL
FT                   KLTSRNIRIICELCGRTDIPVYEGAEKPLVRKPITAEHVHGSTGLNGPVLDEPTMEAQK
FT                   QHAVDFIIETLMREPAGTVTLCTLGALTNVALALLKAPEIADRVKELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPQAADIVFRSGMPVVMMPLDVTHKLLTTKARVNRIRDIGTRPAIAMA
FT                   EMLEFFERFDIEKYGSDGGPLHDPSVIAYLLKPELFEGRECNVEIEVISELTMGMTVVD
FT                   WWRVTDRPANARVMRNVDADGFFELLTERFARL"
FT   gene            370520..370945
FT                   /gene="hspC"
FT                   /locus_tag="Atu0375"
FT                   /old_locus_tag="AGR_C_657"
FT   CDS_pept        370520..370945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspC"
FT                   /locus_tag="Atu0375"
FT                   /old_locus_tag="AGR_C_657"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86192"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC3"
FT                   /protein_id="AAK86192.1"
FT                   /translation="MSRMTPFTHPLLLGFDAMEKTLERMAKANDGYPPYNIERLPGGED
FT                   VPERLRITIAVAGFSQDDLDVTTADNQLVIRGRQQEQEKRDFLYRGIAARQFQRVFVLA
FT                   DGMQVREARLRNGLLSIDLVRPEISNVVKKINISVSE"
FT   gene            371002..371259
FT                   /locus_tag="Atu0376"
FT                   /old_locus_tag="AGR_C_659"
FT   CDS_pept        371002..371259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0376"
FT                   /old_locus_tag="AGR_C_659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86193"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC2"
FT                   /protein_id="AAK86193.1"
FT                   /translation="MLLKEAHARLTQSQLAHIGEGEVGYIRKIRAEEVSRCFPEAPDLD
FT                   PQLDLWALFGADGTPILLTDNRSSTFFKAAEDDLKTVSLH"
FT   gene            complement(371302..371898)
FT                   /locus_tag="Atu0377"
FT                   /old_locus_tag="AGR_C_660"
FT   CDS_pept        complement(371302..371898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0377"
FT                   /old_locus_tag="AGR_C_660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86194"
FT                   /db_xref="GOA:Q7D1K6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1K6"
FT                   /protein_id="AAK86194.2"
FT                   /translation="MTMTTRKIALSALGAALVLSTAATASFAAPGKGHKDRMPIRPEAA
FT                   FVHLLKVADTNKDGKISKEEFTARQDALFTEIDMDKDGSITPKEMREYRKAKMEAFRAA
FT                   NPRPEREDAKADEAKGPEGKRAERDHGGRSGHQGWGRHGGKGGGLGMIRWADTDENGQV
FT                   SKAEFTAAGEKMFERLDRNKDGVISIDDMPDRPFL"
FT   gene            complement(372000..372713)
FT                   /locus_tag="Atu0378"
FT                   /old_locus_tag="AGR_C_662"
FT   CDS_pept        complement(372000..372713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0378"
FT                   /old_locus_tag="AGR_C_662"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86195"
FT                   /db_xref="GOA:Q7D1K5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1K5"
FT                   /protein_id="AAK86195.2"
FT                   /translation="MDTKPKNLPDAADFAHVSEWVFDLDNTLYPHHVNLFSQIDRNMTA
FT                   YVAELLKLDPEEARVLQKRYYHDHGTTLQGLMINYGISPDEFLERAHAIDYSALKPHPE
FT                   LGEAIKALPGRKFILTNGSVKHAQAAAGALGILDHFEDIFDIVAANYLPKPASATYEKF
FT                   AALAKLDTKKAAMFEDLPRNLAAPKALGMKTVLLVPSNLEGVIMERWEIPDVTDEHIDY
FT                   ITDDLTGFLAKTIAR"
FT   gene            372820..373737
FT                   /locus_tag="Atu0379"
FT                   /old_locus_tag="AGR_C_664"
FT   CDS_pept        372820..373737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0379"
FT                   /old_locus_tag="AGR_C_664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86196"
FT                   /db_xref="GOA:A9CKC1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC1"
FT                   /protein_id="AAK86196.1"
FT                   /translation="MELWIGITFASAFLQNLRSTLQKHLKGMMGTTGATFVRFVFGMPF
FT                   ALAYLAFLHLGLGRPLPVPNMSFAGWATVGAMAQIAATFLLVHLFSFRNFAVGTAYSRT
FT                   EPAQAALFALIFIGESITGGTLAAIAISVAGVMLISVARTQVTPASFLTSIFSRTAGIG
FT                   LASGAFFGLSSVAYRSASLALAPSLPAPDAMMQAGFTLVVVIVMQTVSMFLWIIWRERE
FT                   ELPRIAKVWKPSLAVGFVGATASFGWFTAMTLQQAAVVKALAQVEMLFAFASTVLFFKE
FT                   KINRLELSGCMLIVVGVLSLLAFG"
FT   gene            complement(373783..374667)
FT                   /gene="argB"
FT                   /locus_tag="Atu0380"
FT                   /old_locus_tag="AGR_C_666"
FT   CDS_pept        complement(373783..374667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="Atu0380"
FT                   /old_locus_tag="AGR_C_666"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86197"
FT                   /db_xref="GOA:Q8UIB7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIB7"
FT                   /protein_id="AAK86197.1"
FT                   /translation="MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKA
FT                   FAEDIALLKQSGINPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKTVIDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHATRLLFLTDVPGVL
FT                   DKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVLL
FT                   EIFTEGAGTLIVP"
FT   gene            complement(374715..374855)
FT                   /locus_tag="Atu0381"
FT   CDS_pept        complement(374715..374855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41403"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIB6"
FT                   /protein_id="AAL41403.1"
FT                   /translation="MGRHNKARRLFHSSKAEIRLSLQTRRHVESMHPAPQKSIPIFAPM
FT                   L"
FT   gene            375023..375400
FT                   /locus_tag="Atu0382"
FT                   /old_locus_tag="AGR_C_669"
FT   CDS_pept        375023..375400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0382"
FT                   /old_locus_tag="AGR_C_669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86198"
FT                   /db_xref="GOA:A9CKC0"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKC0"
FT                   /protein_id="AAK86198.1"
FT                   /translation="MTAPDRDKQSGLRDEVLAGEYVLGALPPESMAELTKRVKRDRQFA
FT                   AMVRRWRENLAETEYREKATMAVLLERDPARPGLPFRSQPLRGGSVFAAMFSEVWNSVR
FT                   FWRLLALTAMLWTAVLLFTIA"
FT   gene            complement(375413..376066)
FT                   /gene="cgpA"
FT                   /locus_tag="Atu0383"
FT                   /old_locus_tag="AGR_C_672"
FT   CDS_pept        complement(375413..376066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgpA"
FT                   /locus_tag="Atu0383"
FT                   /old_locus_tag="AGR_C_672"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86199"
FT                   /db_xref="GOA:Q8UIB4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIB4"
FT                   /protein_id="AAK86199.1"
FT                   /translation="MSETGTATEKPLFGRPWIFIRGVPAMKFLPPEGPPEIAFAGRSNV
FT                   GKSSLINALVGHKGLARTSNTPGRTQELNYFVPEGYSGEPGDLPPMALVDMPGYGYAQA
FT                   PKDHVDAWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEEVLSLLDKAAVSYQVVLTK
FT                   TDKIKDVGVPRLIGETLEKIRKRPAAYPEVLATSSEKSFGLDDLRAEIVRTVLL"
FT   gene            complement(376063..377862)
FT                   /gene="yidC"
FT                   /locus_tag="Atu0384"
FT                   /old_locus_tag="AGR_C_674"
FT   CDS_pept        complement(376063..377862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="Atu0384"
FT                   /old_locus_tag="AGR_C_674"
FT                   /product="preprotein translocase 60 kD membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86200"
FT                   /db_xref="GOA:Q8UIB3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIB3"
FT                   /protein_id="AAK86200.2"
FT                   /translation="MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQQ
FT                   TTQQQPAPGAAPGATVEGAPPASSTQAAATATREEAIARTQRVAIDTNAIAGSINLTGA
FT                   RFDDIRLKGYHETVDDSSPIITLFSPADTKDGYFTELGYVAAQEVGGVPGPTTVWTLAS
FT                   GDKLTETTPVTLTYTNSKGVVFSRTVSIDEHYMLSIADKVENPGQAAISFATYGRVTRN
FT                   NKPVIPPVFVIHEGFLGVSGKDGSLTEKKYKDVEEEPVTVAKATGGWLGITDKYWAAAI
FT                   VPPQTTPFETRYSHITGNQPSYQADFKSDSMTVEAGQSIELKSLVFAGAKEVPLVDRYE
FT                   TEYSVPKFDLLIDWGWFYFITKPMFKMMDFFFRYFGNFGVAILLTTIVVKALFFPLASK
FT                   QYASMANMKRMQPKMEELKAKHGDDRMAMQQAMMQLYKEEKINPVAGCWPMLLQIPVFF
FT                   ALYKVIYVTIEMRHAPFFGWIHDLSAPDPTSLFNLFGLLPYDVPHFLMIGVWPLVMGIT
FT                   MFLQMRMNPTPPDPTQAMIFTWMPLIFTFMLASFPAGLVIYWAWNNTLSISQQALIMKR
FT                   HGAKIELFDNIKGLFKRKPVQSK"
FT   gene            complement(377862..378245)
FT                   /gene="rnpA"
FT                   /locus_tag="Atu0385"
FT                   /old_locus_tag="AGR_C_677"
FT   CDS_pept        complement(377862..378245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="Atu0385"
FT                   /old_locus_tag="AGR_C_677"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86201"
FT                   /db_xref="GOA:Q8UIB2"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UIB2"
FT                   /protein_id="AAK86201.2"
FT                   /translation="MSETKKQPGRLKNRSEFLAVQAGEKRRGSTFLVEVLDRRAPETEP
FT                   RVGFTVTKRQGNAVERNRMRRRLKEAVRLSAGVAMKPGHDYVIVARRDVLDTAFPKLQS
FT                   LLIERIEGTAKPKRSQETRSRKE"
FT   gene            complement(378282..378419)
FT                   /gene="rpmH"
FT                   /locus_tag="Atu8066"
FT   CDS_pept        complement(378282..378419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="Atu8066"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW89718"
FT                   /db_xref="GOA:P68996"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68996"
FT                   /protein_id="ABW89718.1"
FT                   /translation="MSKRTFQPSKLVRKRRHGFRARMATAGGRKVLAARRARGRARLSA
FT                   "
FT   gene            complement(378461..378733)
FT                   /locus_tag="Atu0386"
FT   CDS_pept        complement(378461..378733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UIB1"
FT                   /protein_id="AAL41408.1"
FT                   /translation="MGRWHNFSRHKIYQCRVKKEFRILSVTHGNACARPAEEANLMRFS
FT                   AKGEVLKPLRQLTLLGLCPYKPRTLGHRKLAQAGLAVQKTKRCCK"
FT   gene            378771..380819
FT                   /gene="mcpA"
FT                   /locus_tag="Atu0387"
FT                   /old_locus_tag="AGR_C_678"
FT   CDS_pept        378771..380819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA"
FT                   /locus_tag="Atu0387"
FT                   /old_locus_tag="AGR_C_678"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86202"
FT                   /db_xref="GOA:Q7D1K2"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1K2"
FT                   /protein_id="AAK86202.2"
FT                   /translation="MRIRGRINLLVGLMSLVACTIGGLSIYAVSEFRVRTVEYEKAAER
FT                   AYKGEALNRLVTAVVMEARGVYAAADIEKAAPFADGIVKNLDAMEKLIATWTPLVPAEQ
FT                   KATFDNLSSRFKEFKTFRLETARLAREAGPQAANQQGNNEANRANRKAYQAEIDAVVKN
FT                   DIAELEAVKAGIDGFVTTTFWLVITVTGSGILAGAAFGLYIGARQLSAPIRRVSEVMNA
FT                   VADGNLDADVPYLGQNDEIGEMAAAVEVFKKNGREVRRMNAQETAMRAKSDDLQAGMAV
FT                   VVDAAAGGDFSRRINKDYGDDNLNRFATTINALLIGVDNGVSETSRVIEGLARGDLTEK
FT                   MDGDFRGVFAELKENVNQTLTKLRETMREVRGSTEGISGNANELRSAADDLSKRTEQQA
FT                   AALEETSAALDEITAVVRNSTDRAQEASAMVAETKQKTEESASVVRDAVSAMDRIEHAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGEEVGRGVSLVQRTGSALSEIETRVLAINEHIHSIATAAREQSTGLHEVNTA
FT                   INQMDEVTQRNAAMVEETSAATHKLSSEADHLVTLVTRFNVGTETAQRSHRIEQSLRPM
FT                   TASTGPVAVSGRTAAVSSPARKLMNSVSRALNAQPAAAPAHGDWQEF"
FT   gene            381014..382489
FT                   /locus_tag="Atu0388"
FT                   /old_locus_tag="AGR_C_680"
FT   CDS_pept        381014..382489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0388"
FT                   /old_locus_tag="AGR_C_680"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86203"
FT                   /db_xref="GOA:A9CKB9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB9"
FT                   /protein_id="AAK86203.1"
FT                   /translation="MFSKGVDSLDRTQDDPVHCMPGLTAGLSGRLLLLTVIFVMIAEVL
FT                   IFVPSVANMRLSWLRDRLNTAAAAGAVIDGLQAELPRSVQNDTLMATGAKLIALRKDGT
FT                   SRLLAVAETPPGVDEQYDLSDVSQAAAVRDAFSTLLFGGNRVIRVFDVVGDSDTIIELV
FT                   LGENKLRAAMLAYARNVFLISIVLSLVTAGLIFISINRIMIRPIRRLTLGMQNFSEDPG
FT                   NPERIFVPEEGTDELSVAGRHLADMQTELQKTLRQQKNLVDLGLAVSKINHDMRNILSS
FT                   AQLMSDRLVDAKDPMVRSFAPKLLRTIDRAVAYTGEVLAYGQATEGAPKRKIVPLSLLV
FT                   RDVRDILALDPDSGIEFHDSVPPDLTVDADSEQLFRVIHNLCRNAVQALQSDVANSAPR
FT                   HLSISAQRAGSVVSIVIDDNGPGMPRKAKENLFSAFRGSARSGGTGLGLVIARELVLAH
FT                   GGTIALVEKPGPGTQFRIEIADRAASIQAARTA"
FT   gene            382568..382669
FT                   /locus_tag="Atu8009"
FT                   /old_locus_tag="AGR_C_681"
FT   CDS_pept        382568..382669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8009"
FT                   /old_locus_tag="AGR_C_681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8009"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M4"
FT                   /protein_id="AAK86204.1"
FT                   /translation="MDGIYNIINVIRELLRKNDNFETKSLAFGMRTF"
FT   gene            382707..382783
FT                   /locus_tag="Atu0389"
FT   tRNA            382707..382783
FT                   /locus_tag="Atu0389"
FT                   /product="tRNA-Arg"
FT   gene            382964..383776
FT                   /gene="ubiE"
FT                   /locus_tag="Atu0390"
FT                   /old_locus_tag="AGR_C_683"
FT   CDS_pept        382964..383776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="Atu0390"
FT                   /old_locus_tag="AGR_C_683"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86205"
FT                   /db_xref="GOA:Q7D1K0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1K0"
FT                   /protein_id="AAK86205.2"
FT                   /translation="MLEADKVFAGSIPENYDRYMVPLIFAPFAADLARRAAALMPIDVL
FT                   EIAAGTGAVTREMIPRLLPAAHYVVTDLNQPMLDFAAAQQAPDNRIKWRQADAQLLPFE
FT                   NAVFDLVFCQFGAMFFNDRLSAYREAKRVLKPGGHYLFNVWDRIEENHFADDVTNALAG
FT                   LFPDDPPRFMARTPHGYHDTVLIRRELENAGFSRVTVETVAAQSRAPSPRIPAVAYCQG
FT                   TVLRTEIEARAPGKLNAATDCAAAAIEARHGKGEVAAKIKAHVILAAV"
FT   gene            384108..385139
FT                   /locus_tag="Atu0391"
FT                   /old_locus_tag="AGR_C_685"
FT   CDS_pept        384108..385139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0391"
FT                   /old_locus_tag="AGR_C_685"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86206"
FT                   /db_xref="GOA:Q7D1J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1J9"
FT                   /protein_id="AAK86206.2"
FT                   /translation="MSGCGKSTLLRIIAGLESPDRGSVSIGGQDVTEIDPSDRNLAMVF
FT                   QSYALYPHMSVRQNIATPLRMRRLPFAARLPLIGRFAAPAETLKQIDAAVEQAAETLQI
FT                   AHLLDRKPAQLSGGQRQRVALARALVRSPAAFLMDEPLSNLDAKLRAHMREELAGLHRR
FT                   LGATFIYVTHDQIEAMTMSDRIALMSEGRIEQLGTPDELYRKPATLTVARFIGTPSINL
FT                   LPVEIDAQGRITAFGRDLGIEGAGRDAGPATLGLRAEDLRPGEEGFTVRVVRSETHGAD
FT                   RFVSCRLLSDETVSMTLRQGADEVLGADADGMMNLGFAPERAHLFAADGLRRKVTVRER
FT                   VPA"
FT   gene            385136..386062
FT                   /locus_tag="Atu0392"
FT                   /old_locus_tag="AGR_C_686"
FT   CDS_pept        385136..386062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0392"
FT                   /old_locus_tag="AGR_C_686"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86207"
FT                   /db_xref="GOA:A9CKB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB8"
FT                   /protein_id="AAK86207.1"
FT                   /translation="MTVVDISTPLRAKSRLRPPKADRRMMWRGLMFAAPAGLLLLAIYI
FT                   VPMFVLAGFSVTDYRLGALSTRFIGLGNFVKAFQDPVFLRALANTALYAIIVIPFGVFL
FT                   ALGVALLVYNRKRSRTFWEVAYFLPVTATLVAMATVWQFLLHPSLGPVNAAIKWLGFEP
FT                   VAFLSNPVLLIPTMALMGIWQVLGFNMVLFLAGLTAISKDLHEAARLDGAKNPVDRFLT
FT                   VTWPMLGPTTMFVVVTTSISAFKVFETVAVLTKGRSGSETLLFDLYLEGFEYSNTGYAA
FT                   ALTIIFLVIVLILSIGQTLHMDRKVHY"
FT   gene            386062..386883
FT                   /locus_tag="Atu0393"
FT                   /old_locus_tag="AGR_C_688"
FT   CDS_pept        386062..386883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0393"
FT                   /old_locus_tag="AGR_C_688"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86208"
FT                   /db_xref="GOA:A9CKB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB7"
FT                   /protein_id="AAK86208.1"
FT                   /translation="MAVFRKYFPHLVLALGAFVMLLPFYWMALTSIRSPAEIFDVSLWP
FT                   IPQKFDAADNYARAAGQVPMARFMLNGVIVCVGILVVQILTSVPAAYALAKLRFPGRKL
FT                   LLGLVIAALCVPIQALALPLFVGLAKTQLLNTYFAMMMPFFLSVFAIFLFNQSFRSYPD
FT                   EIIEAARMDGFSEMEICWGLVLRGSLPSLAAFSIFSLVAHWNDLYWPMIVISDTNLAPP
FT                   PLGMMLFADVESGANYGALMAGATLITAPMVLCFLLARRHFIAGITMTGVK"
FT   gene            386926..388218
FT                   /locus_tag="Atu0394"
FT                   /old_locus_tag="AGR_C_689"
FT   CDS_pept        386926..388218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0394"
FT                   /old_locus_tag="AGR_C_689"
FT                   /product="ABC transporter, substrate binding protein
FT                   (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86209"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB6"
FT                   /protein_id="AAK86209.1"
FT                   /translation="MKLNRRAVMGGLALGMAFAGLAQPVLANEITLNVLYNLPGFTKFH
FT                   QPLADEFMKKNPDVKINFLAPAAGYNEGQQQVLRSAVTGNLPDVYFSGYNLTAELVHTL
FT                   APRNQITDLGPFIQAEGGQAFLDKNYSPKMAALGQIDGKQYGLPVNASSPIIYINSDLV
FT                   TKAGGDPDKMPTTFPELIALAKKIKALDPKFAGMSYDINGWPDDWLWQALVVEQGGKLV
FT                   DDKTKTVAFDNEIGLNALKMTRQFVTEGGQNLLDWDQSRQQFGAGLTGFIFSTPAHVQT
FT                   IQGLVGDRFKLKTATFPLDNKEKGGVPTGGNSAVILTQEKAKQDAAWKYLKWITGPEAQ
FT                   NTIVRITGYLPTNKLATGPDFLAPYYVENPNVKTASLQADRSLPWAGYPGGDSVRIWRT
FT                   QRDIIGTVMRGEVTPEAGLKQIVEQTNALLK"
FT   gene            388283..389083
FT                   /locus_tag="Atu0395"
FT                   /old_locus_tag="AGR_C_691"
FT   CDS_pept        388283..389083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0395"
FT                   /old_locus_tag="AGR_C_691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86210"
FT                   /db_xref="GOA:A9CKB5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB5"
FT                   /protein_id="AAK86210.2"
FT                   /translation="MKIIQITDTHLLPPGIAINGVDPENQLRAAVADIVEKHADADLLV
FT                   MTGDLCNYGEPEAYELLRDILAPVSIPTRLMLGNHDRRPEFVAAFPEQPRDDNGYIQSF
FT                   IDTEFGRLLFLDSHEADVIGGIYGADRLTWLENALESAGDLPITVFVHHPPMDCGIRHF
FT                   EHIGMHDDGAIMRRLAAHPAGIRHIVFGHIHVPMAGTTAEGIAYSSGQACAHRFITDID
FT                   VVDPLWTGGNPCYRVISLGAFGLRAYDAEVGQPVLGQTPVCEGP"
FT   gene            389381..390877
FT                   /locus_tag="Atu0396"
FT                   /old_locus_tag="AGR_C_695"
FT   CDS_pept        389381..390877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0396"
FT                   /old_locus_tag="AGR_C_695"
FT                   /product="coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86211"
FT                   /db_xref="GOA:Q7D1J4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1J4"
FT                   /protein_id="AAK86211.2"
FT                   /translation="MLEKRIRNASLLNRIVSAEEAASLIQDGMTVGMSGFTRAGEAKAV
FT                   PLALAERAKTNPMKITLMTGASLGNDLDKTMVEAGMLARRMPFQSDPALRKAINDGRVM
FT                   FIDQHLSETVEQLRGGQIHGVDIAIVEAVAITAEGGIVPTTSVGNSASFAILADKVIVE
FT                   INLSQPEVLEGLHDIFIPAKRPTRMPIPVVATDSRVGLPFIPVPPEKIAAIVLSDKSDS
FT                   FSTVLPPDDETKAIAGHLTEFLLNEVRHGRMTHELQPLQAGIGTIANAVMHGFIDTPFH
FT                   DLKMYSEVLQDSTFELFDAGKLTFASGSSITLSSAMNEQVMPRLSEYKSRLILRPQEVS
FT                   NHPEVIRRLGIIGINTALEFDIYGNVNSTHVGGTHMMNGIGGSGDFARNAYMSIFVTKS
FT                   IAKGGAISSVVPMVSHVDHTEHDVDILVTETGLADLRGLAPRERAAVIIANCVHPSYRD
FT                   ALTDYYQRAAARGGHTPHLIEEALSWHNALRERGTMLPQR"
FT   gene            391047..392369
FT                   /locus_tag="Atu0397"
FT                   /old_locus_tag="AGR_C_699"
FT   CDS_pept        391047..392369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0397"
FT                   /old_locus_tag="AGR_C_699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86212"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1J3"
FT                   /protein_id="AAK86212.2"
FT                   /translation="MPIRFVAVIAIVALLAGCGGRPIGVMTPTGQTVAGTTPVNLLVAT
FT                   TRAPSENAAVLFGGERGTGLKVDAVTISIPPKANRKVGQVQWPKKLPPNPLKDFTTVAV
FT                   EPIRSEAETKSWISKHIKKDRRVLVFVHGFNNRYEESVYRFAQIVYDSGSDVVPVVFTW
FT                   PSRASIFDYNYDKESTNYSRDALEEMLTRLARDKSIGEVTVMAHSMGTWLAVEALRQMA
FT                   IRNGRVDPKIGNVILAAPDLDVDVFSRQFTSLGKTPPKFTLFVSQDDRALSLSRRISGN
FT                   VDRLGQIDPSVEPYRSQLEKAGITVLDLTKLQSGDRLNHGKFAESPEVVRLIGDRLIAG
FT                   QTVTDSDVGLGEALGAVSIGAAQTVGTAASVVVSAPIAVFDPRTRENYGRQVERLGRSV
FT                   ENTVGSVGDTAGSVVDDQALQSSRVNCDAVANRNRVECRSR"
FT   gene            392498..393535
FT                   /locus_tag="Atu0398"
FT                   /old_locus_tag="AGR_C_701"
FT   CDS_pept        392498..393535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0398"
FT                   /old_locus_tag="AGR_C_701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86213"
FT                   /db_xref="GOA:A9CKB4"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKB4"
FT                   /protein_id="AAK86213.1"
FT                   /translation="MRWKRTLQLLDVHCEGEIGRVVTGGAPKIPGNTVAEQLHWMNTDP
FT                   QGEALRRFLTLEPRGTPMGSVDLLLPPKHPDAHAAFVILQPDQAHASSGSNSICATTAL
FT                   LESGMVEMQEPETVIILETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVSIDTPEW
FT                   GRVTMDISYGGIFYALVDVRQIGLTIEKANAAKLVAAGMTLKDLVNREMTVVHPEIPAI
FT                   SGVAYVMFRDVDADGSIRTCTTMWPGRADRSPCGTGNSANLATLYARGKVKVGDEYKSR
FT                   SIIGSEFDVGLSAVTEVAGRPAVIPTIAGRGFTFGLHQVGLDPFDPLGDGFAMTDVWGP
FT                   EAGNI"
FT   gene            393648..394685
FT                   /gene="pyrC"
FT                   /locus_tag="Atu0399"
FT                   /old_locus_tag="AGR_C_703"
FT   CDS_pept        393648..394685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="Atu0399"
FT                   /old_locus_tag="AGR_C_703"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86214"
FT                   /db_xref="GOA:Q8UI99"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI99"
FT                   /protein_id="AAK86214.2"
FT                   /translation="MKSLTLRRPDDWHLHLRDGAMLEGVIGDTSRHFARAIIMPNLVPP
FT                   VVTTADASAYRERILKAIPEGDRFEPLMTLYLTEDTVADDVEEGKKSGLITAVKLYPAG
FT                   ATTNSHGGVRDFNKAMPVLERMAKIGLPLCVHGEVTTPDVDIFDREKAFIDTVLEPLRQ
FT                   RLPELKVTMEHITTRDGVDYIKSSNANLAGSITTHHLIINRNAILVGGIKPHYYCLPVA
FT                   KREEHRLALRAAATSGDARFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLAHVFED
FT                   ENALDKLEAFASLNGPAWYGLAPNDETITLVKREEAVAFPEKIETGAGPVTVFDPMFPL
FT                   HWDVN"
FT   gene            394837..395535
FT                   /gene="pyrE"
FT                   /locus_tag="Atu0400"
FT                   /old_locus_tag="AGR_C_704"
FT   CDS_pept        394837..395535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="Atu0400"
FT                   /old_locus_tag="AGR_C_704"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86215"
FT                   /db_xref="GOA:Q8UI98"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI98"
FT                   /protein_id="AAK86215.2"
FT                   /translation="MNHFTFTDRTVVAELVAKMLWEIKAVHFNSESPYTFASGMKSPVY
FT                   IDMRKLISFPRIRSAAMDFAAAAVMREAGFEKFDCVAGGETAGIPFAAFLAERLGLPMI
FT                   YCRKKPKGHGRNAQIEGHMPDGARVLVIEDLTTAGGSMFTFIDAIRAAGGIVDHGIALF
FT                   YYGIFEEAEARFANGNVKLHYLTTWRDVLAVARAEKLFDEKTLSGVEAFLDNPLPWSAK
FT                   HGGVSELPQS"
FT   gene            395635..396561
FT                   /gene="scrK"
FT                   /locus_tag="Atu0401"
FT                   /old_locus_tag="AGR_C_706"
FT   CDS_pept        395635..396561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="Atu0401"
FT                   /old_locus_tag="AGR_C_706"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86216"
FT                   /db_xref="GOA:Q7D1J1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1J1"
FT                   /protein_id="AAK86216.2"
FT                   /translation="MILCCGEALIDMLPRQTTLGEAGFAPYAGGAVFNTAIALGRLGVP
FT                   SAFFTGLSDDMMGDILRETLRASKVDFSYCATLSRPTTIAFVKLVDGHATYAFYDENTA
FT                   GRMITEAELPALGADCEALHFGAISLIPEPCGSTYEALMTREHETRVISLDPNIRPGFI
FT                   QNKQSHMARIRRMAAMSDIVKFSDEDLAWFGLEGDEDTLARHWLHHGAKLVVVTRGAKG
FT                   AVGYSANLKVEVASERVEVVDTVGAGDTFDAGILASLKMQGLLTKAQVASLSEEQIRKA
FT                   LALGAKAAAVTVSRAGANPPFAHEIGL"
FT   gene            396686..397651
FT                   /locus_tag="Atu0402"
FT                   /old_locus_tag="AGR_C_708"
FT   CDS_pept        396686..397651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0402"
FT                   /old_locus_tag="AGR_C_708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86217"
FT                   /db_xref="GOA:Q7D1J0"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1J0"
FT                   /protein_id="AAK86217.2"
FT                   /translation="MSIPKTHPFDFDPTYGMQREQLLAITPPEAPPGFDDFWKKRYRRA
FT                   LATDPRPVLRRSKLTHPRWQVLDVTYTSTDGFRIGGWLLLPREGQVRRGLVVGHGYGGR
FT                   GEPDFDLPVEETAVLFPCFRGLSLSACPPISSDPTLHVLYNIDRKDDYIIGGCVDDLWV
FT                   AVSTLVSLYPWLEGQVGYSGISFGGGIGALAIPFDARIDRGHLVVPTFGHRPFWLTLPT
FT                   VGSADAVQTYQKTHAKVLETLRLFDAACAAARIKVPMLVAPALFDPAVAPPCQFAVANA
FT                   VPQSKFNEIFILDAGHFEYPDSASQDAVHKDKIRRFLKVP"
FT   gene            397648..398376
FT                   /locus_tag="Atu0403"
FT                   /old_locus_tag="AGR_C_710"
FT   CDS_pept        397648..398376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0403"
FT                   /old_locus_tag="AGR_C_710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86218"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB3"
FT                   /protein_id="AAK86218.1"
FT                   /translation="MKREYLRWYSHRLHRDMELLIFGHAGAKVLMFPTRDGRFFEYEEL
FT                   GIVASLSDKLEAGHLQLYCIEGLARESFYAGHHHPADRVRRHAALEAYILNEVLPLMAE
FT                   KNPDGSTIVQGCSLGAFQAASLVFRHPHLFTKLVAFSGRYDLTMRVESFGDLFDGYYDD
FT                   DVYFHMPSHFLPGLACPFRLEQLRRIDMVFTIGDADPFLDNNQHLSRLLSDKQVGHQMH
FT                   VWEGRAHRAGAWRKMAALYI"
FT   gene            complement(398432..400057)
FT                   /gene="pgi"
FT                   /locus_tag="Atu0404"
FT                   /old_locus_tag="AGR_C_711"
FT   CDS_pept        complement(398432..400057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="Atu0404"
FT                   /old_locus_tag="AGR_C_711"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86219"
FT                   /db_xref="GOA:Q8UI94"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI94"
FT                   /protein_id="AAK86219.1"
FT                   /translation="MQATIEKLKATASSTAATDLRAAFAADDQRFSRFSVKFDDLLMDY
FT                   SKCAVNEEIVTLLEQLAREGGVEAKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVD
FT                   DKDVMPDVNGVLAAMGKFADAIRSGSLKGATGKKITDVVNIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADTLKLLDPETSLFIIASKTFTTIETMTNAATARRFIAEKL
FT                   GEGAVKHHFAAVSTALDKVAAFGIESDRIFGFWDWVGGRYSIWSAIGLPLMIAIGPDNF
FT                   GKFLDGAHAMDRHFREAPIRENLPMLLGLIGFYNRNVLDYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGQSGPVVWGEPGTNGQHAFYQLIHQGTSVIPAEFMIAAN
FT                   GFEPELRHQHQLLIANCLAQSEALMKGRTLAEAKAQLTSKGMEDSQADFIAPHRVFTGN
FT                   RPSITFVYDKLTPFALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAGHDSSTQGLVKALAGLAG"
FT   gene            complement(400188..401900)
FT                   /gene="fadD"
FT                   /locus_tag="Atu0405"
FT                   /old_locus_tag="AGR_C_713"
FT   CDS_pept        complement(400188..401900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="Atu0405"
FT                   /old_locus_tag="AGR_C_713"
FT                   /product="long-chain-fatty-acid-CoA-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86220"
FT                   /db_xref="GOA:A9CKB2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB2"
FT                   /protein_id="AAK86220.1"
FT                   /translation="MSELSLGHPENVSVAKRWLASYPPGVPSEIPASANASLIDLLEKS
FT                   CKQFADRKAFSSMGKSLTYRELDADTRAVAAWLQSRGLEKGDRVAVMMPNILQNPVAVY
FT                   GILRAGMVVVNVNPLYTPRELEHQLKDSGAKALFVLENFAHVAQQAVPKTAVRHVVVAA
FT                   MGDLLGLKGHIVNLVVRKVKKLVPAHAIPGSISFKAMLKEGQGVSLKPVGLTAQDIAFL
FT                   QYTGGTTGVSKGAVLTHANLLANKAQISLWLDAAFNGRKDRPEVLNFICALPLYHIFAL
FT                   TVNSLMGIALGGHNLLIANPRDIPGFVKELSHYQPHIFPGLTTLFNALMNNEEFRKLDL
FT                   SSLIFVLGGGMAVQRPVAERWVSVVGCPITEGYGLSETSPVATVNRLDAAEFSGTIGLP
FT                   ISSTEIDIRDEDGNSLPTGEVGEICIRGPQVMAGYWQRPDETAKAITADGFFRSGDMGF
FT                   MDERGYTKIVDRKKDMILVSGFNVYPNEVEEVAASHPGVLECAAIGVPDEHSGETVKLF
FT                   VVKKDQSLTEAELKAFCAKNLTNYKRPKIIEFRTDLPKSNVGKILRRELRNLN"
FT   gene            402258..403307
FT                   /gene="fbpA1"
FT                   /locus_tag="Atu0406"
FT                   /old_locus_tag="AGR_C_714"
FT   CDS_pept        402258..403307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA1"
FT                   /locus_tag="Atu0406"
FT                   /old_locus_tag="AGR_C_714"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86221"
FT                   /db_xref="GOA:Q7D1I7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1I7"
FT                   /protein_id="AAK86221.2"
FT                   /translation="MAGSAALELKSVGKRFGDTDVLSDIDLSVERGEIICLVGRSGCGK
FT                   STLLRIVAGVETPDRGSVSLNGNVVAGPAAFVEPEKRNIGFVFQDYALFPHLTVEQNVM
FT                   FGLRALPKAEARRRAAEMIEHVHLQDLAKRYPHTLSGGEQQRVALARALAPQPGLLLMD
FT                   EPFSNLDRGLRDNVREETLGLLRQLGTTAIMVTHDPEEALSAGDRVVLMQRGRIVQSGT
FT                   GYEIHDNPKSRYAADFFCAFNKIEGRVKQGRVETPLGLLGDASDLPDGLAAIAYVRPNA
FT                   ISIIEDGAAREGIAGEISSRVFLGEIEQLGIAVPGLPSDLRVRTMQRTPARTKAVRFGI
FT                   DPKGVLIFT"
FT   gene            403461..404477
FT                   /gene="fbpA"
FT                   /locus_tag="Atu0407"
FT                   /old_locus_tag="AGR_C_715"
FT   CDS_pept        403461..404477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="Atu0407"
FT                   /old_locus_tag="AGR_C_715"
FT                   /product="ABC transporter, substrate binding protein
FT                   (iron)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86222"
FT                   /db_xref="GOA:A9CKB1"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB1"
FT                   /protein_id="AAK86222.2"
FT                   /translation="MTKFTRFALLASTVAFAAGTVSAAELNIYTTREPGLIQPLLESFT
FT                   ASSGVKVNTVFLKDGLAERVLSEGASSPADVLMTVDAGNLVDLAEKGVTQAVESETLTK
FT                   AVPAELRDAKGHWFALSMRARVLYAAKDLDLASFNYEDLADAKWKGKVCIRAGQHPYNT
FT                   ALFADYIAHYGAADTEKWLAGVKENLARKAGGGDRDVAKDILGGICDIGIANSYYVGLM
FT                   RSGKGGEEQVKWGDAIKVVLPTFKNGGTQVNISGAAVAKNAPNKAEAVKLLEYLVSDEA
FT                   QKIYAEANYEYPVKQGAALNEIVASFGTLKIDNKPLTEIVSHRKQASELVDKVGFDK"
FT   gene            404550..406226
FT                   /gene="fbpA3"
FT                   /locus_tag="Atu0408"
FT                   /old_locus_tag="AGR_C_717"
FT   CDS_pept        404550..406226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA3"
FT                   /locus_tag="Atu0408"
FT                   /old_locus_tag="AGR_C_717"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86223"
FT                   /db_xref="GOA:A9CKB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKB0"
FT                   /protein_id="AAK86223.1"
FT                   /translation="MNPDTIQPLPPRTRARFSSTFWWLGLSLLAVCGAMVPVLALVSQA
FT                   VQGSEGLWDHLGATVLWTALPDTAILLAGVGLLAGVVGTSAAWLVTAYDFPGRRVLEWA
FT                   LLLPLAMPTYIVAYAYLDILHPIGPVQGAIRWLLGYSSPREFRLPDIRSTVGCIVLLGF
FT                   VLFPYVYIPVRAMFLTQAGNLLEVARTLGVSRRAAFFKVAVPLARPAIAVGVSLALMEA
FT                   LNDIGASEFLGVRTLTVSVYTTWVTKSDLPGAAQIALSMLFIVVALVALERWARRKQRY
FT                   SVSAQKSRELEPLRLTGPRGWAAFTLGSLPVLIGFVGPASYLVIEAWKRFRFSGLSVRF
FT                   ADEAVNTIVFAGLATLITLILGLAVAYAMRLAPGRLSLWSYRLSTVGYAAPGTVIAIGV
FT                   LIALGGFDRFVDQTMRDWFGISTGLIFIGSGAALIYAYSARFLTIAAGGVDAGLSRIPH
FT                   SFDHASRTLGRSATQTFRQIHLPLSKASLAAAALLIFVDCVKELPATLLLRPLNFETFA
FT                   THLYGEAARGTYEEASIAALAIVVIGMLPVVLLARIGRRKG"
FT   gene            406406..408595
FT                   /locus_tag="Atu0409"
FT                   /old_locus_tag="AGR_C_718"
FT   CDS_pept        406406..408595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0409"
FT                   /old_locus_tag="AGR_C_718"
FT                   /product="ferrichrome iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86224"
FT                   /db_xref="GOA:Q7D1I4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1I4"
FT                   /protein_id="AAK86224.2"
FT                   /translation="MKNLHGMFLSRLALGTAAVVLMGPVMGHAQETTVLKQITVEGQGA
FT                   ENATGPVRGYVAKKSATGSKTETETKAIPQSVSVVGRQEMDDRGAVTKIDEVLRYTPGV
FT                   TAEPFGTDPDTDWFYIRGFQATQTGVFLDGLNLFSYGFGGFQMDAYGLERVEVLKGPAS
FT                   VLYGGANPGGIVQMVSKRAQDTPVRETEIGINNFGNAFFGFDLGDKVDAEGVWKYRVTG
FT                   KVSGGDNYTDYSEDLRGFIMPQITFEPDAQTSATLYGYFSALDQVHVGNGFLPYVGTVV
FT                   DAPFGKLDRKAFYGEPDIDNGRVYQSMVGYDVSHEFDNGWKISQNARYGHLYKHETGPY
FT                   PGGWANADANGQPILDPITNDYMLTRFGYDGLSKVDSFGVDNRIEGQFDTGAVNHSPLF
FT                   GLDYKYYRLDQVQACCGSNAIGALKPVYGSTQGTNFVYADNIVTQQQIGIYAQDQLRFG
FT                   DGWLVTLNGRYDYVDTELNNRLPAGVSRRSNDDALSGRAGLAYEFDNGLTPYVSAATFF
FT                   NPLIDTLADGTPASPEEGHQFEAGIKYEPSFFDGSITASVFKLVKDNAIVSYTAGGVTT
FT                   SGQFGQVESTGFELEAKANLDENWKALASYSYTDLDITKDANPNLIGKSPWIVPAHTAS
FT                   LWVDYAFTDETFEGLSIGGGVRYQGKSWADAANTLRVSDAAVFDAAIRYEKNDWTASVN
FT                   VANVFDKEYVKSCAGVSVCGWGDSRTITLKLSKKW"
FT   gene            408723..409586
FT                   /locus_tag="Atu0410"
FT                   /old_locus_tag="AGR_C_720"
FT   CDS_pept        408723..409586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0410"
FT                   /old_locus_tag="AGR_C_720"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86225"
FT                   /db_xref="GOA:Q7D1I3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1I3"
FT                   /protein_id="AAK86225.2"
FT                   /translation="MENEIEGFAVIGGPRSRVWNGIVADLWDVRCAPKAGGRYVGKDPR
FT                   FVFLLDMEGTDDGRFMMNRCRRDTCGSSRANRISFVPADIDVHAELSNVSFVRHLDLHF
FT                   DAGLLGARLVQGFDPHALLDPHLMFEDERLLALARLIAAECDNPDPLHDLYGESLVLAL
FT                   LTDFLKVKREPVRKRSKLAAWQLRAATDYIREHCLRSIRLEELAELTNLSQSHFSHAFK
FT                   ASTGVPPHQWQMQARIDRVKELMMRPDMALTDIAIAAGFSDQAHFSRVFRKMVGVSPSV
FT                   WQKNRQ"
FT   gene            409701..410108
FT                   /locus_tag="Atu8119"
FT                   /old_locus_tag="AGR_C_723"
FT   CDS_pept        409701..410108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8119"
FT                   /old_locus_tag="AGR_C_723"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8119"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86226"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M3"
FT                   /protein_id="AAK86226.2"
FT                   /translation="MEETIMLHQEPRAGQDPYVKDTPSLIASDKVEGTRVYGADGKHIG
FT                   SIQRIILEKRGGRVAYAVLSFGGFLGIGDDYYPLPWEKLHYDEELDGYRIDLTKEQIEN
FT                   APHFTNLDDDDLLYAKDRKVYDYYGVAPYWM"
FT   gene            complement(410201..410443)
FT                   /locus_tag="Atu8120"
FT                   /old_locus_tag="AGR_C_724"
FT   CDS_pept        complement(410201..410443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8120"
FT                   /old_locus_tag="AGR_C_724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8120"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86227"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M2"
FT                   /protein_id="AAK86227.2"
FT                   /translation="MKNERWTEPVEVNLEAKGKSVVAGPFEALTLLTEGWPRTGGLSFV
FT                   KARSACRAALDGRKSPEEARKCFTDAVSEMQKNPH"
FT   gene            complement(410761..410919)
FT                   /locus_tag="Atu0413"
FT                   /old_locus_tag="AGR_C_727"
FT   CDS_pept        complement(410761..410919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0413"
FT                   /old_locus_tag="AGR_C_727"
FT                   /product="stress induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86229"
FT                   /db_xref="GOA:Q7D1I2"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1I2"
FT                   /protein_id="AAK86229.2"
FT                   /translation="MDVIRILIAIILPPVGVFLQVGLGLQFWLNILLTLCGYVPGIIHA
FT                   IWVILRR"
FT   gene            complement(411076..411151)
FT                   /locus_tag="Atu0414"
FT   tRNA            complement(411076..411151)
FT                   /locus_tag="Atu0414"
FT                   /product="tRNA-Thr"
FT   gene            complement(411286..412248)
FT                   /locus_tag="Atu0415"
FT                   /old_locus_tag="AGR_C_729"
FT   CDS_pept        complement(411286..412248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0415"
FT                   /old_locus_tag="AGR_C_729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86230"
FT                   /db_xref="GOA:A9CKA9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA9"
FT                   /protein_id="AAK86230.2"
FT                   /translation="MLPSVLKDNLRLPVIASPLFIISHPQLTLAQCKAGVIGAFPALNA
FT                   RPESQLDEWLAMITEELAAYNRANPERPAAPFAVNQIVHMSNRRLEHDLGLCVKYKVPV
FT                   VISSLGAVPEVNAAVHSYGGIVLHDVINDRHARSAIRKGADGLIAVAAGAGGHAGTLSP
FT                   FALIQEIREWFDGPLLLAGAIANGGSILAAQAMGADMAYIGSPFIATEEARASDGYKQA
FT                   LVDAQAKDIVYSNYFTGVHGNYLKSSIVASGMDPDNLPEADPSKMDFETATGGAKAWKD
FT                   IWGAGQGIGAIKAVEPVAALVDRLAAEYEAAKGRICAKA"
FT   gene            412452..413651
FT                   /locus_tag="Atu8121"
FT                   /old_locus_tag="AGR_C_731"
FT   CDS_pept        412452..413651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8121"
FT                   /old_locus_tag="AGR_C_731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8121"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86231"
FT                   /db_xref="GOA:Q8U5M0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5M0"
FT                   /protein_id="AAK86231.2"
FT                   /translation="MAQRRIFLHSAIEQGSVVSGLETAIRNALEKSDRSNAEVRARIYQ
FT                   SSRQALEAGLRKQGIDDPQVVAQQRQRLESLIHLIENEERNRLLDRVEQQLRPPASESP
FT                   VEHDHGVDPVSQPAHHDHMAVEPELRGETRDVRPGAAAIAPETSSAGQRNGKPSKRSSS
FT                   AADASLAFRPEGAVGRRKRRGLFARLFIYVTLLAFIGFGAWWVYSSGLLLSPEQRDTSV
FT                   PNPPAQVQAEDFNGTEPAPSLSAGRGFSDDWVEVFNAERGSSGVSAGPRANVENVATPA
FT                   GKVIRVTSKSVAQDGAVSVEVPVEVMRDMAGKSSTISITLQSSSDRQTQVSVSCDFATL
FT                   GDCSRHRFTATAERADMLLNTTFERSLAPNAPGKIFINSDIDGSGRPINLYSVRILPGQ
FT                   "
FT   gene            complement(413701..414582)
FT                   /locus_tag="Atu0418"
FT                   /old_locus_tag="AGR_C_733"
FT   CDS_pept        complement(413701..414582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0418"
FT                   /old_locus_tag="AGR_C_733"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86232"
FT                   /db_xref="GOA:A9CKA8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CKA8"
FT                   /protein_id="AAK86232.1"
FT                   /translation="MGEEKKKRTVEITIGGKLRSFDIDDPVLPDWVEEKKLSAGNFPYD
FT                   KKMKREDYDATLEALQVELVKVQFWLQATGKRVMAVFEGRDAAGKGGAIFATHAYLNPR
FT                   YARVVALTKPTETERGQWYFQRYISHFPTAGEFVLFDRSWYNRAGVEPVMGFCTPDEHK
FT                   RFLKETPRLEKMLVHDDIHLFKFWLDIGRETQIERFHDRRQSPLKCWKLSDMDIAALTK
FT                   WDDYTQKRDEMLEKTHTDAAPWTVVRANDKRRARVNLIRHILLALDYEGKDRQAIGEID
FT                   DKILGSGPDFLK"
FT   gene            414781..416082
FT                   /locus_tag="Atu0419"
FT                   /old_locus_tag="AGR_C_736"
FT   CDS_pept        414781..416082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0419"
FT                   /old_locus_tag="AGR_C_736"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86233"
FT                   /db_xref="GOA:Q7D1H9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1H9"
FT                   /protein_id="AAK86233.1"
FT                   /translation="MLSDESGEQAEMAVREGESGLRLLGKKLGRNWLPVLIVSMLAVVA
FT                   VTELHTPYMPAALWLCAIIAILAVREKPAAPEKDKETAADVDEPDVPGENVISGVRAGL
FT                   AVLDTPVFILDKNASVLFQNGAAERAFGQLPAGAHISARLRSPGLLDVIRETITTGQPN
FT                   QVEHSERFPSERVFIVRIARADVGEGASPPFYILSFRDVSELRRIDRMRSDFVANASHE
FT                   LRTPLASLRGFIETMQGPARNDPKAQERFLAIMLDQATRMSRLVDDLMSLSRLELRANI
FT                   APDQKVDLVPVIGHVRDALLPLADELDVTITLHLPDRPAEVQGDRDELVQVFQNLVENA
FT                   CKYGQEGKVVDVWLRAEPGKPVEVSIIDKGPGIPAEHVPRLTERFYRVSVADSRSKKGT
FT                   GLGLAIVKHILTRHRARLIIKSEMGSGTDFTVRF"
FT   gene            416278..417312
FT                   /locus_tag="Atu0420"
FT                   /old_locus_tag="AGR_C_738"
FT   CDS_pept        416278..417312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0420"
FT                   /old_locus_tag="AGR_C_738"
FT                   /product="ABC transporter, substrate binding protein
FT                   (phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86234"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA7"
FT                   /protein_id="AAK86234.1"
FT                   /translation="MNFVKFSAAALVASVAFAGAAAARDQIQVAGSSTVLPYAKIVAET
FT                   FAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIANASRPIKSDELAACKAAGVADV
FT                   QEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKDGKLVANPYKKWSEINKELPD
FT                   VAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALITDAKQAAAKCVAVRKDGAA
FT                   VDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVATVSGVVPSTETVASGKYPVS
FT                   RPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYGLVAAPDKEREEIRSKFAA
FT                   GASM"
FT   gene            417601..419085
FT                   /gene="pstC"
FT                   /locus_tag="Atu0421"
FT                   /old_locus_tag="AGR_C_740"
FT   CDS_pept        417601..419085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="Atu0421"
FT                   /old_locus_tag="AGR_C_740"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86235"
FT                   /db_xref="GOA:A9CKA6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA6"
FT                   /protein_id="AAK86235.2"
FT                   /translation="MNTSILLLILALIGIGSYLLGRRRAVVLSGGRPSSMHSRAGYHGS
FT                   YAVVWAVLPAAFILCAWLVISPLLVTSAVRGDFPEDVRAQSEAQQSLTYGMVTSIARGL
FT                   QRLAPEETAQVEADTAAVRPLLASKGVAIAGEPQRFMVDAAQTLNAMTSTSRLGMIATV
FT                   LLVAFAGAAYALRSIAPRFRARNRVERVILAALVVASSIAILTTIGIVLSMLTEAIQFF
FT                   TMVPAHQFFFGTVWDPRFAAAGATDSSGQFGLIPLLAGTLYIGFVAMLVAVPVGLFSAI
FT                   YMSEYATPRLRSVVKPLLEVLAGIPTIVYGFFALTTVGPFLRDISTQINGLATGNYANF
FT                   IQAQSVITAGFVMGIMLIPYVSSLSDDIITAVPRSLRDGSLGLGATRSETIKKVIVPAA
FT                   LPGIVGAVLMTASRAIGETMIVVLAAGVAARLQLNPFEPMTTVTVKIVSQLTGDLEFTS
FT                   PQTLVAFALGITLFAITLCLNIYALYIVRKYREQYE"
FT   gene            419082..420404
FT                   /gene="pstA"
FT                   /locus_tag="Atu0422"
FT                   /old_locus_tag="AGR_C_741"
FT   CDS_pept        419082..420404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="Atu0422"
FT                   /old_locus_tag="AGR_C_741"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86236"
FT                   /db_xref="GOA:A9CKA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA5"
FT                   /protein_id="AAK86236.1"
FT                   /translation="MTDIVSPAAGGSAVNKATRRDIGIKRRYAAERRFRAYGMAAISFG
FT                   LLFLFLLLFSVVSKGYTAFQQTMITVPVEFSEQIIDPKNERATNPAKLMTANYPVVARD
FT                   AVAKVLGIAPTDRAGLRAVNLLISDSVRTQLRDIVVADPAVIGTTRTVTLLASGDVDSA
FT                   FKGQVDLTADEANRRISNQQLGWMNQLAESGQLGKHFNTGIFINGASSRPEAAGVGVAL
FT                   IGSFYMMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFMGFPRSASLVGGLVLTLMTLPTIIIATRAALKAVPPSIRAAALGLGASKMQTIF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANYPTTPMDPSTALPVQIYMW
FT                   ANEAERAFVERTSGAIIILLLFLIVMNVGAILLRRRFERRW"
FT   gene            420419..421234
FT                   /gene="pstB"
FT                   /locus_tag="Atu0423"
FT                   /old_locus_tag="AGR_C_743"
FT   CDS_pept        420419..421234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="Atu0423"
FT                   /old_locus_tag="AGR_C_743"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86237"
FT                   /db_xref="GOA:Q8UI76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI76"
FT                   /protein_id="AAK86237.1"
FT                   /translation="MNMLSEAAVEKALDKKMNEVSYKMIGKDVSVYYGEKRALYDVNLN
FT                   VRENTVTALIGPSGCGKSTFLRTLNRMNDTIDGCRVTGKITLDTDDIYDQQIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENIAYGPRIHGLARNKADMDQIVEHSLQKAGLWNEVKDRLLE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRTNYTIVIV
FT                   THSMQQAARVSQRTAMFHLGHLVEENETDKMFTNPDDQRTQDYIMGRFG"
FT   gene            421331..422056
FT                   /gene="phoU"
FT                   /locus_tag="Atu0424"
FT                   /old_locus_tag="AGR_C_744"
FT   CDS_pept        421331..422056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="Atu0424"
FT                   /old_locus_tag="AGR_C_744"
FT                   /product="phosphate transport system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86238"
FT                   /db_xref="GOA:A9CKA4"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA4"
FT                   /protein_id="AAK86238.1"
FT                   /translation="MTQTTTHSHILSAYDDELKFLTRRIAEMGGLAEQMCGDAVRALVN
FT                   SDAALAQKVISDDTILDHAEREIGDKAIVTIARRQPMAADLREIIGTLRIAADLERVGD
FT                   LGKNTAKRVIAVAGTGVPRKLARGIEHLSELALVQLKEVLDVYSTRSAEKANAIRERDE
FT                   EIDAMYTSLFRELLTYMMEDPRNITTCTHLLFCAKNIERIGDHATNIAETIYYMATGSQ
FT                   PEGERPKDDSSNTLGSVTE"
FT   gene            422089..422772
FT                   /gene="phoB"
FT                   /locus_tag="Atu0425"
FT                   /old_locus_tag="AGR_C_746"
FT   CDS_pept        422089..422772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="Atu0425"
FT                   /old_locus_tag="AGR_C_746"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86239"
FT                   /db_xref="GOA:A9CKA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA3"
FT                   /protein_id="AAK86239.1"
FT                   /translation="MVPKIAVVEDEEALSVLLRYNLEAEGYDVDTIPRGDEAEIRLQER
FT                   IPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLATGADDYVV
FT                   KPFSTPELMARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEFRLL
FT                   EFLMTSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSHMQDVIRTVRGAG
FT                   YSMEA"
FT   gene            423109..423690
FT                   /locus_tag="Atu0426"
FT   CDS_pept        423109..423690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41446"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI73"
FT                   /protein_id="AAL41446.1"
FT                   /translation="MELAIGRRFQRFTTAEMEIIFQGVADRPLAGALRQFRQRQATGNR
FT                   GDDVSGRNVIENFCSLDADLFLKSRCRVGTRQDPGRCRADTTGEIRRARGRGGGALGRG
FT                   TRRSDRTAGLDASRQIETVNLADNGITADTAQLRCYLAGAKSLGPQFLEFLDSLVCPVH
FT                   AASPLFACIVGRIPLRPAGVPQAWFPPDFR"
FT   gene            423750..423998
FT                   /locus_tag="Atu0427"
FT                   /old_locus_tag="AGR_C_751"
FT   CDS_pept        423750..423998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0427"
FT                   /old_locus_tag="AGR_C_751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86240"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1H3"
FT                   /protein_id="AAK86240.1"
FT                   /translation="MARVGGIIWNRFSGFPQLAGELSLKGNTLGLESFHLLLLETPGKC
FT                   GLLLTSAGELTIVPVPPQGGIFDFQARDNPQSLLTTV"
FT   gene            424029..425228
FT                   /gene="argD"
FT                   /locus_tag="Atu0428"
FT                   /old_locus_tag="AGR_C_752"
FT   CDS_pept        424029..425228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="Atu0428"
FT                   /old_locus_tag="AGR_C_752"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86241"
FT                   /db_xref="GOA:Q8UI71"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI71"
FT                   /protein_id="AAK86241.1"
FT                   /translation="MAEAAAPLFDTFARAPLRFERGEGVWLFTESGERYLDFAAGVAVN
FT                   SLGHAHPHLVEAIKTQAEKVWHVSNLYEVPGQEKLAKRLTEATFADKVFFTNSGAEALE
FT                   CAIKTARRYHYSKGHPEKFRIITFEGAFHGRTLATIAAGGQQKYLEGFGPKVEGFDQVP
FT                   FGDVDALKAAITAETAALLIEPIQGEGGIRAPAKEFLQLLRSLCDEHDLLLIFDEVQTG
FT                   VGRTGKFFAYEQTGVAPDIMAVAKGIGGGFPLGACLATADAASGMTAGVHGTTYGGNPL
FT                   AMAVGNAVLDVVLADGFLEKVRDVALVFRQGLASLKDRYPDVIEEIRGEGLLLGIKARV
FT                   PSGELLQAMRAEHLLGVPAGDNVIRLLPPLVTTAEEAREGLARVEAAAASLTAKQAKIA
FT                   "
FT   gene            425285..426202
FT                   /gene="argF"
FT                   /locus_tag="Atu0429"
FT                   /old_locus_tag="AGR_C_755"
FT   CDS_pept        425285..426202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="Atu0429"
FT                   /old_locus_tag="AGR_C_755"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86242"
FT                   /db_xref="GOA:Q8UI70"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI70"
FT                   /protein_id="AAK86242.1"
FT                   /translation="MASPKHFLDLSAVGPQDLRTILDDARARKVATKAGTAEKPLAGKM
FT                   LAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMI
FT                   RTTDHSRLLELAEHATVPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGDGNN
FT                   VLHSFVEGSARFGYRMTMAVPMGSEPHDKFMNWARNNGGEIALYHDADKAVAGADCVVT
FT                   DTWVSMNQEHKARGHNIFQPYQVNEALMAKAQKDALFMHCLPAHRGEEVTDAVIDGPQS
FT                   VVFDEAENRLHAQKSVIAWCMGVI"
FT   gene            426439..427428
FT                   /gene="hslO"
FT                   /locus_tag="Atu0430"
FT                   /old_locus_tag="AGR_C_757"
FT   CDS_pept        426439..427428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="Atu0430"
FT                   /old_locus_tag="AGR_C_757"
FT                   /product="chaperonin (heat shock protein hsp33)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86243"
FT                   /db_xref="GOA:Q7D1H2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1H2"
FT                   /protein_id="AAK86243.2"
FT                   /translation="MADVTVELDDLNFAGDDKVVPFQVEGLDVRGRGVQVGPLLNAILE
FT                   RHDYPAVVARLLAEATVLTALIGTSLKFSGKLTVQTKGDGPVDLLVADFSAPDSMRAYA
FT                   RFDEERLAEAVAAGETSPEQLLGNGILAFTIDQGAGMQPYQGIVPLDGSSLEDIAGVYF
FT                   RQSEQLPTRVRLGVAEFFDRDSEGKPRHGWRAGGLIAQFLPQAPERLRMRDLHGGDGDE
FT                   GGHEVQEDDAWTEAVTLLNTIDTDELTDPQVPVERLLYRLFHESGVRIYDPQAIFDRCS
FT                   CSRDKIKGVLSGFTAEEIKASEEDGAIAVTCEFCSTTYRYDVSEFENA"
FT   gene            complement(427501..427893)
FT                   /gene="apaG"
FT                   /locus_tag="Atu0431"
FT                   /old_locus_tag="AGR_C_759"
FT   CDS_pept        complement(427501..427893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="Atu0431"
FT                   /old_locus_tag="AGR_C_759"
FT                   /product="apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86244"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI68"
FT                   /protein_id="AAK86244.2"
FT                   /translation="MYRALTRDIEVTVDPYYLEEQSDPDDDRYVWGYKVVIANNSDVPV
FT                   KLVNRYWHITDQNGQVDEVYGPGVVGEQPQLKPGDSYEYSSGCPLDTPSGLMFGHYEME
FT                   TENGEVFNVTIPAFSLDSPGLMRVLN"
FT   gene            complement(428128..429312)
FT                   /locus_tag="Atu0432"
FT                   /old_locus_tag="AGR_C_761"
FT   CDS_pept        complement(428128..429312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0432"
FT                   /old_locus_tag="AGR_C_761"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86245"
FT                   /db_xref="GOA:A9CKA2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA2"
FT                   /protein_id="AAK86245.1"
FT                   /translation="MSNKWRPATQLVHGGTLRSPYGETSEAIYLTQGFVYENSEAAEAR
FT                   FKGETDGFIYARYASPTNDMFEKRMCLLEGAEDARALASGMAAVTAAIMCQLRAGDHIV
FT                   AARALFGSCRWVVETLAPKYGIECTLIDGRDLDNWEKAIQPNTKLFFLESPTNPTLEVV
FT                   DIAGVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVILS
FT                   DKKWIEEELQDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTENAAKIADFLADSGKV
FT                   AKVIYPGRADHPQADIIARQMSGGSTLVAFELKGGKDAAFKLQNALEIVKISNNLGDAK
FT                   SLITHPGTTTHKNLSDEARAELGISGGTLRLSCGIEDTDDLLEDLAKGLAAVSA"
FT   misc_feature    complement(429356..429434)
FT                   /note="SAM riboswitch (alpha-proteobacteria); predicted by
FT                   RFAM"
FT   gene            429508..430620
FT                   /gene="dcd"
FT                   /locus_tag="Atu0434"
FT                   /old_locus_tag="AGR_C_764"
FT   CDS_pept        429508..430620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="Atu0434"
FT                   /old_locus_tag="AGR_C_764"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86246"
FT                   /db_xref="GOA:A9CKA1"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="PDB:2R9Q"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA1"
FT                   /protein_id="AAK86246.1"
FT                   /translation="MTRTTGTRTTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDL
FT                   RLGSKAYRVRASFMPGPGTRVIDKLNRFSLHEVDLSQGAVLETGCVYIVPLMESLALPA
FT                   DMSASANPKSSTGRLDIFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRL
FT                   SQIRFRIGHALLNESEVLKLHETETLVASENPNVTGGGIALSIDLKGFGENGLIGYRGK
FT                   HHTAVVDVDKKAQHDVLDFWEPLFARGRAELILDPDEFYILVSREAVHVPPLYAAEMTP
FT                   FDPLVGEFRVHYAGFFDPGFGHAQAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHM
FT                   LEKPEGLYGTGLGSNYQAQGLKLSKHFRAE"
FT   gene            430677..430750
FT                   /locus_tag="Atu0435"
FT   tRNA            430677..430750
FT                   /locus_tag="Atu0435"
FT                   /product="tRNA-Gly"
FT   gene            430993..433149
FT                   /locus_tag="Atu0436"
FT                   /old_locus_tag="AGR_C_765"
FT   CDS_pept        430993..433149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0436"
FT                   /old_locus_tag="AGR_C_765"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86247"
FT                   /db_xref="GOA:A9CKA0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A9CKA0"
FT                   /protein_id="AAK86247.1"
FT                   /translation="MQRLESDVAEIIYGDQHVSMAQRQLVEVFGAGNVPGTLYLGYPIL
FT                   LNAQGNVKVDALYVSPFHGVWAFDLEHGNNDPGKQEEFEEIESSTERLYNALHSKLLED
FT                   DGLVKRSKLQVPVNVITLSVDQSFDDEYVRFLTIDQVNSALQQGVEIPRAYYERLCSVI
FT                   ERTATIRPKKQRAAVSKTGSRGAIIKEIEKKIANLDAFQKKAAIEIPSGVQRIRGLAGS
FT                   GKTIVLALKAAFLHTKNPDWQIVITFQTRTLYQQFRRLVRQFCFEFSKSEPDWSKLLVM
FT                   HAWGGATTPGLYTSFAEAASLKKMTFSEASSKYGQNGAFRGACSELLQASKAGGEIRPI
FT                   YDVILIDEAQDFPAEFFELVFLYTKDPKRIVYAYDELQNLSDFDMLPAESLFGVRPDGT
FT                   PNVELRNEPGRARSDIVLPICYRNSPWNLTAAHGLGFGTAREQAPNEPSNLIQLFDGSE
FT                   LWTDIGYSIVQGPLTAGSHVRLRRDEASTPAFFSELLSPEESLRFIQFDTLGDEVEWVA
FT                   NQIASNVNEDELELDDILVVIPDPYTSRSIGGKLIKSLGARGIGGHLVGVTSSLDEVFT
FT                   SNSVAITSIYRAKGNEAPFVYVLGAESCSQGFGLARKRNMLFTAMTRSRAWVRVTGTGP
FT                   SMANLIAEFNRIRQSNFELNFIYPTQEDLKKIRLLHRDRPQDEIDGLRQDQAAVERILL
FT                   LLKSGQISASSLSPEIQAVFRNIQ"
FT   gene            433149..433829
FT                   /locus_tag="Atu0437"
FT                   /old_locus_tag="AGR_C_766"
FT   CDS_pept        433149..433829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0437"
FT                   /old_locus_tag="AGR_C_766"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86248"
FT                   /db_xref="InterPro:IPR018742"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK99"
FT                   /protein_id="AAK86248.1"
FT                   /translation="MNHLALTSYLGTLAEVGFVNEFRQVVPTRTTNITTIEVGDTSKIS
FT                   GDETGADIAEGSTIHYLACLRQAKYSCILFDGSLVQLKYSTCEGRITNHRYLYFPCPAK
FT                   LDLRSTADETIYDIVDDACLAGALDAPRLGFMRFDFEPPKREQDRRPPGEHPDAHIHIG
FT                   IGSCRIPLVSPISVDEFFSFLLKFYYAEFWDHQVHGQSRFREPRTILPLEQGFFHFGWI
FT                   RPTP"
FT   gene            complement(433831..434859)
FT                   /gene="intD"
FT                   /locus_tag="Atu0438"
FT                   /old_locus_tag="AGR_C_767"
FT   CDS_pept        complement(433831..434859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intD"
FT                   /locus_tag="Atu0438"
FT                   /old_locus_tag="AGR_C_767"
FT                   /product="phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86249"
FT                   /db_xref="GOA:Q7D1G6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1G6"
FT                   /protein_id="AAK86249.2"
FT                   /translation="MVTVELKGIHTVKAKGNVYYYAWRGGPRLDGHPGTAAFMASYNEA
FT                   IANRMEPESGRFRSIITHYKATEFKKLADSTKRVWSPWIDRISEHFGNLSIAQFNRTDK
FT                   IRPRIRQWRGQYSDTPRAADTGMQVLSRILSHGVDPMGKLSANPAEGIKHLYSSDRSEI
FT                   IWTDADIAQVKAECSDEVKWVIDLAAHTGLRVSDLLKLSWSHVGPDAIIISTGKSRHKR
FT                   EAIIPRYDALNEILERIPKRSPVILTSSKKKPWKPSGLNTMFWRAKEKAKMLERDLHFH
FT                   DLRGTAATKFYNAGLSVRVIAEIMAWEEETVGKIIRRYVGRNSATLEHINMLNSKSKDK
FT                   SG"
FT   gene            complement(435142..436047)
FT                   /locus_tag="Atu8122"
FT                   /old_locus_tag="AGR_C_768"
FT   CDS_pept        complement(435142..436047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8122"
FT                   /old_locus_tag="AGR_C_768"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8122"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86250"
FT                   /db_xref="InterPro:IPR019276"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5L9"
FT                   /protein_id="AAK86250.1"
FT                   /translation="MDQLTQTAVAEIAKLAALTNAAIVQVPAPADAKGIPSTVPALLDP
FT                   TSGRLADVSAIFAPWRTRPERKQGTAYAETLESFVQLVERHQTENSVIFAVTDWRDPTF
FT                   TAVIDYHGDDPDNGKHRVHYAFPLSEEWKAWQSINGKALTQNEFAEFIEDHIAELASPD
FT                   SDEVKDLELLFKAKVAYPNELVVLSQGLQINAETRVKTAVKLQTGESQIVFEEDHKNAN
FT                   GDPITVPGVFVLNIAPFFQGESIRLPVRLRYRLREGKLSWTCMLYRPDTHITKAVTFAL
FT                   HETAAELGLPKFAGKPEMSA"
FT   gene            complement(437097..437330)
FT                   /locus_tag="Atu8123"
FT                   /old_locus_tag="AGR_C_776"
FT   CDS_pept        complement(437097..437330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8123"
FT                   /old_locus_tag="AGR_C_776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8123"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5L5"
FT                   /protein_id="AAK86254.1"
FT                   /translation="MRKKARPTQSGDTGMRINTVNDTELTQAMADAIQRVGEGCTKADL
FT                   REWFTADEIHRCGDAAIARFHDMRVQDAREAA"
FT   gene            complement(437495..437917)
FT                   /locus_tag="Atu8124"
FT                   /old_locus_tag="AGR_C_779"
FT   CDS_pept        complement(437495..437917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8124"
FT                   /old_locus_tag="AGR_C_779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8124"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86255"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5L4"
FT                   /protein_id="AAK86255.2"
FT                   /translation="MLAMFKSLVGDKAKKFSGKTDFLEAVCAASALVATADGELDDKEL
FT                   LAAVAAVKSNAALSGAFDARAIETTMDKMCSRAVGRVGKAGLFKEIEDIKADHDMSETV
FT                   LLVALDVADSGGISDDEKAVLAKIASTVELDLAKYL"
FT   gene            complement(438416..439111)
FT                   /locus_tag="Atu0443"
FT                   /old_locus_tag="AGR_C_784"
FT   CDS_pept        complement(438416..439111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0443"
FT                   /old_locus_tag="AGR_C_784"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86257"
FT                   /db_xref="GOA:A9CK98"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK98"
FT                   /protein_id="AAK86257.1"
FT                   /translation="MDHIELRKKIGQAIRTARIRRGLVMRDLAEAGGVSTGAVGNWERG
FT                   ANAIAMEHLQAISQKLRIDPVALSNGSLRYLDEEEALADAEQVTDFGPAPTGPMDVEVL
FT                   GVAVGGDDGDFTLNGEVSGYVRRPPGIAHLRKVFALHVLSDSMIPRYDPGELIYVGGRE
FT                   AVAGDHVVIEMFPDEGATVGKAYVKKLKGRTKGAIVCEQYNPPKELQFDQYAIKNMWRI
FT                   IPLRELLGY"
FT   gene            439119..439418
FT                   /locus_tag="Atu0444"
FT                   /old_locus_tag="AGR_C_785"
FT   CDS_pept        439119..439418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0444"
FT                   /old_locus_tag="AGR_C_785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86258"
FT                   /db_xref="GOA:Q7D1G4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1G4"
FT                   /protein_id="AAK86258.1"
FT                   /translation="MKGELSSFVHLSIACIDFKAVLLIALMETNLNQNGLIAVKGAAGG
FT                   ASAIARAIGVTPQAVAQWKAIPPEHVLKLEKAFGVSRHIQRADVFGPAELEAAE"
FT   gene            439628..440125
FT                   /locus_tag="Atu0445"
FT                   /old_locus_tag="AGR_C_787"
FT   CDS_pept        439628..440125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0445"
FT                   /old_locus_tag="AGR_C_787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86260"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK97"
FT                   /protein_id="AAK86260.1"
FT                   /translation="MISNAWFHRIKAAQRDLIRLVGGIERAAEISSISKSHIGRMNNAT
FT                   DPELMPLHAVYALESECGVPVVTSAMAELNGRRLADPENERAAEQCVVVTYSEMVRKAG
FT                   DLISGGAVAIADMVVTPAEATKMDRDAAELGAGLAAFRKALASVKAKGGHKVGLSVVGG
FT                   AE"
FT   gene            440613..441758
FT                   /locus_tag="Atu0446"
FT                   /old_locus_tag="AGR_C_790"
FT   CDS_pept        440613..441758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0446"
FT                   /old_locus_tag="AGR_C_790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86261"
FT                   /db_xref="GOA:Q7D1G2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1G2"
FT                   /protein_id="AAK86261.2"
FT                   /translation="MPERETETAVVPVVDASGLVATVERARALLDEGDVMNARIVASVA
FT                   YNQAKTAAQFAEQIGATEKLVAKARRMQADALLIEARAKILIADKWDEAKAAGTASSGG
FT                   RPKTTSDGSGFFVADTGLSSKELVEARKLAAAEHREPGIVERAIQARLAAGLEPTKANL
FT                   RAAVGTASATKEERGANLYETPPEAMFTLLALEEFSACVLEPACGRGAISRMLEAFHYG
FT                   VVLADINDYGTADSNGELQAVQDFLTSQPDEPGSYDIVTNPPYGDVLNAFVAHALRIYQ
FT                   PRKMALLLNLNFLCGFADDDRNFVMDDCPPARVYVFKRRLPMMHRDGWEGNKASSRMNT
FT                   AWFVWERDESGNYGSATVVRRVDWKDFQPQETAVTAESEAA"
FT   gene            441917..442468
FT                   /locus_tag="Atu8082"
FT                   /old_locus_tag="AGR_C_792"
FT   CDS_pept        441917..442468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8082"
FT                   /old_locus_tag="AGR_C_792"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8082"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5L1"
FT                   /protein_id="AAK86262.1"
FT                   /translation="MNKLVDPARAREQKAVDRLRYLSARIDGDVWAFEPRGNNIAVIAR
FT                   RSTGDEALICTLHADALPDERDLICGAAENLAFLLGLIGRASDAVRNLKKQLEAQQTAA
FT                   VRKKYAAQAAILLSDRTFQRFLEIKGAGGPVRDKAQAHTRLKSILAISSKKEIDNDPRA
FT                   QAAFLHFRKDFEAWKRGSSR"
FT   gene            442525..443106
FT                   /locus_tag="Atu0447"
FT                   /old_locus_tag="AGR_C_793"
FT   CDS_pept        442525..443106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0447"
FT                   /old_locus_tag="AGR_C_793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86263"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK96"
FT                   /protein_id="AAK86263.2"
FT                   /translation="MQITCACCGAVAYFPHQTGVNRKPPIAATQHFQNKGWVVGGNPRK
FT                   DFCPIHAAPAKRKGQKAMVDTVATIADKPREMSREDRRIINDKLDEVYAKDAYKSPWTD
FT                   SAVAKDLGVPRDWVAQVRDQFFGPAGSNPLYDEFLKETKLVEGAFLACEEATARAEKAA
FT                   ADQRRAHGDLCKAMDSYRVLARKVEREISR"
FT   gene            443103..443396
FT                   /locus_tag="Atu0448"
FT                   /old_locus_tag="AGR_C_795"
FT   CDS_pept        443103..443396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0448"
FT                   /old_locus_tag="AGR_C_795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86264"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK95"
FT                   /protein_id="AAK86264.1"
FT                   /translation="MTDLMPIVEILADCQTDAARADWLLRAPQGVIYRDHTTIRRVLQE
FT                   AHFTLGVDALDVEFAAINATRLPDGGLPHTVVLGVHAVRSFLRDVVRKGGAQ"
FT   gene            443396..444616
FT                   /locus_tag="Atu0449"
FT                   /old_locus_tag="AGR_C_796"
FT   CDS_pept        443396..444616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0449"
FT                   /old_locus_tag="AGR_C_796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1F9"
FT                   /protein_id="AAK86265.2"
FT                   /translation="MEPDHGAMSRAWSWRHAVGKSGLPPITRLVLHTLGLKMDATGGSC
FT                   YPPISELVDLTGLDKKTVLKHLEIAEESGWIVVTQHGFRGQKWKRNEYVARWPGRDLSG
FT                   NAASTEDNEGGGNPPPRSVAKAVEIVPEGGGNDDRKVVEEFHQDKNLPTNIPENSPAAG
FT                   AEEGVLKKVDRKKIEHAFTLWFAMWKKGDVEYARNAWFALSPEDRTECVERTPAYLRWA
FT                   KPADLMAAAVYLKNRHWRDLPEHVLAEPINAHGIAKVCGKLWMGTRFEALSKEPTGLLY
FT                   VTSFDETRIAKGMISREQLMFEKRRDNGWPLVNTMRDLARRREPFNTSLSLLPLVQGFR
FT                   QVHRDSDVFAAWKHLHERNGWPFIEHPPEWVYFPPVDDGADDLEAAVDAALSKFLSTIS
FT                   EGRNNDA"
FT   gene            444726..445292
FT                   /gene="nusG"
FT                   /locus_tag="Atu0450"
FT                   /old_locus_tag="AGR_C_797"
FT   CDS_pept        444726..445292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="Atu0450"
FT                   /old_locus_tag="AGR_C_797"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86266"
FT                   /db_xref="GOA:Q7D1F8"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1F8"
FT                   /protein_id="AAK86266.2"
FT                   /translation="MLSMAAENQPGKHEWFVVETKHKAEKAVEDALRKAGVKVFLPLET
FT                   IGETVVRGRIIPAVSRPLLPGYVLVNIVYSPAAVCGIARLEGVAGFVGGMVHPHRVSDE
FT                   EMNRFKAFGDDETAPDVKHCEQFKRGDKVRFVLGPFASFGGNILKLRKDRAVDGERVAT
FT                   GAVVAVDVFGKVSTIEAPLALLEQL"
FT   gene            445537..446106
FT                   /locus_tag="Atu8125"
FT                   /old_locus_tag="AGR_C_798"
FT   CDS_pept        445537..446106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8125"
FT                   /old_locus_tag="AGR_C_798"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8125"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5L0"
FT                   /protein_id="AAK86267.1"
FT                   /translation="MAVLSMKWADRNLAEYGDRIAELKRRFPTVLPRIVNQVGNRTKTV
FT                   VIRELTKQTGLPRATIVKAIGNPATAKPGRFVYDMTTRGGNIRLKYLRPKETEAGVVAR
FT                   PFGKPMLYPGAFLRGGQFPDRKLVAQFNGHAYYRLNRSGTKITFARSGVFIPKEMTSGA
FT                   TAAAFQRIAAPLLKERVEAALAKLVP"
FT   gene            446189..447001
FT                   /locus_tag="Atu8083"
FT                   /old_locus_tag="AGR_C_800"
FT   CDS_pept        446189..447001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8083"
FT                   /old_locus_tag="AGR_C_800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8083"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86268"
FT                   /db_xref="GOA:Q8U5K9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K9"
FT                   /protein_id="AAK86268.2"
FT                   /translation="MGDCGISLCEENYRGVPPPFQWNRNQMAKSYPDELREQVVAFMDE
FT                   GHTVREAAAKFNVSPSFAAKSHKKHAEAGESLPLLNETAPAEPEKPSLDIEITASELAE
FT                   LLKVSKRAVSDFVERGIVVKTERNRFDLRQSIQLYCEHLRGVAAGRGGDGADVLTAERA
FT                   RLAREQADQTAMKNAAMRGELISMTDVRNEWVSIGRRIRNAVLSVPSRCRQMLPHLTTY
FT                   DVDLIGEEIRSALTELGDEDDDNGAGDIAASGMGQPVAAAETSAVGLD"
FT   gene            complement(447142..447747)
FT                   /locus_tag="Atu0452"
FT   CDS_pept        complement(447142..447747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI48"
FT                   /protein_id="AAL41471.1"
FT                   /translation="MTICGRSGAALPFDMNDKRTVSPKAPPTFRSTAASSFRQSTILLM
FT                   QDEVAGRRRIGGDGGGVTDLGICASIIGGGQLGTIPIKDCAFGPCLRVRLGQGENARAG
FT                   NIDALTSLGGKLRYAEQLANKNAVAGIDIGGRGDFHRVGGASIVFHGDLPCDQRDEERE
FT                   SRAAPPTKSGRRLTLGRGCDSRSGNRSHRNRSRVPPTC"
FT   gene            448012..448758
FT                   /locus_tag="Atu0453"
FT                   /old_locus_tag="AGR_C_807"
FT   CDS_pept        448012..448758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0453"
FT                   /old_locus_tag="AGR_C_807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86271"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK94"
FT                   /protein_id="AAK86271.1"
FT                   /translation="MSFIRFAARICAVEAIKGNTVVGSNVLDSEIGVLDIAADGSLRTD
FT                   KDKPFISVYTDGSKLIEGLELRSLASPGQLDIVFEAGVTTAHAVTDTETDESVILGMPA
FT                   TDATFEFHLDMALRQTGDALNDSENEWAEIFRSLCSSFQSASRSRISGDTNGVRLAAHQ
FT                   LKITANMVAEPLCGQPLNPGSPFAKFVAKCESDLAPNDPSMAEKIALIRAQLSGDANEL
FT                   QTAMRRYGLIYDEADAMLITPYEGSP"
FT   gene            448758..449309
FT                   /locus_tag="Atu0454"
FT                   /old_locus_tag="AGR_C_808"
FT   CDS_pept        448758..449309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0454"
FT                   /old_locus_tag="AGR_C_808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86272"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK93"
FT                   /protein_id="AAK86272.1"
FT                   /translation="MASLVDQITDLYVRMAELERRNRNRRRKGTIAEVSDDKSKYRVKL
FT                   SEQAGKPYLTPWIKARTLAAGGVKVDVLYSVGEQVDVVSENGEMTDAQIDFSTYSDDNA
FT                   RENSDTPFHIKIGDTVIEASAGQAKVTSPKVIVESPNVQLGGDGGKRVARIGDLVHVMS
FT                   GSSSGKWPIVEGSEHVFAVD"
FT   gene            449518..450183
FT                   /locus_tag="Atu8126"
FT                   /old_locus_tag="AGR_C_810"
FT   CDS_pept        449518..450183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8126"
FT                   /old_locus_tag="AGR_C_810"
FT                   /product="putative phage tail protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8126"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86273"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K6"
FT                   /protein_id="AAK86273.1"
FT                   /translation="MSDVGVLLPSSAEPFEKALAAGMSDDLPIPYAVLMDPYQTPARFL
FT                   PWLAVHHSVDLWFDDWTEERKREMIAQCAGVSTLYPASPLGALKGTLAGLKRYLAFVDA
FT                   EIVDRIAHPNRFTFGRAVIGRTPIAHQPFVAHYLVRVTLTAPKNRFQIGRSAFGRAAMT
FT                   AIDLEPIRRAKHAMKTAKTPETIYSVSFAWRRGITFNDNIFIDGSHAIGGYMDRKRLD"
FT   gene            450196..452397
FT                   /locus_tag="Atu8127"
FT                   /old_locus_tag="AGR_C_812"
FT   CDS_pept        450196..452397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8127"
FT                   /old_locus_tag="AGR_C_812"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8127"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86274"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K5"
FT                   /protein_id="AAK86274.1"
FT                   /translation="MQRTSFAEAEIADHADFEAIGLQAQAATDGLWLDAIGYPAHWAAF
FT                   TVARKSAQEITVSAGRYVAGEIVFAQEAPTDMNLQLHIPLAASDQRWVAVLLRGKEVTD
FT                   TANRPFETSDDPETSVIVNRTTPKTIRRVVELIVQPGDANPVPVKPVVASTDACIAFVL
FT                   LTSSGIDAIEPGNSDRVKTLYEVEGRVTALEVDLDALFMRTETIETQIVNIKAKLTEIP
FT                   RPVIIRQMQRDIGAARLKVDLPDEARAYVFDNGLIPDRWDMTHVDWLARIEEGIRFGFA
FT                   AEAQARLEVQAEDDPKIYFRGRRMVPAFDEVTRIANTSLDSTLLISQLVHTEITAIRKE
FT                   ASRVRVTYGPTQWACENQAGWSALGGDARVGQIFNIGGEEFQIVDIRANGGPGHQTYGV
FT                   RQIRYESYNEVYWEYVTEQIGLNGSIYGQTFLVAQPMQATSLELSFARVGNDGDVHVLI
FT                   VETTTGGVPRFDAVLAKGILKHADIKVGWNKVELPITLLESGKRYAFVTVTTGAHALHI
FT                   SASNKYTGGTQFLTTDGAFAQGSMETDICFKLNAARYRSPRTVIPMQALNLADGMTQID
FT                   MLFAGWVPGGCQLGWEIRPSGSAIWTELDDGDPATNPLVGLPASVELRMVMMGTADLQP
FT                   MIQLDDKAISRVARNRSTMRAVSKSLPFGFPTTHVQTQYTLDSFDPVRHTFTPAIMVGD
FT                   TVVSPDATVVTVDPQVPSRRTYLSTYTLGAAASAAASRS"
FT   gene            452511..454250
FT                   /locus_tag="Atu0457"
FT                   /old_locus_tag="AGR_C_813"
FT   CDS_pept        452511..454250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0457"
FT                   /old_locus_tag="AGR_C_813"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86275"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK92"
FT                   /protein_id="AAK86275.2"
FT                   /translation="MTTIFNEGGSWCIVNRVPESADAATLQNNLIGDPVARTGLYAALR
FT                   AKAITSYQPRVLITAGDTGAWIEGGVVSVSLTSEGDNLTEVPDVTATGGGADPGKVLPT
FT                   LKAIMGTGPNAKKVVGVEVVAPGKKMSAAPLLTFTGGGADAGKVLPAATANVGDVANPF
FT                   VSALNAITPKIRARAYITGPNTTDAEALRFRKTVNGGRILIIDPKTIKNVNGVPVTKPV
FT                   APVFAGVRSRVVASAEGFSGSVSNKIIRTIDGVARTIAYTGGMKEFMNDLGDLLLGPVD
FT                   PNAADRIGAIFMRAKEWGASIRELNDAIKDNPIAKFFAEMSGYGFQLFAWGMGISMLAG
FT                   TIRKLAAALFVLSGASTLLGALKTVGSIAAIVGGGAVAGGAAAGAGTGSAGAAAGGAAT
FT                   AGLLGRWGSIITGLARIGTYGTAGAGLWEMGKATYTGDTFYKQGKAWLPGPEDLLHAVG
FT                   SYFASSPPSTALPASASAQLSLDAARSARAAGFGGSTDNLPGKTMDDLGIRTVRIDSSS
FT                   LAQMDRPSGTQDVRVVNPQRPDITIHAPITITGVVDPRAAASAAISEISNALAPNLEGS
FT                   FSD"
FT   gene            complement(454247..454615)
FT                   /locus_tag="Atu0458"
FT                   /old_locus_tag="AGR_C_814"
FT   CDS_pept        complement(454247..454615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0458"
FT                   /old_locus_tag="AGR_C_814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86276"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK91"
FT                   /protein_id="AAK86276.1"
FT                   /translation="MTESQTETPAANEWPKRIIWVAIIAGAIYAYSNWDSVSVQLFGAT
FT                   AYTCKSLVPDVVKISAENTNAFQVKVVGVIDPKQVSKTDTRLECEGTGMLANGQKAPIS
FT                   YRAYEEGEQWWVVYEAKP"
FT   gene            454649..455113
FT                   /locus_tag="Atu8128"
FT                   /old_locus_tag="AGR_C_815"
FT   CDS_pept        454649..455113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8128"
FT                   /old_locus_tag="AGR_C_815"
FT                   /product="putative bacteriophage P2 tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8128"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86277"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K4"
FT                   /protein_id="AAK86277.1"
FT                   /translation="MTGVTSMMLGGFAFEGLGFGYQGVKRKVNTPWVDIPVGQTLNQQQ
FT                   WTGPTSDEVTISGVLFPEEFGGQSQLDGIIAASMAGTEMMLVTGDAAQGVIQGMFTVQS
FT                   VEEDRSYINRRGEAGRNAYSITLKRSGSGTLPSAGGLVDRAASFLSELFR"
FT   gene            455118..455330
FT                   /locus_tag="Atu0460"
FT   CDS_pept        455118..455330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41479"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI40"
FT                   /protein_id="AAL41479.1"
FT                   /translation="MATIYTTRQGETVDLACLAFYGRTAKVVEAVIDANPGLAALGPVL
FT                   PLGTKITMPDIPSTSTAKPLTSLWD"
FT   gene            455333..456493
FT                   /locus_tag="Atu0461"
FT                   /old_locus_tag="AGR_C_819"
FT   CDS_pept        455333..456493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0461"
FT                   /old_locus_tag="AGR_C_819"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86278"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK90"
FT                   /protein_id="AAK86278.2"
FT                   /translation="MKPRVEVSIDGVPVAGHFYERLLSLTVTDEEGMKSDTVDIELNDG
FT                   PPNFLAIPRKGAIISVKMGFGDDLVPKGVFTADKVNLDCLPYKMSISGKAADLRSGKLK
FT                   ERQERSWDKSKLGDILSQIASESGLTPAVDDDLADFEYDWLAQQDESNINFLRRLAERH
FT                   NGLFAVKQRRLIFTRLGSGLSASGAPLGSIILTPEKIKVGSLKVEINDRTKYSKVVAYY
FT                   QDSDKAERVEIDADADADGDSVYRLPEPYASPAEADKAAQAKAKELQRGEGSVSVTVIG
FT                   DAGIDAGLPLLFADVRPGVDGVPYIIKTAKTSYTKTGALEVAVSGRLYDGKSATEKSAG
FT                   TESSGSSATPDASKATGKVAPNSAPGTPATPSSFLTPRRFGRTDEN"
FT   gene            456537..457178
FT                   /locus_tag="Atu0462"
FT                   /old_locus_tag="AGR_C_820"
FT   CDS_pept        456537..457178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0462"
FT                   /old_locus_tag="AGR_C_820"
FT                   /product="endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86279"
FT                   /db_xref="GOA:Q7D1F2"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1F2"
FT                   /protein_id="AAK86279.2"
FT                   /translation="MGYVLSQRSLARLDGVHPDLVRVVRRAIQITEIDFVVTEGVRTLE
FT                   KQKDMVARGASKTMNSRHLKAANGYSHAVDLAALVGGSVVWDWPLYAKLAKAMKQAAKE
FT                   LGIPLEWGGDWKSFKDGPHFQLPWKQYPSAGPVAGKKYTAETETQAKSKALAILGGGVS
FT                   TAVPVGQEPLTKAVEVVSAQQGELSSGEWARMAIAVFIVGISVYLAWRKL"
FT   gene            complement(457154..457471)
FT                   /locus_tag="Atu0463"
FT   CDS_pept        complement(457154..457471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41482"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI37"
FT                   /protein_id="AAL41482.1"
FT                   /translation="MFVSGRGLIGTSKSQGSIAFTVGLHAAAEKPAQIKIVSLQSAFID
FT                   LLSVFENGDTVILESDRDFGFSCPLADKVGGRSHESGTDNDAAPDQCSVKNPHQSFRHA
FT                   R"
FT   gene            457559..457882
FT                   /locus_tag="Atu0464"
FT                   /old_locus_tag="AGR_C_824"
FT   CDS_pept        457559..457882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0464"
FT                   /old_locus_tag="AGR_C_824"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86280"
FT                   /db_xref="GOA:Q7D1F1"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1F1"
FT                   /protein_id="AAK86280.2"
FT                   /translation="MPEKYTSFIELMNAWVGGAFTTIIASLLGRFMWHGNEARKGRRKF
FT                   FGIELFWELPVALGMAVIGESAAAYADLGQPASTGLIALLAYLGPRGVEALFHKWFDRR
FT                   MAG"
FT   gene            complement(457933..458391)
FT                   /locus_tag="Atu0465"
FT   CDS_pept        complement(457933..458391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0465"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41484"
FT                   /db_xref="GOA:Q8UI35"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI35"
FT                   /protein_id="AAL41484.1"
FT                   /translation="MSVVEHHYTECGLMNVFISGIEVQTDDDGDEVIIVPAVNELHHVI
FT                   ATGIVNHPKGISGDELRFLRTEMGLTQSELSGLVHRDKQSIGRWERGEVEIDSPSETLI
FT                   RRLAIEKLGLQEVAIEELSKRSIPTAETQTISIRKVENNNEPYELIAA"
FT   gene            complement(458394..458753)
FT                   /locus_tag="Atu0466"
FT   CDS_pept        complement(458394..458753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41485"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI34"
FT                   /protein_id="AAL41485.1"
FT                   /translation="MKSNDPWLPNVATDKLRAIARDPKFTIAYKLHAKERLAERNLIAS
FT                   DVLYALKYGFVYEQAIPATRQGFFRYRVECKTPNSGSRAIGVVVIPNHVGCYMKIVTVM
FT                   WIDEFERRDGSIIGE"
FT   gene            complement(458882..459028)
FT                   /locus_tag="Atu0467"
FT   CDS_pept        complement(458882..459028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41486"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI33"
FT                   /protein_id="AAL41486.1"
FT                   /translation="MGKGWQSSINSDLRKLSGLRWRPKRKKPPGAARAAFLIAKNNVSM
FT                   GRH"
FT   gene            459236..459649
FT                   /locus_tag="Atu0468"
FT                   /old_locus_tag="AGR_C_828"
FT   CDS_pept        459236..459649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0468"
FT                   /old_locus_tag="AGR_C_828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86281"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK89"
FT                   /protein_id="AAK86281.1"
FT                   /translation="MSSDSNFSEISPEEMEIIQSVLKSAGYNAALLGDDQRQFNTAAFL
FT                   VMSLFLAGEKSADALAAQLKRRLGRASFHRPSYQSALAPYAIRGLPRNMRYVLQFSRKG
FT                   SARSIEAEEQSWENEGGAVRRPLGHPHHRPQLF"
FT   gene            459731..460009
FT                   /locus_tag="Atu0469"
FT   CDS_pept        459731..460009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41488"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI31"
FT                   /protein_id="AAL41488.1"
FT                   /translation="MIERTTNSEITFAHPFVLSSLVAPLDAGTYRLVVDEELIEGLSFS
FT                   AYRRVATHLEIPAISAQTVKRQFLQVSSAEIDDALRKDAELGSAATN"
FT   gene            460159..460419
FT                   /locus_tag="Atu0470"
FT   CDS_pept        460159..460419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41489"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UI30"
FT                   /protein_id="AAL41489.1"
FT                   /translation="MTLIFPNRSRSYDDTRNAVRFLGYDGILEVRFFIEAAALVQSSSS
FT                   NISSECLLAFDAARGSILEAAKKAYARGYQSIYMLNARDFR"
FT   gene            complement(460517..460756)
FT                   /locus_tag="Atu0471"
FT                   /old_locus_tag="AGR_C_832"
FT   CDS_pept        complement(460517..460756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0471"
FT                   /old_locus_tag="AGR_C_832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86283"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E9"
FT                   /protein_id="AAK86283.2"
FT                   /translation="MSDAEKIIVVQFKKGRYGIVPGDMRPATNAASAEKMANAMAPRHI
FT                   GVAAYAVTVDEESGSMANPRLLVSHGQIADLMPD"
FT   gene            461200..461757
FT                   /locus_tag="Atu0472"
FT                   /old_locus_tag="AGR_C_835"
FT   CDS_pept        461200..461757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0472"
FT                   /old_locus_tag="AGR_C_835"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86284"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E8"
FT                   /protein_id="AAK86284.2"
FT                   /translation="MIKSAIRTLALATIVSAISASAFAANPKVGGAAMYENKNIVENAM
FT                   NSKDHTTLVAAVKAAGLVETLQGKGPFTVFAPTNEAFAALPKGTVENLLKPENKAQLTK
FT                   VLTCHVVEADAMSKTIEKMIKDDKGTHDVKTVGGCILKAKESMDKITLTDEMGGVAHVT
FT                   IADVKQSNGVIHVIDKVLLPKM"
FT   gene            complement(461846..462760)
FT                   /locus_tag="Atu0473"
FT                   /old_locus_tag="AGR_C_837"
FT   CDS_pept        complement(461846..462760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0473"
FT                   /old_locus_tag="AGR_C_837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86285"
FT                   /db_xref="GOA:Q7D1E7"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E7"
FT                   /protein_id="AAK86285.2"
FT                   /translation="MHKQIFFCCLHPNPPPRVSSLMEASKTKGWTTSKRINAREKDMKT
FT                   IQITLIASAAFVATASAAVSAPVLGLTGDKTLVMFDTEKPAVSKSMDVTGVDKLVGIDF
FT                   RPGNKTVIGVTPDHRIVTINLETGAATDVAKMDKMLTLTEAPVVVDFNPMADRLRFMTG
FT                   TTNHRVHPDTGAVTVDGALAYEDADMHKGETPDIVAAAYTNSIGKPEKTAMYNIDATIG
FT                   ALVQQTKPNDGTLKAIGKLGLKDKPASYAFDIHGEDGGKNTAYLAAGATLYTVNLETGA
FT                   ATEVGPITGADNGLRDITVLPKM"
FT   gene            462837..463382
FT                   /locus_tag="Atu0474"
FT                   /old_locus_tag="AGR_C_838"
FT   CDS_pept        462837..463382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0474"
FT                   /old_locus_tag="AGR_C_838"
FT                   /product="putative RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86286"
FT                   /db_xref="GOA:Q7D1E6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E6"
FT                   /protein_id="AAK86286.2"
FT                   /translation="MGSAPDDLDRALAACARGDRNALRVIFEREAGRLIAVAERIVKRR
FT                   ELAEEVVQESFVRIWTHAPQYRADHGSARGWIYAIVRNRALNLLRDGSRELTVQDVETL
FT                   RDSEQADEVVAAWQKLDRNSRLYECLGALDETKRQGILMAYVAGYSHGEIAGRLRVPLG
FT                   TTKSWIRRGLSALRECMA"
FT   gene            463379..464083
FT                   /locus_tag="Atu0475"
FT                   /old_locus_tag="AGR_C_840"
FT   CDS_pept        463379..464083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0475"
FT                   /old_locus_tag="AGR_C_840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86287"
FT                   /db_xref="GOA:Q7D1E5"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E5"
FT                   /protein_id="AAK86287.2"
FT                   /translation="MTYDQKDIPAIADDYVLGLLEASEAAAIETATERDGELRAAIAAS
FT                   RERFLPLDTSVAPAAVNSELWSNIESRLPPQAKFTANKSTRTANDNRKNGWRSIAVSAI
FT                   AATLVLAAGLTFSLTRTTEPLVIAVLVNEAGEVQAVVEDFGNEKATVRMLADFAVPQDK
FT                   TIQVWTLPSREVGPVSLGLIEGVRSASLEGPTLPKPRNDQLYEITLEQAGGSPTGRPTG
FT                   PILAKGLARMPR"
FT   gene            464352..465077
FT                   /gene="aqpZ"
FT                   /locus_tag="Atu0476"
FT                   /old_locus_tag="AGR_C_841"
FT   CDS_pept        464352..465077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="Atu0476"
FT                   /old_locus_tag="AGR_C_841"
FT                   /product="aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86288"
FT                   /db_xref="GOA:Q8UI24"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UI24"
FT                   /protein_id="AAK86288.1"
FT                   /translation="MSRKFISEFLGTFWLVFGGCGSAVFAAAFPELGIGFLGVAFAFGL
FT                   TVLTMAYAVGGISGGHFNPAVSVGLTVAGKFPAANLVPYIVAQVLGAVVAAAALYVILT
FT                   GKAGAEIGGFAANGYGEHSPGGYSLLSALLIEIILTAFFLVVILGSTHGRVPVGFAPVA
FT                   IGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPILGGAIGAVVWK
FT                   IFGEEEKAGHAGSVQPAKT"
FT   gene            465100..465423
FT                   /locus_tag="Atu0477"
FT                   /old_locus_tag="AGR_C_842"
FT   CDS_pept        465100..465423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0477"
FT                   /old_locus_tag="AGR_C_842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86289"
FT                   /db_xref="GOA:A9CK88"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK88"
FT                   /protein_id="AAK86289.1"
FT                   /translation="MVGETTEEDGMDLTSILAQIVGGAVGGTAGGKILKDSDLGSLGNL
FT                   IAGAIGGIGGGTVLGSLLGTAGTAAAGGVDIGALAGQLVGGGVGGLIVQIIVGLIKNKL
FT                   VAK"
FT   gene            complement(465635..467182)
FT                   /locus_tag="Atu0478"
FT                   /old_locus_tag="AGR_C_847"
FT   CDS_pept        complement(465635..467182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0478"
FT                   /old_locus_tag="AGR_C_847"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86291"
FT                   /db_xref="GOA:Q7D1E2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E2"
FT                   /protein_id="AAK86291.2"
FT                   /translation="MGLLIVPELARLDLLTNILDELPHLFDELAVTTPQAMRDAIWKAG
FT                   EARRLAETRQRLFNAAPQHSAKITLHGQQGFYGGVLATLLVLSLLTYSEIALAWLHATL
FT                   SMLYLNTLLFRLFALIHIPRETDVETALSLRHENELPVYTILVALYREEAVIEQLVSAL
FT                   ERLDWPRSRLDIKLVCEADDGATIEAIRRINPGPHMEIVQVPPSEPRTKPKALTYALSG
FT                   ARGTFVVVYDAEDRPHPQQLREAYAAFRNQPEDMACVQAPLIISNASSSWLSACFALEY
FT                   AGLFRCMLPALATHGLPLPLGGTSNHFRTAALRRAGAWDPYNVTEDADLGLRLHRLGYR
FT                   CGVIRRQTLEDAPTSLPVWLNQRTRWFKGWLQSWLVMTRTPFATARTMGWFAYMTFQLL
FT                   IGGMLLSSLTHPLLFVSLVFMAIAIRENGVDLLFRWQGALFFIDALNIVGSYTIFVLMG
FT                   RSRMIAYERRQVGRRWLAMPLYWLMLSVAAWRAVVELKTRPFVWNKTPHVPVAKDKT"
FT   gene            467742..468503
FT                   /locus_tag="Atu0479"
FT                   /old_locus_tag="AGR_C_849"
FT   CDS_pept        467742..468503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0479"
FT                   /old_locus_tag="AGR_C_849"
FT                   /product="ABC transporter, substrate binding protein (amino
FT                   acid)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86292"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E1"
FT                   /protein_id="AAK86292.2"
FT                   /translation="MPVLFDAQERFPGGDLSSVPRIRFLMSVDFPPFNFTDQEGRLAGF
FT                   HVDLVREICAQLKVESKCQVQALPFDELEAALEMGEGEAVISGLATTADLRKSFTFSRP
FT                   YLLLPARLAVNKAGKFTGSGADALSGKKVGVVGNSRHEQMLKAFFPKARVEGFDGYEPM
FT                   YEALKTGKVDAIFADGLRLPFWVSGGASESCCALFGGPYMSDRFLGEGLSIMAVDPDNI
FT                   LVPAFDQALAALSRNGRLEEIYRRYFPYGLY"
FT   gene            complement(468531..469733)
FT                   /locus_tag="Atu0480"
FT                   /old_locus_tag="AGR_C_851"
FT   CDS_pept        complement(468531..469733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0480"
FT                   /old_locus_tag="AGR_C_851"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86293"
FT                   /db_xref="GOA:Q7D1E0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1E0"
FT                   /protein_id="AAK86293.2"
FT                   /translation="MSSAAQLLTFALLARHLGVEQFALYASITAVTNLGVQICGIGSQE
FT                   SLIRRVAQDRSMFPVMLGHSYLLSAATGVVLTIIGMVTIPVFFPTSETLLHTLITTFLI
FT                   LFTNLVLLKVISLSTQSFIAHSNFASANKLEVMFAVTRTIAAVVACLIFKVETVEAWAL
FT                   WNLAAHAVAAVISVKATGRLGRPIFRIVREEIRIGILFSTQFLFKAVRGNADILVLGAI
FT                   ASAEVLGSYSIARRILDSSYLSVEALNRLIYPGSASAALQGITKTIGRAYNVLKAALFI
FT                   ATGSALVIFIIAPFLPLLFGDEYVSLPIITRVLCWVVLPMAVAATALEALGASGRQDIR
FT                   AKIWNSGNLLGSVIVAFFTWSFSISGTIGSYFLVETAIAAAVWIALLRLRRDEQVFAPA
FT                   K"
FT   gene            470111..471406
FT                   /gene="exoQ"
FT                   /locus_tag="Atu0481"
FT                   /old_locus_tag="AGR_C_854"
FT   CDS_pept        470111..471406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoQ"
FT                   /locus_tag="Atu0481"
FT                   /old_locus_tag="AGR_C_854"
FT                   /product="exopolysaccharide production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86294"
FT                   /db_xref="GOA:Q7D1D9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D9"
FT                   /protein_id="AAK86294.2"
FT                   /translation="MPRLADTQPITAQDSAISLAGGRRDAFFFVATMLYIWISVAPFEN
FT                   LAAPPVPRAAANQLTGLVIALILAVFALRHRLTGLLLRPRLPILLLFFWLVICSVIGTQ
FT                   PGTSLQRLVFTALLCFITSVLVVMPRDRRQFDRMMAIFALILLALCYLGVIFLRSRSVH
FT                   QPFDLDEKALAGDWRGIFNHKNAAAPAMIILFMIGLYLRNAWSTLGGIAITLLAGFFLW
FT                   KTNGKTAAMLLPVTLALVWIMERHAHRTLLMIGGLLAFLNIVAVGSTYFPSIQNFVESL
FT                   GIDSTFTGRTDIWRLSFDTFAQSPIFGQGFQAFWTSDRLLSQADIAGTWAVTAFHAHNG
FT                   YVESLLNGGLPAFILTVIWLVIIPANDFHTAVDKGTDPGLTRLFARIWVYALLSSCLES
FT                   NFFTGTGPIWSSLLIAVYCLRHQAHDILEQGQ"
FT   gene            471433..472185
FT                   /locus_tag="Atu0482"
FT                   /old_locus_tag="AGR_C_856"
FT   CDS_pept        471433..472185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0482"
FT                   /old_locus_tag="AGR_C_856"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86295"
FT                   /db_xref="GOA:A9CK87"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK87"
FT                   /protein_id="AAK86295.1"
FT                   /translation="MTQKIGTFVDRINNRLVRYFPGPAVRIEKSEPIVSFTFDDVPATA
FT                   WTKGARILENEGVCGTFYIAGTFIDRHDGQQEMISAKGCSELAAAGHELACHTFSHRKL
FT                   SSFSRRALEEDLERNDSVLGAFDENRHSRNFSVPFGMASPVMQPLLRRRFRTTRGIMPG
FT                   INRDSVDPHNLAAVELRADQSYLDAADRWLEDVLQKGGWLIIFTHDVSPTPSFYGCPED
FT                   RFQGLVRKAASGGAKIMTVDAAARTLGL"
FT   gene            complement(472247..472897)
FT                   /gene="c1"
FT                   /locus_tag="Atu0483"
FT                   /old_locus_tag="AGR_C_858"
FT   CDS_pept        complement(472247..472897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="c1"
FT                   /locus_tag="Atu0483"
FT                   /old_locus_tag="AGR_C_858"
FT                   /product="bacteriophage repressor protein C1"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86296"
FT                   /db_xref="GOA:A9CK86"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK86"
FT                   /protein_id="AAK86296.1"
FT                   /translation="MLSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGPD
FT                   GRKRWPSTESVSKVLEATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGGFF
FT                   DDGGFPAGQGWDVVEFPSSPERKQGVYALEVQGESMMPLYRDGDILIVEPGAPVRRGDR
FT                   VVLKSRDGEVMAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ"
FT   gene            complement(473010..473660)
FT                   /locus_tag="Atu0484"
FT                   /old_locus_tag="AGR_C_859"
FT   CDS_pept        complement(473010..473660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0484"
FT                   /old_locus_tag="AGR_C_859"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86297"
FT                   /db_xref="GOA:Q7D1D6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D6"
FT                   /protein_id="AAK86297.2"
FT                   /translation="MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAA
FT                   TTRNDADLMLLDLAMPGVSGFSGLMALRAEFSSLPIVIVSATDDATTVRRSIELGASGF
FT                   ISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDPDVADLIGRLRTLTPQQSRVLGML
FT                   AEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKINTSAMVA"
FT   gene            473913..474266
FT                   /locus_tag="Atu0485"
FT                   /old_locus_tag="AGR_C_860"
FT   CDS_pept        473913..474266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0485"
FT                   /old_locus_tag="AGR_C_860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86298"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D5"
FT                   /protein_id="AAK86298.2"
FT                   /translation="MQETPAIIYKIVPETLWTAARAEGMFEGAAIDLTDGFIHFSTAKQ
FT                   VAETAARHFSGQVDLLLIAVDGAALGDKLVYEPSRGGDLFPHLYAPLPFSAVLWETPLS
FT                   LDHDGQHQFPEIL"
FT   gene            474266..475357
FT                   /gene="pyrD"
FT                   /locus_tag="Atu0486"
FT                   /old_locus_tag="AGR_C_861"
FT   CDS_pept        474266..475357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="Atu0486"
FT                   /old_locus_tag="AGR_C_861"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86299"
FT                   /db_xref="GOA:A9CK85"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CK85"
FT                   /protein_id="AAK86299.2"
FT                   /translation="MSGLFSSVGRKGLFLIDPEKAHGLSVAALKSGFLPTCMVPHDPRL
FT                   QQTVAGLVFPNPLGMAAGYDKNAEVPGPLLRLGFGFTEIGTVTPRAQSGNPKPRIFRLV
FT                   EDEGVINRLGFNNEGHAAALERLTQARLRGIVGVNIGANKDSEDRIADYVQGIEAFYAV
FT                   ASYFTVNISSPNTPGLRDLQARESLAALLTAVLERRKTEAERLGKRIPIFLKIAPDLTE
FT                   EGLDDVAEEALAHDLDGLIVSNTTLSREGLRPGPHRGEAGGLSGKPLFELSTTVLAKMR
FT                   RRVGANLPIIGVGGVSSAETALEKVRAGADLVQLYSCMVYEGPGLPSAIVKGMSKLVAR
FT                   EGVETIRDLRDSAVDRWADRKLG"
FT   gene            complement(475394..475891)
FT                   /locus_tag="Atu8129"
FT                   /old_locus_tag="AGR_C_862"
FT   CDS_pept        complement(475394..475891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8129"
FT                   /old_locus_tag="AGR_C_862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8129"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86300"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K1"
FT                   /protein_id="AAK86300.1"
FT                   /translation="MTDTSLQTLTRRGFVLISAGSVLSACVSMPTNKGLPSGTRDETAA
FT                   ALPMVNDLRRSKGLAPLAINGAASGAAAYQAGRMVKAQKMAHLIGLTDSFLIRMKDGKV
FT                   PLPAAENVAAGQDSVERVVKAWIGSQHHLENMLGPYNGLGVAVAYDAASRNRPYWAMVL
FT                   CA"
FT   gene            complement(475893..476159)
FT                   /locus_tag="Atu0488"
FT                   /old_locus_tag="AGR_C_864"
FT   CDS_pept        complement(475893..476159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0488"
FT                   /old_locus_tag="AGR_C_864"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86301"
FT                   /db_xref="GOA:Q7D1D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D3"
FT                   /protein_id="AAK86301.2"
FT                   /translation="MAGEVNKMLGDTVARTVVKLLVVSLLVGFLMAIFGLTPWNIIYSA
FT                   RDFVVDLWRSGFHALGAIGDYLLLGATIVIPVFIILRLLSYRR"
FT   gene            476434..477270
FT                   /locus_tag="Atu0489"
FT                   /old_locus_tag="AGR_C_866"
FT   CDS_pept        476434..477270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0489"
FT                   /old_locus_tag="AGR_C_866"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86302"
FT                   /db_xref="GOA:Q7D1D2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D2"
FT                   /protein_id="AAK86302.2"
FT                   /translation="MEQALELAPRWTAGWFRFGEYHEKAGETAKAVAAYEKVAELDAEG
FT                   LFAAELKLAVLGAAETPEQPPSRYVEGLFDDYADRFETSLVEKLDYSVPQKLAELIGKA
FT                   ATGDAFDTIVDIGCGTGLLGIEIRSLAKRLEGFDISQNMLAKADEKSLYDHLGQADLSL
FT                   DAEASGLFTPVLTQHRADLVAAADVMMYLGSLETVMPLVSALLKPSGFFAFSVEDAGDE
FT                   QGFVLRESLRYAHSKSYVIDLLERSGFSPMEIRKTTIRKDAGKPLSGILFLARAKA"
FT   gene            477406..478017
FT                   /locus_tag="Atu0490"
FT                   /old_locus_tag="AGR_C_867"
FT   CDS_pept        477406..478017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0490"
FT                   /old_locus_tag="AGR_C_867"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86303"
FT                   /db_xref="GOA:Q7D1D1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D1"
FT                   /protein_id="AAK86303.2"
FT                   /translation="MWSSDPARHAPVEDVQGIVTGAIVSALGFYLLAKVGLLTGGTAGV
FT                   AFLLHYAFGISFGLLFFLVNLPFYYLSFRRLGLAFSCKTFIAIGLVSVLTEVEARWMVI
FT                   DSINPLWAALLGGLLLGYGLLALYRHRASLGGIGILAIYIQDRFGIRAGLIQLAFDACV
FT                   MLCAFLVIDPATVAYSIVGAFVLNIFLAINHRSDRYIVVR"
FT   gene            478100..478741
FT                   /locus_tag="Atu0491"
FT                   /old_locus_tag="AGR_C_869"
FT   CDS_pept        478100..478741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0491"
FT                   /old_locus_tag="AGR_C_869"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86304"
FT                   /db_xref="GOA:Q7D1D0"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1D0"
FT                   /protein_id="AAK86304.2"
FT                   /translation="MDDTSARRRLNLWTSAPDRHSLLEDAQAILAGSMLISLGVTLFSA
FT                   AGLLTGGVVGLAFLAHYASGFSFGAVFFLANLPFYYLAFRRLGLAFTVKTFCAIATTAL
FT                   LSEYMPGFFAFESINPIAAALFGGLTVAAGMLALFRHRTSLGGFGILALYLQDRFGWRA
FT                   GLVQLAFDGMVLGCSFFVATPFVILCSILGALVMNLTLAVNHRNDRYIAM"
FT   gene            complement(478768..479229)
FT                   /locus_tag="Atu0492"
FT                   /old_locus_tag="AGR_C_871"
FT   CDS_pept        complement(478768..479229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0492"
FT                   /old_locus_tag="AGR_C_871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86305"
FT                   /db_xref="GOA:Q7D1C9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="PDB:2GMY"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C9"
FT                   /protein_id="AAK86305.2"
FT                   /translation="MKTRINYAKASPEAFKAVMALENYVQSSGLEHRFIHLIKLRASII
FT                   NGCAFCVDMHVKESRHDGLSEQWINLMSVWRESPVYTEQERALLGWVDAVTKIAETGAP
FT                   DDAFETLRAHFSDEEIVKITVAIGAINTWNRIAVGFRSQHPVEAAAKAA"
FT   gene            complement(479337..479840)
FT                   /locus_tag="Atu0493"
FT                   /old_locus_tag="AGR_C_872"
FT   CDS_pept        complement(479337..479840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0493"
FT                   /old_locus_tag="AGR_C_872"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86306"
FT                   /db_xref="GOA:Q7D1C8"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C8"
FT                   /protein_id="AAK86306.2"
FT                   /translation="MKLGDGVEQAIHSVSMLAGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQSLSNAGIVTTVPGPKGGYRLARTTDKITLLDIVLAVEGPQPAFRCAEIRQRGPNPLP
FT                   GRYFTKPCGINAAMLKAEKVYRAELAKTSIADILGDLAANDDGGIAARGCAFLDMNERK
FT                   TTTR"
FT   gene            480100..482478
FT                   /gene="lhr"
FT                   /locus_tag="Atu0494"
FT                   /old_locus_tag="AGR_C_874"
FT   CDS_pept        480100..482478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhr"
FT                   /locus_tag="Atu0494"
FT                   /old_locus_tag="AGR_C_874"
FT                   /product="large atp-dependant helicase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86307"
FT                   /db_xref="GOA:Q7D1C7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C7"
FT                   /protein_id="AAK86307.2"
FT                   /translation="MLLIAPTGAGKTLGGFMASLTDLAERGKVPPGSGFVGVHTLYISP
FT                   LKALAVDIERNLTRPVSEMGLPIVIETRTGDTPQAKRQRQKVKPPDILLTTPEQVSLLL
FT                   ANKEAERFFRDLKYVVLDELHSLVTSKRGHLLSLALARVRRHAPDVRFIGLSATVAEPM
FT                   DLRRYLAPQGQGEPPAGLITVEGGAKPDISILHTEERIPWSGHSARYAGKDLYEALKQH
FT                   QTTLVFVNTRSQAERVFQELWTVNDDNLPIALHHGSLDAGQRRRVEAAMAENKLRAVVA
FT                   TSTLDLGIDWGDVDLVVHVGAPKGASRLAQRIGRSNHRMDEPSKAILVPANRFEVMECR
FT                   AALDANYIGAQDTPPIAEGALDVLAQHVLGMACAEPFDADELYREVTSASPYANLPRAT
FT                   FDRVVDFTATGGYALRTYERYARIRQMKDGRWRVSNPAVAQQYRLNLGTIVEAAELNVR
FT                   MVKRNAKGTVGRGGMSLGKVEEYFLEQLVQGDTFLFAGKVLRFEGIRENECLVSQAFSM
FT                   DPKIPSYAGGKFPLSTYLADQVRSMLADPARWQALPDQVRDWLEIQKEKSIIPKRDELL
FT                   VETFPFRKRFFMVMYPFEGRLAHQTLGMLLTRRLERAGAKPMGFVATDYSLAIWAMEDI
FT                   GMRLKSRRLSLADLLDEDMLGDDLEAWLDESFMLKRTFRNCAVISGLIERRHPGKEKTG
FT                   RQVTVSADLIYDVLRSHEPDHILLEATRRDAAAGLLDIGRLGDMLKRIKGHTTHRALEH
FT                   VSPLAVPVMLEIGRETVAGEAMDDVLAEAADELIAEAMS"
FT   gene            482513..483241
FT                   /locus_tag="Atu0495"
FT                   /old_locus_tag="AGR_C_876"
FT   CDS_pept        482513..483241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0495"
FT                   /old_locus_tag="AGR_C_876"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86308"
FT                   /db_xref="GOA:A9CK84"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK84"
FT                   /protein_id="AAK86308.1"
FT                   /translation="MLSRLTLSDRFSNGFECLGSETAIHGVAAWCDPLGGLYLPDLSLL
FT                   VVSDLHLEKGAAFARRGRMLPPYDTIATLKILSSLVSRYDPKIVVSLGDNFHDRVGSQH
FT                   LPLPLRELIREMARGREWIWINGNHDPDGTVDLPGSSVDEMFYGNLVFRHEPKVGEAAG
FT                   EIAGHLHPSATVRRREKTVRRPCFATDGSRLLMPAFGVMSGGLDLRHQAMRGLFDHTAL
FT                   VAHLMGRDRIYSVRFSNLLG"
FT   gene            complement(483264..483701)
FT                   /locus_tag="Atu0496"
FT                   /old_locus_tag="AGR_C_878"
FT   CDS_pept        complement(483264..483701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0496"
FT                   /old_locus_tag="AGR_C_878"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86309"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C5"
FT                   /protein_id="AAK86309.2"
FT                   /translation="MFKHILIPTDGSPLAQIAIDQGFALAREAGAKVTVVTVSEPFHVI
FT                   ASDVEDIAAIAEEEFHRCEEAEHLLRDTQAHAAAMGLDCEALLARAGRPDEAIIEIADR
FT                   TGCDLIAMASHRRRSFIEMLLGSVTAKVLKNSKIPVLVYRQ"
FT   gene            complement(483859..484650)
FT                   /locus_tag="Atu8130"
FT                   /old_locus_tag="AGR_C_880"
FT   CDS_pept        complement(483859..484650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8130"
FT                   /old_locus_tag="AGR_C_880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8130"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86310"
FT                   /db_xref="GOA:Q8U5K0"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5K0"
FT                   /protein_id="AAK86310.2"
FT                   /translation="MPFLAFGETASAQTPPLALPPGPQQRPLQENIEIGASTTEIPIAS
FT                   DFRGADFTLFGALNNTDQLLLAIGQYDIVVTLEGPSDYMTVRKKQRVAGIWINTSAITF
FT                   TPLPESYSMASTRNINDVASPGTLRAMGLGVDHLSLKSAVFSGVPDNVFDFQEAYRRLK
FT                   LSSGIYRNDTTGVRLERTGLFWATLRLPANVPNGVHTARAYLFKSGKFIAQRELKLRVV
FT                   KTGMEQAITDAAHQTPLAYGALCVLLAVVTGWGASIIFRKD"
FT   gene            complement(484683..485609)
FT                   /locus_tag="Atu0498"
FT                   /old_locus_tag="AGR_C_881"
FT   CDS_pept        complement(484683..485609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0498"
FT                   /old_locus_tag="AGR_C_881"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86311"
FT                   /db_xref="GOA:Q7D1C4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C4"
FT                   /protein_id="AAK86311.2"
FT                   /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSVSGSITHFRRGTLDIKLGTVLLVGGLVGATVGVWIFSFL
FT                   RSIGQLDLIVSLLYVILLGTVGTLMLKESISALRRAARNETVTLRRPGHHNWVHRLPLK
FT                   MRFKKSKIYLSIIPIVALGFGIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQ
FT                   IIFVTAYTTVVQAATNYSVDVVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLALLVL
FT                   AVALRLAVSLVVRPEDLFSVAVGGLGY"
FT   gene            complement(485874..489620)
FT                   /locus_tag="Atu0499"
FT                   /old_locus_tag="AGR_C_883"
FT   CDS_pept        complement(485874..489620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0499"
FT                   /old_locus_tag="AGR_C_883"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86312"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C3"
FT                   /protein_id="AAK86312.2"
FT                   /translation="MNGLRSKTQQPSDRSSLDALNRTIEGLEARIEGLMSQKFPREPRA
FT                   ASSQPEPKNEAYAAPREPRAAVTPPQLDPVNEIRQRQRLLEASFQRPQEPVARPERTIT
FT                   RPLAPEYGSRDTQQTAAPAPRARAIPPYQEQQRNDAALQEIAQALVNLRHELKHDIAEG
FT                   VAREAQGLRAEIRNIRAVAEDQQFIGDLRDDIARLAGSIDQLGNLASPDAYGLRNEFED
FT                   LRLTIDQLAREDSVHRIESRWNNVEDTLRGFDAASLQDEIVSLAYRLDDIKTQLGGMSN
FT                   NPAVRVLEEKLITIASAVEQLGKHMQPNEAAFTEQFSGLDQRLDEISRAIAATGTRANA
FT                   QATDNALAQRLETRLNGLAEQLGDINRLAAIKPEPAPDLTARLEALSGKIDELSTARDA
FT                   AQLHDRLDQLSLLLERSQRPTQQAELTSFLSDISRKIDALDHGAINDGLAERLDLLSRR
FT                   IEDLDYRYSQPQPASGLSDSAFSRLEERLGTIAARLDETAHAAPADSRALASLENQIAH
FT                   LSTLISQPVQVQAAGISPELDVRMAAIEDYMASNDEYIIEAARQAAEAVLDAYTRNNLS
FT                   AGANLADMTMLTDLATDLRSLEALSRNTEERTHRTFEALHETLVQIAGRLDNLDSAPAY
FT                   RQDAPRNVAQHMVAASREDAAMPAAVFPADGYIAEEQAILDDVSENDATAIVPPAAAKP
FT                   AKAERKSLLAGLTKRFKTSTAKPAKAKEEPVSASSARTQVEPAPSLDPIDVLPAGQENE
FT                   LLEPGSGAPDIKKILERVRASQVAGAGKAADAEGRTDFIAAARRAAQAAAMETSPEKLD
FT                   TGKKSRKADTSALSRYRRPLLLGIGAILLAMMAMPLVKTLIGGAEAPAPVIEQKTDQGP
FT                   VSALPETDDKAVTIPSGLAIDPEQAASADSIENAAPAQNIIDNRTIGGAPLPDEPPVAD
FT                   VPAVDPAKSDTVAQNEGPKPTEVATTTIPAQDTIVVPAGIEPASLAEAAAKGDTQALFE
FT                   IAARYTDGRGVTADRAEAAKWYKMAADRGLAPAQYRLANLYEKANGVERNLVEAKRYYT
FT                   LAAEQGNAGAMHNLAVLLASDAAGQPDFATSAQWFIKASELGVRDSQFNLAILYARGSG
FT                   VKQDIEESYKWFAIAAKDGDADAAQKRDEVAGAMSPQQLQSAKAKVDAWKVKPLSDDAN
FT                   SVNPPEEWAGKEGVKTASVDMEKAIRNIQAILNKNGFDAGQPDGKLGKNTVTAIRDFQK
FT                   SVGQTPDGRITNDLVTALLARNK"
FT   gene            489550..489831
FT                   /locus_tag="Atu0500"
FT                   /old_locus_tag="AGR_C_884"
FT   CDS_pept        489550..489831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0500"
FT                   /old_locus_tag="AGR_C_884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1C2"
FT                   /protein_id="AAK86313.1"
FT                   /translation="MVRLSASRDDLSLGCWVFDRNPFIFSLASLPPAVPGFLSRRCLSR
FT                   QAVAATCRNSRAGICPLGGKCAAERSSYLLSENSRNVVKKWLTMVGIF"
FT   gene            489997..491793
FT                   /gene="acd"
FT                   /locus_tag="Atu0501"
FT                   /old_locus_tag="AGR_C_885"
FT   CDS_pept        489997..491793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="Atu0501"
FT                   /old_locus_tag="AGR_C_885"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86314"
FT                   /db_xref="GOA:A9CK83"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK83"
FT                   /protein_id="AAK86314.2"
FT                   /translation="MPVYKAPVKDTLFILNDVLGLERYNNLPGFEDATPDMIEAITGEA
FT                   AKLAEERLFPLNLSGDQQGCKRADDGSVSVPDGFKAAYDAYCEGGWIGLAVPSEFGGQG
FT                   LPYTLHAAIGEYMSSANLSLMMYPGLTQGAIAAVLVHGTQEQKETYLPKMVEGTWSGTM
FT                   NLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAGEHSMTDNIVHLVIARIEGAPE
FT                   GTKGISLFIVPKFLVKEDGTLGERNGVTCGAIEHKMGIHGNATCVMNYDDATGYLLGAE
FT                   NKGLSAMFVMMNEARLGVGLQGLSVGEIAYQNAVEYARDRIQGRSLSGAKFPDKKADPI
FT                   IVHPDIRRTLMTIKAYNEAGRAFLLWTALQSDIAHRAADEKQRQAADDLLGLVTPILKG
FT                   VLTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARITMIYEGANGIQALDLVGRKLGM
FT                   NGGRAVMALFKEIGDFCEENRADEKLSLYTKGLKKGLNDLQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGIVVLGYMQALMAKAASEALAAGSTSDEDFLKTKLVTAKFYMERIMPET
FT                   ALRKARIETGADTMMELAAEAF"
FT   gene            491832..493040
FT                   /locus_tag="Atu0502"
FT                   /old_locus_tag="AGR_C_886"
FT   CDS_pept        491832..493040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0502"
FT                   /old_locus_tag="AGR_C_886"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86315"
FT                   /db_xref="GOA:A9CK82"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK82"
FT                   /protein_id="AAK86315.1"
FT                   /translation="MTDVYIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNGL
FT                   DTSAVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSNRAPGMQISRFCASGLDAINFAAGK
FT                   VKAGSDDIVIAGGVESMSRVGMGMSGGAWYMDPSVNFPAFFMPQGVSADLIATKYGFSR
FT                   DDVDAYAVESQKRAAHAWENGYFNKSVIPVKDQNGLTILDRDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIMAHPEVERINYVHHAGNSSGIVDGAAAVLVGSKAGGEAMGVKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKKTGMSIADIDLFELNEAFAAVVLRYMQAF
FT                   DISHDRMNVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
FT   gene            493225..495441
FT                   /gene="fadB"
FT                   /locus_tag="Atu0503"
FT                   /old_locus_tag="AGR_C_888"
FT   CDS_pept        493225..495441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="Atu0503"
FT                   /old_locus_tag="AGR_C_888"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86316"
FT                   /db_xref="GOA:A9CK81"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK81"
FT                   /protein_id="AAK86316.1"
FT                   /translation="MSTYTNFTIETDADGIALVTWDMPEKSMNVFTAEVLEELNAIVDA
FT                   TVADGAVKGVVFTSGKSSFSGGADLSMLKSMFALYNDEKAKSPDAAAAKLFELVGRMTG
FT                   LFRKIETNGKPWVSAINGTCMGGAFELSLACHGRVASSAKSLKIALPEVKVGIFPGAGG
FT                   TQRVSRLTDAQSALQMMTTGQSLTGARAKAMGLVHQVVEPDQLVATAKQMIKDGLKPVA
FT                   PWDEKGFKAPGGGIWTPAAAQLWPAAPAILRRESAGNYPAALAILKCVYEGLQLPFDTA
FT                   LKVEQRYFTEILRSKEAFGMIRSLFISMQELNKGARRPAGQPKTEFKKVGVVGAGFMGA
FT                   AVAYVTAAAGIPVTLVDRDQDAADKGKGHCEESVKAAIGKGRLTQEEGKALLDLVTPTS
FT                   DYATLADADLVIEAVFEDRDVKKAVIEAVEAVLPEGAIFASNTSTLPITGLAKNSKRPA
FT                   DFIGIHFFSPVEKMMLTEVILGKETGDKALAVALDYVAKIRKTPIVVNDTRGFFVNRCV
FT                   LRYMAESYDMLIEGVPAAMIENAAKFAGMPVGPLALNDEVAIDLSYKILKATVADLGEK
FT                   AVDPRHMELVKKLVEGDGRFGRKNAKGFYDYPPKPAKKSLWPGLKDLYPQQKPEDVDMD
FT                   VLKQRFLVTVALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGVKNFV
FT                   ALAEKLSEAYGPRFQPTPLLKDMAAKGETFYGRFDPYASAAKAA"
FT   gene            495598..496029
FT                   /locus_tag="Atu0504"
FT                   /old_locus_tag="AGR_C_891"
FT   CDS_pept        495598..496029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0504"
FT                   /old_locus_tag="AGR_C_891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86317"
FT                   /db_xref="GOA:Q7D1B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1B8"
FT                   /protein_id="AAK86317.2"
FT                   /translation="MKAPLRSHGFDKPSDLDDHLAELDEEAEAIAAEAKTEKTAVKRTR
FT                   ASHAIDPSLRAELEELRKQLDKIRRDVKRLEAAQYPRHRPAQLHHERDRENSRLMTVVR
FT                   SVAVTSLASRIFASSPVMAALVAVVPFALGLAARRSEGS"
FT   gene            496071..496277
FT                   /locus_tag="Atu8010"
FT                   /old_locus_tag="AGR_C_892"
FT   CDS_pept        496071..496277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8010"
FT                   /old_locus_tag="AGR_C_892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8010"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J9"
FT                   /protein_id="AAK86318.1"
FT                   /translation="MRDPCGDRMCQLRLMPEGGVPCNPAFAGRAFQPSTGAVKKLSKNF
FT                   AMALAMSEQDVITPLTFGAPKQP"
FT   gene            496313..496388
FT                   /locus_tag="Atu0505"
FT   tRNA            496313..496388
FT                   /locus_tag="Atu0505"
FT                   /product="tRNA-Phe"
FT   gene            496545..497132
FT                   /locus_tag="Atu0506"
FT                   /old_locus_tag="AGR_C_894"
FT   CDS_pept        496545..497132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0506"
FT                   /old_locus_tag="AGR_C_894"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86320"
FT                   /db_xref="GOA:Q7D1B7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1B7"
FT                   /protein_id="AAK86320.2"
FT                   /translation="MDCVANPTLLPHDIMYFDGFLSSEDEAFVADRLDAGEWSTELKRR
FT                   VQHFGYRYDYKVRAVTPDAYLGPLPPWLGLFAERLVADGYCRTVPDQVIANEYLLGQGI
FT                   SAHVDCVPCFDDTIVSISLLSACEMVFRDLRGPGIRSVLHPRSGVLLRGSSRYDWTHEI
FT                   PARKSDIVNGVKTARSRRISLTFRKVLGLKRP"
FT   gene            complement(497142..497486)
FT                   /gene="phaG"
FT                   /locus_tag="Atu0507"
FT                   /old_locus_tag="AGR_C_895"
FT   CDS_pept        complement(497142..497486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaG"
FT                   /locus_tag="Atu0507"
FT                   /old_locus_tag="AGR_C_895"
FT                   /product="potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86321"
FT                   /db_xref="GOA:A9CK80"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK80"
FT                   /protein_id="AAK86321.1"
FT                   /translation="MNNAAEFPLWAAILVAFFVLLGASLTLTGTIGFAKLNSFYERLHA
FT                   PTLGTSWGTGGIVMASIIYFSVSGDRFAFHEIFIGIFMTVTTPVSLMLLGRAALYRDRA
FT                   EQNSDNREHL"
FT   gene            complement(497483..497764)
FT                   /gene="phaF"
FT                   /locus_tag="Atu0508"
FT                   /old_locus_tag="AGR_C_896"
FT   CDS_pept        complement(497483..497764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="Atu0508"
FT                   /old_locus_tag="AGR_C_896"
FT                   /product="PH Adaption potassium efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86322"
FT                   /db_xref="GOA:A9CK79"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK79"
FT                   /protein_id="AAK86322.1"
FT                   /translation="MSSIILFWSFSLAQLMLAIAMTISVYRIAIGPRAQDRVLGMDTLY
FT                   VNAMLLLLTFGLRTGNDIYFEASLLIAILGFVSTVALSKFMMRGEVIE"
FT   gene            complement(497761..498246)
FT                   /gene="phaE"
FT                   /locus_tag="Atu0509"
FT                   /old_locus_tag="AGR_C_898"
FT   CDS_pept        complement(497761..498246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /locus_tag="Atu0509"
FT                   /old_locus_tag="AGR_C_898"
FT                   /product="phaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86323"
FT                   /db_xref="GOA:Q7D1B4"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1B4"
FT                   /protein_id="AAK86323.2"
FT                   /translation="MSRLLPYPLLTVSLIFFWLTINSFSAGHLLLGTGVALIASWAMAS
FT                   LRPAKPRIRNWHRLVQLILIVLYDIVRSNLSVAKIILFQRERDRKSGFLAVPLEIRDPM
FT                   ALAVLATILTSTPGSAWLEYNSSQGTLLLHVLDDVDEAAWISLIKNRYEKLLMEIFE"
FT   gene            complement(498246..499889)
FT                   /gene="phaD"
FT                   /locus_tag="Atu0510"
FT                   /old_locus_tag="AGR_C_899"
FT   CDS_pept        complement(498246..499889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="Atu0510"
FT                   /old_locus_tag="AGR_C_899"
FT                   /product="pH adaption potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86324"
FT                   /db_xref="GOA:Q7D1B3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1B3"
FT                   /protein_id="AAK86324.2"
FT                   /translation="MSFPFHIVVAPILLPLITAALLLFFDERQRVAKAAISFTSTVLLL
FT                   IVAILLFREVNSTVNTEIAAVVSSGVYLLGNWPAPFGIVLVADRLSGLMVLLTALLAIP
FT                   SLIYSMAKWHKSGAHFHSLFQMMLMGVNGAFLTGDLFNLFVFFEVMLAASYGLLLHGSG
FT                   QQRVKAGLHYIAINLVAALFFLIGVSLIYGVTGTLNMGDLAHRIEGLNPDQRMLLETGA
FT                   AILGIAFLVKAGMWPLNFWLPSAYGAASAPVGGLFAIMSKVGIYVIARLSFLLFGQTAG
FT                   ESAGFGHDALLVGGIATIIFGAIGVLASQALGRLAGFSVLVSSGTLLAAMGTGNPTVAA
FT                   GALYYMVSSTLTISAFFMLIELVERGQDAGANVLAVTMEAYGEGEEEDEEEEVGVTMPA
FT                   TIAVLGACFAACGILLAGLPPLSGFIAKFSMLTAILNPSGLGANDSVSTLSWWLVFLIV
FT                   FAGFASLVSMTRAGIRTFWASIEGTVPRVLVIEIAPIMLLLGLTLAMTIQAGPVMRYMQ
FT                   ETARILDLPASYIQGVISAPRAGSNPEAEP"
FT   gene            complement(499889..500224)
FT                   /gene="phaC"
FT                   /locus_tag="Atu0511"
FT                   /old_locus_tag="AGR_C_902"
FT   CDS_pept        complement(499889..500224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="Atu0511"
FT                   /old_locus_tag="AGR_C_902"
FT                   /product="pH adaption potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86325"
FT                   /db_xref="GOA:A9CK78"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK78"
FT                   /protein_id="AAK86325.1"
FT                   /translation="MELILAIGIGIMTGSGVWLILRPRTYQVIVGLSLLSYAVNLFIFG
FT                   VGGIKTNAPPVLVNGVDSSTLADPVPQALVLTAIVIGFATTALFLVVLLAARGLTGTDH
FT                   VDGRESK"
FT   gene            complement(500224..503142)
FT                   /gene="phaA"
FT                   /locus_tag="Atu8131"
FT                   /old_locus_tag="AGR_C_903"
FT   CDS_pept        complement(500224..503142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaA"
FT                   /locus_tag="Atu8131"
FT                   /old_locus_tag="AGR_C_903"
FT                   /product="pH adaption potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8131"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86326"
FT                   /db_xref="GOA:Q8U5J7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR005663"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J7"
FT                   /protein_id="AAK86326.1"
FT                   /translation="MTLATLLPFIVALPFVGAFLTAFMPRDGAAAGPASVAGGVALFGL
FT                   VSSMFLYSTISGGGVLKYDVEWLPQLGLNFTLRLDGFAWIFAILITGIGLLVVLYARYY
FT                   MSSKDPIPRFFAFFLAFMGSMLGVVLSGNVILLSIFWEMTSIFSFLLIGYWHQNAGARD
FT                   GARMALTVTGIGGFSLLAGLLILGHMAGSYDLDKIIEAGAAIRAHSLYLPALILILGGA
FT                   LTKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGVFLLARFWPVLAGTPEWFWLVGV
FT                   AGVITLLLGAYFAMFQQDLKGLLAYSTISHLGLITTLLSLGSPLAAVAAIFHMVNHATF
FT                   KASLFMAAGIIDHETGTRDMRRLSGLYTYMPATATLAMAASAAMAGVPLFNGFLSKEMF
FT                   FAEAVETHADSLLDRALPYVATLSGAFAVAYSLRFIHTVFFGPKPVDLPNPNPHEPPRW
FT                   MRFPIEFLVFACLIVGIVPSLSIGPFLHSAVLSVLGAQTPVYSLSIWHGFNLPLIMSIA
FT                   ALIGGVTIYALLGGYFSRCDDGPPIFRHLRGQRIFERILVTVSWKWARWLESTLGTRRL
FT                   QPQLRLLILVALLAGFSPLFLSEFSLSLPRVTTFDPIFAILWLIGMIAAMGAAWQAKYH
FT                   RLAALIMLGVSGLVTCLTFVWLSAPDLAITQLLVEIVTTVLILLGLRWLPKRFEKVDSS
FT                   DELPAQLRRARDFLLAAASGIGMSVIAYAVMTLPVPNAIATYFLERAYTEGGGTNVVNV
FT                   ILVDFRGFDTFGEIAVLAIVALTVFALLRRFRPAHESIGVPEQQQMQNAFDAERPDRSK
FT                   GDTVRDYLYVPSIVMQWMFPVIVTFSIFLFIRGHDMPGGGFAAGITMAIAFLLQYLAGG
FT                   ARWAEDRIRILPLRWMGFGLLMAAATGIGSWYFGYPFLTTYFQYTDIPYIGKMPTASAL
FT                   LFDLGVFATVVGSTVLILIALAHQSLRNYRVRTPEAAKAEDV"
FT   gene            complement(503248..503625)
FT                   /locus_tag="Atu0513"
FT                   /old_locus_tag="AGR_C_905"
FT   CDS_pept        complement(503248..503625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0513"
FT                   /old_locus_tag="AGR_C_905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86327"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK77"
FT                   /protein_id="AAK86327.2"
FT                   /translation="MEKGRSSRRHPQVLIGLVVASLLVMIGFQVPSGVKALSKASRLER
FT                   LQTVDLSRSLSLRDKDCDSGNDYTCRSSDTGRGFQHGEFPSPALSITENTKASLVAVAI
FT                   VPQAFRDFASVVPRAPPHIMY"
FT   gene            504030..505736
FT                   /locus_tag="Atu0514"
FT                   /old_locus_tag="AGR_C_907"
FT   CDS_pept        504030..505736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0514"
FT                   /old_locus_tag="AGR_C_907"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86328"
FT                   /db_xref="GOA:Q7D1B0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1B0"
FT                   /protein_id="AAK86328.2"
FT                   /translation="MGMFVQKSLEGAGVLNLGQLAGFYRPSCCWGRRLGHDLPSDQARR
FT                   SAGGSLAGRLRFAGLDEMQSDFLRNYRGMLEPYVKAGLRDVMTRFQSMPDCSPSFESEN
FT                   QLDRLHDLQSSHWSVLTDARFDALYAERVKVLSDNAGRMGLDPRWQIASHAVVLEHLLG
FT                   GLVAEHAPRSILPGNRKKSRELADAVKNVVRLVMVDTEIAVSLRFNELRLRHGRELQEQ
FT                   RENDRSEAANLLGTALTAFAAGNLQARIGDDVPDAYRDVAATFNTALETIGASLIAAQN
FT                   GVGEAEALSARFADIGRSIAERSRQQAEALTETSRALQVMIAHVAENGARISATEKAVS
FT                   SARDAAVESGRAIGEAIDAMSDIEQSAEQIGRIIGTIDEIAFQTNLLALNAGIEAARAG
FT                   DSGRGFAVVAQEVRALAQRSADAAREIKSLVGSTKTQVEGGVRMVNRTQEAIGGVVRQV
FT                   SGINDMIAEVSRHTADHAGELQSVAGDIDEQQRQAGRNVADMGASASEADALHTVILEL
FT                   GRTVRAFRIARQEHFAAAAGADWQHSSFMARGDNRTDNSQNYQQFRRQGVM"
FT   gene            505736..506035
FT                   /locus_tag="Atu0515"
FT                   /old_locus_tag="AGR_C_908"
FT   CDS_pept        505736..506035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0515"
FT                   /old_locus_tag="AGR_C_908"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86329"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A9"
FT                   /protein_id="AAK86329.1"
FT                   /translation="MAARKAAEATLKLSPVLDLNEASALHGKLMTLRGAPLSVDASEVE
FT                   RIGALCAQVLMAGAKSWEEDGKPFGFARVSDAFDKTMKLIGVDIDHLLPKEMQK"
FT   gene            506032..506397
FT                   /gene="cheY"
FT                   /locus_tag="Atu0516"
FT                   /old_locus_tag="AGR_C_909"
FT   CDS_pept        506032..506397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="Atu0516"
FT                   /old_locus_tag="AGR_C_909"
FT                   /product="chemotaxis receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86330"
FT                   /db_xref="GOA:Q7D1A8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A8"
FT                   /protein_id="AAK86330.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEQS
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
FT   gene            506474..508687
FT                   /gene="cheA"
FT                   /locus_tag="Atu0517"
FT                   /old_locus_tag="AGR_C_912"
FT   CDS_pept        506474..508687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="Atu0517"
FT                   /old_locus_tag="AGR_C_912"
FT                   /product="Chemotaxis protein histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86331"
FT                   /db_xref="GOA:A9CK76"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK76"
FT                   /protein_id="AAK86331.2"
FT                   /translation="MESGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVAFAH
FT                   VFETTLDCVRSNKLEPTQDVLKVMLRSADVLADLTNAARDGGSVDESRTRGLVKELEAL
FT                   ANGEAVPASAPAPVAVKAPEPVKAPAAPKPTDESGFEPIPFSFSDFADETTPLMEVPTF
FT                   QITFKPHASLYSKGNEAALLLRDLSRIGDMSVNCDMSDLPALDKLDPEASYLSWTVSIA
FT                   TEKGEEGIRSVFEFAEWDCDLEITAVVSDASADEEELPMIPVPFDLSALDGDAQDEPAV
FT                   ATPAMEDAYVAATVEAAVATTQIAQSVNAAIEKREAAAAPAAAQANANAAANASAGQTI
FT                   RVDLDRVDRLINLVGELVINQAMLSQSVIENDASGTSAVNMGLDELQQLTREIQDSVMA
FT                   IRAQPVKPVFQRMSRIVREVADMIGKQIRLVTEGENTEVDKTVIDKLAEPLTHMIRNAV
FT                   DHGIETPEKREAAGKNPEGTIKLSAKHRSGRILIELQDDGAGINRERVRQKAIDNDLIA
FT                   ADANLTDEEIDNLIFAPGFSTADKISDISGRGVGMDVVKRSIQALGGRISISSRPGLGS
FT                   TFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQPEAKNIHSFGSNQRLISIRNSF
FT                   CPLVDVGRVLNFRPTQADPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTH
FT                   VPGIAAATILGDGRVALILDVDAIVSASRGQPLKQEMSLAATG"
FT   gene            508701..509609
FT                   /gene="cheR"
FT                   /locus_tag="Atu0518"
FT                   /old_locus_tag="AGR_C_914"
FT   CDS_pept        508701..509609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="Atu0518"
FT                   /old_locus_tag="AGR_C_914"
FT                   /product="chemotaxis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86332"
FT                   /db_xref="GOA:Q7D1A6"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A6"
FT                   /protein_id="AAK86332.1"
FT                   /translation="MAALNLSDQRQSPDDVLASGEYPLTRRDLSEIAAMIYADAGIYLN
FT                   DTKASLVYSRLSKHIRNLGLSGFREYCALVSSSEGAQPRREMLSHLTTNFTRFFRENHH
FT                   FEHLRDEVLPGLIARAKSGGRVRIWSAACSDGQEPYSIALTVLAMFPNAADYDFKILAT
FT                   DIDPKILAQARAGVYDDNALETVSPAMRKQWFTEVDAGGRRKFRIDDKVKRLITFNELN
FT                   LMTQWPFKGNFDVIFCRNVVIYFDEPTQVRIWSRFAGLLPEGGHLYIGHSERVSGDAKN
FT                   VFDNTGITTYRFIGHASGRKA"
FT   gene            509606..510661
FT                   /gene="cheB"
FT                   /locus_tag="Atu0519"
FT                   /old_locus_tag="AGR_C_916"
FT   CDS_pept        509606..510661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="Atu0519"
FT                   /old_locus_tag="AGR_C_916"
FT                   /product="protein-glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86333"
FT                   /db_xref="GOA:O85128"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:O85128"
FT                   /protein_id="AAK86333.1"
FT                   /translation="MSALARVLVVDDSPTMRGLISAVLKADPEVEVVGQAGNAMEARAA
FT                   IKQLNPDVVTLDIEMPEMNGLEFLEKIMRLRPMPVIMVSSLTHRGADASLAALEIGAFD
FT                   CVGKPAPGDARPFGDLADKVKAAARSQHAAYRATRPETAAAPQPVPMSEYRAGRKVVAI
FT                   GSSTGGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRICAPVVEEATDGARL
FT                   QTGKIYLAPGGERHLQIANRSAPCCRLLDRDPVNGHRPSVDVLFDSVAELAGRNAVGVI
FT                   LTGMGRDGAAGLLKMRHAGARTVGQNEKTCVVYGMPRVAYELGAVEQQLPLASIGEEIL
FT                   KLTTARKEGAD"
FT   gene            510661..511050
FT                   /gene="cheY"
FT                   /locus_tag="Atu0520"
FT                   /old_locus_tag="AGR_C_917"
FT   CDS_pept        510661..511050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="Atu0520"
FT                   /old_locus_tag="AGR_C_917"
FT                   /product="chemotaxis receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86334"
FT                   /db_xref="GOA:Q7D1A5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A5"
FT                   /protein_id="AAK86334.1"
FT                   /translation="MSLAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGLK
FT                   IMEQQPHHLVISDFNMPKMDGLGFLHAVRANPTTKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIDKMRAAIEAVFGSLK"
FT   gene            511047..511592
FT                   /gene="cheD"
FT                   /locus_tag="Atu0521"
FT                   /old_locus_tag="AGR_C_918"
FT   CDS_pept        511047..511592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="Atu0521"
FT                   /old_locus_tag="AGR_C_918"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86335"
FT                   /db_xref="GOA:Q7D1A4"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7D1A4"
FT                   /protein_id="AAK86335.1"
FT                   /translation="MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGL
FT                   GGMNHFLLPGTGNVTGGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIASFS
FT                   NVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEFWPVSGRARQHPLSGAETQKTVAM
FT                   ETRPVPAPKPVANDIEFF"
FT   gene            511607..511990
FT                   /locus_tag="Atu0522"
FT                   /old_locus_tag="AGR_C_920"
FT   CDS_pept        511607..511990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0522"
FT                   /old_locus_tag="AGR_C_920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86336"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A3"
FT                   /protein_id="AAK86336.1"
FT                   /translation="MQLAEHTATTPFEEALPDVLMRVVSELHDVAYLIERIEPQLLDVT
FT                   SGQLSAEGVKLLQGIDLAVQKTRGLAEFIDTITGSIPADWFVDVSTALSLVKLAEMQKA
FT                   LGAAFRHGHSQPLDKASGDFDLF"
FT   gene            512099..513799
FT                   /gene="fliF"
FT                   /locus_tag="Atu0523"
FT                   /old_locus_tag="AGR_C_922"
FT   CDS_pept        512099..513799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="Atu0523"
FT                   /old_locus_tag="AGR_C_922"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86337"
FT                   /db_xref="GOA:Q7D1A2"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A2"
FT                   /protein_id="AAK86337.1"
FT                   /translation="MTVRNRMNLLNQIPQVLKNVAALGQTRLLMLGGVGVLSMAIILAA
FT                   ALYVNRPAYETLYVGLEKSDLNKISIALAESGLDFQVGTDGSSLQVPVGLTSKARLLLA
FT                   ERGLPDSANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIGRSIQQIDGVSAARVHIVL
FT                   PDVGNFRRGEQKPTASVMIRASASAGRKASASIRHLVASAVPGLEVDDVTLLDSTGQLL
FT                   ASGDDVTNAAMNRSLTLAQNVQQEITTNIDKALAPFLGIDNFRSSVTAQINTDSRQVQE
FT                   TVYDPESRVERSVRTVKEDQKSQETQPDTAATVEQNVPQAAPQGGGGGPQSSDQSAKKE
FT                   EQTNYEINSKTVATVKNGYTLEKISVAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIV
FT                   TSAAGISSDRGDIVTLTAMDFLETQLLDEAASGPGVMEVLSRNSAGIINSLAFVAVAFL
FT                   VVWLGVRPLVRTVTANGSAAAQLSQESAGLELPDFSPGMEAGAGGLMEGFGADFGFDST
FT                   DDLLAGGDGEGTFNRRVREGPERRLSRMVEISEERAAKILRKWAVEKAA"
FT   gene            514221..514901
FT                   /gene="luxR"
FT                   /locus_tag="Atu0524"
FT                   /old_locus_tag="AGR_C_926"
FT   CDS_pept        514221..514901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="Atu0524"
FT                   /old_locus_tag="AGR_C_926"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86339"
FT                   /db_xref="GOA:A9CK75"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK75"
FT                   /protein_id="AAK86339.2"
FT                   /translation="MGKPLPRDQLAKNVAATAAAGNVAGALDLLVTYAGASHYLLARDD
FT                   LLEETGLKFIVTSDWPFDLVRRLGIELTNSQNRSSEMEKCLSLLQPRLLLLPDDVSVPY
FT                   GIDRQYSALSFCVGRIRLSLLLLFPEEAVPSPERLREIALLTGYCVSFGIASEAKTVRD
FT                   IDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAYAVR
FT                   NNLV"
FT   gene            514901..515656
FT                   /gene="agrR"
FT                   /locus_tag="Atu0525"
FT                   /old_locus_tag="AGR_C_927"
FT   CDS_pept        514901..515656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrR"
FT                   /locus_tag="Atu0525"
FT                   /old_locus_tag="AGR_C_927"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86340"
FT                   /db_xref="GOA:Q7D1A0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D1A0"
FT                   /protein_id="AAK86340.1"
FT                   /translation="MVGRMVQTKDNEGTGRMGMFYRSPVVTSRSDLFPKLVAMQKLVGA
FT                   RNFVVTKAAASGFPNKKKMTCELENWGMNAAEQSAQFIRAVGDILLDHIETSLLPVIWR
FT                   NKNAGGFADLPDVPALLRRIENDTLPYAGLALPVRLGTIGNGYIVFCGTNLILDNEVVI
FT                   EQHIKCCEIMVDMLALDERKVAPSEALSEREIACLQLAGDGRISEEIAVKLGLSVHTVN
FT                   AYLGSATIKLDSVNRIQAIAKAIRLGYIH"
FT   gene            515805..517652
FT                   /gene="mclA"
FT                   /locus_tag="Atu0526"
FT                   /old_locus_tag="AGR_C_929"
FT   CDS_pept        515805..517652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mclA"
FT                   /locus_tag="Atu0526"
FT                   /old_locus_tag="AGR_C_929"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86341"
FT                   /db_xref="GOA:Q7D199"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D199"
FT                   /protein_id="AAK86341.2"
FT                   /translation="MHNRLFKSVAGKVVALTIGLITLSVAAVGFSTYIRLKDNIITTAL
FT                   RDTHGAMRGMAILYEMKVGGVALEMVDGDLKSVGRASIGTMRDNDLVDRTAAGNGGIAT
FT                   VFEAKAGEFIRLTTNLKNEKGERAAGTKLATDHPAFEKVSKGEAYFGTATLFGTSYMTG
FT                   YMPVTNKTGATVGILFVGVPMDFYNAQIYSLRDMMVVCGALAMLGVGLLAYFVIKRTLQ
FT                   PLSKLTDAVKSLSDGDLETPIPYATNTNEFGNIARALVIFRENAIEKLAIEGKSAQERS
FT                   AAESERHRNDAEKQELDGQIEFAVGEIASGLGRLSRGDLSRTIETPFAGRLDRLRTDFN
FT                   ESLLNLRDALGQIRERTLIIQNSGIEIEQSSVDLSKRTENQAASLEETAAAVEEITATV
FT                   RSSAERAREANEAVRVTKQSADSSGSVVSNAVDAMSRIEGASRKIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKQLINQSTHEVSSGSKL
FT                   VQEAGTVLSAISRQIVTVSQHVETIATATQDQSSALHNVNGSVNQMDQMTQQNAALAEQ
FT                   SSAASRVLSGEVEALLDLVQRFQMEQGSAAGSGRLNRAA"
FT   gene            complement(517707..521216)
FT                   /locus_tag="Atu0527"
FT                   /old_locus_tag="AGR_C_932"
FT   CDS_pept        complement(517707..521216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0527"
FT                   /old_locus_tag="AGR_C_932"
FT                   /product="two component sensor kinase/response regulator
FT                   hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86342"
FT                   /db_xref="GOA:A9CK74"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK74"
FT                   /protein_id="AAK86342.1"
FT                   /translation="MLPGWIIFGSAFAYILLLFAVASYGDRKSRDRHAPKKGRPFVYAL
FT                   SLAIYCTSWTYFGGVGLAADKGLEFLGIYTGPILAFTLGMPIIRRIVDLAKTEKLTSVA
FT                   DFIAARYGKNSTVAMIVAIIALVGAIPYIALQLKAVSSSVATMVDPGDYGIGSGNLYFL
FT                   DLPLVVTLVMAGFAVMFGTRHTDATEHQDGLILAISMESLVKLVAMCTVGFYVLFVLFD
FT                   GPAHLWQLATDNEQAMRAISYHTPISRWIVMTLLSGFAIILLPRQFHVTVVENRTPEEL
FT                   RMAGFLLPLYLIAINIFVLPIALAGILTLGANGDADLYVLQLPLNHQMPVVSLITFIGG
FT                   FSAATAMVIVASVALSIMISNDIVMPIFLRQKLLNRSPHRDDFAKTLLNIRRTAIFAVM
FT                   LLGYGYYRAADSATGLASIGLLAFAAIAQMAPALFGGLFWRRANARGAIAGLSSGFFVW
FT                   AYLLFLPSFGGPDNSEVAANILGFLFSGSTVFNGPEADPFVNAVILSLLVNSLAFVLGS
FT                   LSRNPRPVERIQSGIFVKRHSKSQFATRGWKTRVSVGDLKSAIARYLGEERMLRSLATY
FT                   EKTAGRKLNDDQPADMALIHFSEQLLGSAIGSSSARLVLSIILQKAEDTSADTAWLLDQ
FT                   ASEALQYNQDMLQTALAQMDQGIAVFDSSQQLTIWNRRFRTLLDLPEQFGQVGVPLTEI
FT                   VTMLQERGDMPPGDTDELITSFLTMDLPFSLVLAGGERIIEVRSNTMPDKGIVATFTDI
FT                   TQRVASDQALKQANETLEQRVEERTVELTRVNRALAEARASADEANIGKTRFFAAAGHD
FT                   ILQPLNAARLYSSSLVERLGASGESDLVHNIDSALESVETILGAVLDISRLDTGSMKAR
FT                   MTSVPLNELLKRIETDFAPMAQEKNLDLVVMPTSLTVRSDPNLLRRLIQNLVSNAIKYT
FT                   LEGKVVVGARRRGGEVVIQVTDSGIGIPASKFRTVFKEFARLDEGAKTASGLGLGLSIV
FT                   DRLSRMLHHPVQLISTPGKGTTFRIHLPREADRLAPAKTEGGTTSPAASDRLHGIRVLC
FT                   IDNEPKILEGMTLLLTGWGCDVLPAGSVAALEEPFLTLAAAPDVIIADYHLDDGDGISA
FT                   IRLIRTFYGKTIPALLVTADRSPEVRSDAEKYGISVQHKPVKPAALRAYINQISGTARA
FT                   AAE"
FT   gene            521539..521967
FT                   /gene="mscL"
FT                   /locus_tag="Atu0528"
FT                   /old_locus_tag="AGR_C_934"
FT   CDS_pept        521539..521967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Atu0528"
FT                   /old_locus_tag="AGR_C_934"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86343"
FT                   /db_xref="GOA:Q8UHY0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHY0"
FT                   /protein_id="AAK86343.1"
FT                   /translation="MLNEFKTFIARGNVMDLAVGVIIGAAFSKIVDSVVNDLIMPIVGA
FT                   IFGGFDFSNYFLPLSSNVNATSLAAAREQGAVFAYGNFLTVLINFLILAWIIFLMVKGV
FT                   NKLRDSVDRKKIEEKPDAAPPPEDVKLLTEIRDLLKTR"
FT   gene            522122..523288
FT                   /gene="aspB"
FT                   /locus_tag="Atu0529"
FT                   /old_locus_tag="AGR_C_935"
FT   CDS_pept        522122..523288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="Atu0529"
FT                   /old_locus_tag="AGR_C_935"
FT                   /product="aspartate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86344"
FT                   /db_xref="GOA:Q7D196"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D196"
FT                   /protein_id="AAK86344.2"
FT                   /translation="MSILNSLSARSLAAPESGIVEVVNYARGRDNLLPLWVGEGDLPSP
FT                   DFINQAAIDGLNNGETFYTWQRGIPELRQALSHYYERHFAASLPPEHFYATGSGMQAIV
FT                   LAVQALTSPGDEMVYLSPTWPNIVAAIGVAGAKAVPVGIDFRDGRWDLDINRLESAITG
FT                   KTKALFINTPSNPTGWTATRDNLRDVLALARKHDLWIVADEIYALYHYAGSRAPSFLDV
FT                   MEPDDKIVFANSFSKNWSMTGWRVGWLVAPPAIGQVIENLIQYSTSGVAQFMQRGAVAA
FT                   LDHGDGFIRENYERALTSRDILCDALIATNRVETLKPDGALYAFLKIDGVTDSRATALD
FT                   IVDKTGVGLAPGTAFGPGGELFLRACFLRNPRQIEDAADRLASYILGR"
FT   gene            523619..524650
FT                   /gene="galE"
FT                   /locus_tag="Atu0530"
FT                   /old_locus_tag="AGR_C_938"
FT   CDS_pept        523619..524650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="Atu0530"
FT                   /old_locus_tag="AGR_C_938"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86345"
FT                   /db_xref="GOA:A9CK73"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK73"
FT                   /protein_id="AAK86345.1"
FT                   /translation="MAVLVTGGAGYIGSHMVWALLDAGEEVVVVDRLSTGSRWAVAPAA
FT                   RFYLGDAADRALLDQVFEENHIETIFHFAGSVSVPESISQPLEYYENNTGTTRALVAAA
FT                   VRSGIRNFIFSSTAAVYGNQPFDGPVPETAILSPENPYGLSKLASEIMLRDVVQAHDFN
FT                   YVALRYFNVAGADPQGRAGPSPTGVANLIKVACEAATGRRDRVEVYGTDYPTADGTGVR
FT                   DYIHVSDLIDAHMLAMAHLRAGGGTRTLNCGYGVGYSVLDVLQAVQRESACEFAVIHCP
FT                   RRPGDIAAMVADSSRIQSELGWRPRFNDLATIVRTALQWEAKRQAQQSGRIPPMRRKLA
FT                   AIG"
FT   gene            complement(524663..525415)
FT                   /locus_tag="Atu0531"
FT                   /old_locus_tag="AGR_C_940"
FT   CDS_pept        complement(524663..525415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0531"
FT                   /old_locus_tag="AGR_C_940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D194"
FT                   /protein_id="AAK86346.2"
FT                   /translation="MLLANDKKHLKSLLTYLNLAPATRFAEPPPKMKHAKRQKLAARTV
FT                   YLPPHLLKFERAGDRPSFARDFVISGKDLCDRFTAAGFSNPKGWQASPVSIRNFECMAD
FT                   LAAVKAEDPAQRASLFIDIRGEASGDIRSIRIKAVAPETPDGAAILTKLEKTLTLVIAQ
FT                   THWTDLASMLEPARRMQAYQAQHFGISVSIKPEPTAPHRLNVILLASEEPPGVKLTRAF
FT                   FDRDRWLRPAALSDRPIPHPSVTKSHVP"
FT   gene            complement(525399..525809)
FT                   /locus_tag="Atu0532"
FT   CDS_pept        complement(525399..525809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41550"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UHX6"
FT                   /protein_id="AAL41550.1"
FT                   /translation="MSPAVDAGKLSLLFGSLPLARSCPLAERLLRHSRCGRRKQRRWAG
FT                   RRQKQLRVRTRIAGNFGGKLQKIFQSLCSHLIFTGLPPARKAISESAEVFLRAPLRSCD
FT                   GRRLAKESELWRTAVCGVGRLFCHRGDGAACQ"
FT   gene            complement(525882..526505)
FT                   /gene="maf-2"
FT                   /locus_tag="Atu0533"
FT                   /old_locus_tag="AGR_C_943"
FT   CDS_pept        complement(525882..526505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-2"
FT                   /locus_tag="Atu0533"
FT                   /old_locus_tag="AGR_C_943"
FT                   /product="putative inhibitor of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86347"
FT                   /db_xref="GOA:Q8UHX5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHX5"
FT                   /protein_id="AAK86347.1"
FT                   /translation="MTNSKQKLVLASGSPRRLELLHQIGIEPARLMPMDIDETPVKLEH
FT                   PRTLCRRLSQQKAEAAQAALKSEQAWKDAYVLGSDTVVAVGRRIVGKAEYTEEASAALH
FT                   LLSGRSHWVYTGICLVTPDGKIRQKVAETKVRFKRLSTREIDAYIASGQWRGKAGAYGI
FT                   QGIAGAFVQKLTGSYTNVVGLPLYETMSLLSGEGFEVTSGWLEG"
FT   gene            complement(526539..526838)
FT                   /gene="infA"
FT                   /locus_tag="Atu0534"
FT                   /old_locus_tag="AGR_C_945"
FT   CDS_pept        complement(526539..526838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="Atu0534"
FT                   /old_locus_tag="AGR_C_945"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86348"
FT                   /db_xref="GOA:Q8UHX4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHX4"
FT                   /protein_id="AAK86348.2"
FT                   /translation="MCRDCVVSAQFSRTGHVRHYQQEENPYMTKEEVLEFPGIVTELLP
FT                   NATFRVKLENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            complement(526902..527390)
FT                   /locus_tag="Atu0535"
FT                   /old_locus_tag="AGR_C_946"
FT   CDS_pept        complement(526902..527390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0535"
FT                   /old_locus_tag="AGR_C_946"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86349"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D192"
FT                   /protein_id="AAK86349.2"
FT                   /translation="MSDPAAAPNEGRAPKSVLFMCGMNSIRSPMAEVIAKRLVASGIYI
FT                   QSAGVRAGERDPFVDAVLEEQGFSLGKHKPRTLDEIEDDFFDLIITLTPEAHHAALELT
FT                   RSNSLDVVYWPTMDPTVITGTREQILDAYREVRDHLAKLIAERLPKRQQPVADALSKD"
FT   gene            complement(527393..527866)
FT                   /locus_tag="Atu0536"
FT                   /old_locus_tag="AGR_C_947"
FT   CDS_pept        complement(527393..527866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0536"
FT                   /old_locus_tag="AGR_C_947"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86350"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHX2"
FT                   /protein_id="AAK86350.1"
FT                   /translation="MASGDFRLCDVVLDDSIGRSTPDVEHERAVAIFDLIEENTFEPAG
FT                   HDGGPYRLHISLVDAKLVFAIKTEDDKDVSTHILSLTPFRRIIKDYFLICESYYEAIRS
FT                   STPSQIEAIDMGRRGIHNDGSQTLMDRLSGKIKVDFDTARRLFTLVCVLYWRG"
FT   gene            complement(527870..529168)
FT                   /gene="hisD"
FT                   /locus_tag="Atu0537"
FT                   /old_locus_tag="AGR_C_948"
FT   CDS_pept        complement(527870..529168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="Atu0537"
FT                   /old_locus_tag="AGR_C_948"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86351"
FT                   /db_xref="GOA:Q8UHX1"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHX1"
FT                   /protein_id="AAK86351.1"
FT                   /translation="MAIWLERASADFEQKFAAFLTTKREVSEDVNATVRDIINDVRHRG
FT                   DAALAHYSQKFDGIDFTRVSMRVTADEIDAAFSAVDRAVIEALELAARRIEKHHARQMP
FT                   KDDIYEDDIGVGLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERIVMVVPA
FT                   NGGAVNPAVLAAARIAGVEEIYRIGGAQAVAALAYGTETIAPVAKIVGPGNAYVAAAKR
FT                   QVFGTVGIDMIAGPSEVLVIADKDNDPDWLAADLLAQAEHDRGAQSILITDNADLGKAV
FT                   GAAVERQLKLLSRSETAAASWADFGAIILVEKLTDAIPLANRIAAEHLELAVDDPDALM
FT                   AHIRNAGAIFVGRHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPE
FT                   QLRQLAPAAITLAHSEGLDAHARSVSIRLNPES"
FT   gene            complement(529302..529742)
FT                   /locus_tag="Atu0538"
FT                   /old_locus_tag="AGR_C_950"
FT   CDS_pept        complement(529302..529742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0538"
FT                   /old_locus_tag="AGR_C_950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86352"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D191"
FT                   /protein_id="AAK86352.2"
FT                   /translation="MSGLKLLALDTEDLSIISTHMQDSVFKLKDVAFEPRQGQFTLSAN
FT                   RFVWESASKKNLPPERCRSVIFLKRVSAVRSQSINLADREQVLSLLAIRFTPDGEGPDG
FT                   VVELALSGGGTIALDVECIEAQLTDVSGAWETAAKPHHPDSE"
FT   gene            complement(529856..531148)
FT                   /gene="murA"
FT                   /locus_tag="Atu0539"
FT                   /old_locus_tag="AGR_C_953"
FT   CDS_pept        complement(529856..531148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="Atu0539"
FT                   /old_locus_tag="AGR_C_953"
FT                   /product="UDP-N-acetylglucosamine"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86353"
FT                   /db_xref="GOA:Q8UHW9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHW9"
FT                   /protein_id="AAK86353.1"
FT                   /translation="MDRIRITGGNKLNGVIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVEQLIRILGNHGVDISVNGRRESQGEAYSRTVHFTCRTIVDTTAPYELVSKMRAS
FT                   FWVIGPLLAREGRARVSLPGGCAIGTRPVDLFIEGLQALGATMEIDGGYINASAPKGGL
FT                   IGAVYTFPKVSVGATHVMLMAASLARGTTVIHNAAREPEVVDLAHCLIAMGAKIEGAGT
FT                   STITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLEGTRASLLDNALDTLRLA
FT                   GVTISDTDTGLRVVRNGNGIQPVDIVTEPFPGFPTDLQAQFMALMTRSQGVSHITETIF
FT                   ENRFMHVQELARLGAKISLSGQMARIEGVTRLKGAPVMATDLRASVSLVIAGLVAEGET
FT                   MVSRVYHLDRGFERLEEKLTRCGALVERVSD"
FT   gene            complement(531251..531517)
FT                   /locus_tag="Atu0540"
FT                   /old_locus_tag="AGR_C_956"
FT   CDS_pept        complement(531251..531517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0540"
FT                   /old_locus_tag="AGR_C_956"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86354"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D190"
FT                   /protein_id="AAK86354.1"
FT                   /translation="MNEQHDKQAKAAVSVDISKEPSAVVANGNTQAGPGEKARQREAER
FT                   KARAAKKLRENLLKRKQQVRARRAGEEDQTIGLPAAKTDESSS"
FT   gene            531673..531747
FT                   /locus_tag="Atu0541"
FT   tRNA            531673..531747
FT                   /locus_tag="Atu0541"
FT                   /product="tRNA-Thr"
FT   gene            complement(531936..532877)
FT                   /gene="fla"
FT                   /locus_tag="Atu0542"
FT                   /old_locus_tag="AGR_C_958"
FT   CDS_pept        complement(531936..532877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fla"
FT                   /locus_tag="Atu0542"
FT                   /old_locus_tag="AGR_C_958"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86355"
FT                   /db_xref="GOA:Q7D189"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D189"
FT                   /protein_id="AAK86355.1"
FT                   /translation="MTSILTNTAAMSALQTLRAISGQLEDTQSRVSSGLRVKSASDNAA
FT                   YWSIATTMRSDNMALSAVQDALGLGAAKVDVAYSAMESTVEVVKEIKSKIVAATEEGVD
FT                   KTKIQEEIDQLKKQLESIAQGASFSGENWLLGTGAKTVVSGFVRDGGGTVSVTKTDYTL
FT                   IDTTAGTTTANVLFGLTGSPATLDTTKGIIGQPGTASGISVWDIDLKLFNSATPPTYTI
FT                   GNLLTDVETAFQSISSASAALGSIKMRIGLQEDFVSKLTDSIDKGIGRLVDADMNEEST
FT                   KLKALQTQQQLGIQSLSIANTSSENILSLFRQ"
FT   gene            complement(533119..534081)
FT                   /gene="flaB"
FT                   /locus_tag="Atu0543"
FT                   /old_locus_tag="AGR_C_959"
FT   CDS_pept        complement(533119..534081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaB"
FT                   /locus_tag="Atu0543"
FT                   /old_locus_tag="AGR_C_959"
FT                   /product="flaB"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86356"
FT                   /db_xref="GOA:Q7D188"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D188"
FT                   /protein_id="AAK86356.2"
FT                   /translation="MTSIITNVAAMSALQTLRSIGQNMESTQARVSSGLRVGDASDNAA
FT                   YWSIATTMRSDNMALSSVSDALGLGAAKVDTASAGMSSAIDVVKEIKAKLVTATEEGVD
FT                   RTKVQEEIGQLQKQLASISQGASFYGENWLVGVSTLGAATPGTDPDKSVVAGFVRASGG
FT                   AVSVTTTKYALDNTATGNVLFGSVDGTGTPDASGILGTVGTFTTVAAQSVYTLDITQYA
FT                   AADRATNMAEALTLVENSLKAMTSAAAKLGSLSMRIGLQEDFASKLSDSVEKGIGRLVD
FT                   ADMNEESTRLKALQTQQQLGVQALSIANSNSESILSLFR"
FT   gene            complement(534107..534364)
FT                   /locus_tag="Atu0544"
FT   CDS_pept        complement(534107..534364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41561"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UHW6"
FT                   /protein_id="AAL41561.1"
FT                   /translation="MHPRGRIRKRMRPYLFFKLLQIRARAREGCNFNFAGNEFLSALIN
FT                   SLTKPALPNAHRNGELTLKISQLAGMMLCAVPGETGMSLL"
FT   gene            complement(534488..535408)
FT                   /gene="flaA"
FT                   /locus_tag="Atu0545"
FT                   /old_locus_tag="AGR_C_961"
FT   CDS_pept        complement(534488..535408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="Atu0545"
FT                   /old_locus_tag="AGR_C_961"
FT                   /product="flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86357"
FT                   /db_xref="GOA:Q7D187"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D187"
FT                   /protein_id="AAK86357.1"
FT                   /translation="MASILTNNNAMAALSTLRSIASDLSTTQDRISSGLKVGSASDNAA
FT                   YWSIATTMRSDNKALGAVSDALGMGAAKVDTASAGMDAAIKVVTDIKAKVVAAKEQGVD
FT                   KTKVQEEVSQLLDQLKSIGTSASFNGENWLVSSANATKTVVSGFVRDAGGTVSVKTTDY
FT                   ALDANSMLYTEGTPGTIDANSGILNATGATTTVGAKTYTQISVLDMNVGTDDLDNALYS
FT                   VETALTKMTSAGAKLGSLSARIDLQSGFADKLSDTIEKGVGRLVDADMNEESTKLKALQ
FT                   TQQQLAIQALSIANSDSQNILSLFR"
FT   gene            complement(535780..536517)
FT                   /gene="fliP"
FT                   /locus_tag="Atu0546"
FT                   /old_locus_tag="AGR_C_963"
FT   CDS_pept        complement(535780..536517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="Atu0546"
FT                   /old_locus_tag="AGR_C_963"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86358"
FT                   /db_xref="GOA:Q44344"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44344"
FT                   /protein_id="AAK86358.1"
FT                   /translation="MIRFLVTIAVLLALPGLANAQQFPSDLFNTQIDGSVAAWIIRTFG
FT                   LLTVLSVAPGILIMVTSFPRFVIAFSILRSGMGLASTPSNMILLSMAMFMTFYVMSPTF
FT                   DKAWTDGVQPLLQNQINEQQAVQRIAEPFRTFMNANTRDKDLKLFVDIARERGQVVMTD
FT                   NVVDYRVLVPAFMLSEIRRGFEIGFLIILPFLVIDLIVATITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFN"
FT   gene            complement(536514..537014)
FT                   /gene="fliL"
FT                   /locus_tag="Atu0547"
FT                   /old_locus_tag="AGR_C_964"
FT   CDS_pept        complement(536514..537014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="Atu0547"
FT                   /old_locus_tag="AGR_C_964"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86359"
FT                   /db_xref="GOA:Q7D186"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D186"
FT                   /protein_id="AAK86359.1"
FT                   /translation="MENEQAEGKKKSSPLVMTIAGVVILTLLGAGGGWLVGGMIAPKVA
FT                   ATEAHATAAAGGHGEKKGEGLDKIDAEANGIVQLDPITTNLAYPSTNWVRLEVALMFKG
FT                   PVEVGLAEDIHQDIMAYVRTVSLQQLEGPRGFQYLKDDIQERVDLRSQGRVSKVMFRTF
FT                   VIE"
FT   gene            complement(537041..537760)
FT                   /gene="flgH"
FT                   /locus_tag="Atu0548"
FT                   /old_locus_tag="AGR_C_967"
FT   CDS_pept        complement(537041..537760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="Atu0548"
FT                   /old_locus_tag="AGR_C_967"
FT                   /product="flagellar L-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86360"
FT                   /db_xref="GOA:Q44342"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44342"
FT                   /protein_id="AAK86360.1"
FT                   /translation="MSTRRLPALLLPLALLAGCQNNQTLKEIGNAPAMSPIGSGLQFSQ
FT                   TPQMGMYPKQPKHMASGYSLWSDSQGALFKDLRALNIGDILTVNIQINDKADFDNETER
FT                   NRTNASGLNWKAKAQILGWTPDADSSIKYGSDTDTQAKGKTKRSEKLTLLVAAVVTGIL
FT                   ENGNLIISGSQEVRVNHEIRILNVGGIVRPQDVDAQNIISYERIAEARISYGGRGRLTE
FT                   VQQPPVGQQVVDLFSPL"
FT   gene            complement(537757..538293)
FT                   /locus_tag="Atu0549"
FT                   /old_locus_tag="AGR_C_968"
FT   CDS_pept        complement(537757..538293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0549"
FT                   /old_locus_tag="AGR_C_968"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86361"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D185"
FT                   /protein_id="AAK86361.1"
FT                   /translation="MMERQTKNPLSNGLVRFAAVASLLFLLPVAGAESQQNVVSELSTQ
FT                   DEIQKFCTNIADAARDQRYLMQKQDLEKLQADVNERISVLENRKAEYEDWLARREHFLN
FT                   QAKSNLVDIYKTMKADAAAPQLEKMHVEIAAAIIMQLPPRQSGLILSEMDAQKAATVAG
FT                   IMSQAIDKNTSKDPS"
FT   gene            complement(538290..539411)
FT                   /gene="flgI"
FT                   /locus_tag="Atu0550"
FT                   /old_locus_tag="AGR_C_970"
FT   CDS_pept        complement(538290..539411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="Atu0550"
FT                   /old_locus_tag="AGR_C_970"
FT                   /product="flagellar P-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86362"
FT                   /db_xref="GOA:Q44340"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44340"
FT                   /protein_id="AAK86362.1"
FT                   /translation="MRVLRIIAAALVFSALPFLSTPPAQADTSRIKDIASLQAGRDNQL
FT                   IGYGLVVGLQGTGDSLRSSPFTEQSMRAMLQNLGITTQGGQSNAKNIAAVMVTANLPPF
FT                   ASPGSRVDVTVSSLGDATSLRGGNLIMTSLSGADGQIYAVAQGALIVNGFSAQGDAATL
FT                   TQGVTTSARVPNGAIIERELPSKFKDSVNLVLQLRNPDFSTAVRVADVVNAFARARYGD
FT                   PIAEPRDSQEIAVQKPRVADLTRLMAEIENLTVETDTPAKVVINERTGTIVIGADVRIS
FT                   RVAVSYGTLTVQVTESPQVIQPAPFSRGQTAVQPQTDIMAMQEGSKVAIVEGPDLRTLV
FT                   AGLNSIGLKADGIIAILQGIKSAGALQAELVLQ"
FT   gene            complement(539408..539896)
FT                   /gene="flgA"
FT                   /locus_tag="Atu0551"
FT                   /old_locus_tag="AGR_C_971"
FT   CDS_pept        complement(539408..539896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="Atu0551"
FT                   /old_locus_tag="AGR_C_971"
FT                   /product="flagellar protein FLGA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86363"
FT                   /db_xref="GOA:Q44339"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44339"
FT                   /protein_id="AAK86363.2"
FT                   /translation="MRFGRNNSSCRTALVRMCLASAFSLGALAPALAQAPMALVPVRTI
FT                   YPGEAISPEQVKSVEVTNPNISAGYASDISEVEGMISKQTLLPGRTIPIAALREPSLVV
FT                   RGTSVKLVFHIGNMTLMASGTPMSDGSLGEVVRVRNIDSGVMVSGTVMKDGTIQVMAK"
FT   gene            complement(539917..540705)
FT                   /gene="flgG"
FT                   /locus_tag="Atu0552"
FT                   /old_locus_tag="AGR_C_972"
FT   CDS_pept        complement(539917..540705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="Atu0552"
FT                   /old_locus_tag="AGR_C_972"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86364"
FT                   /db_xref="GOA:Q44338"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44338"
FT                   /protein_id="AAK86364.1"
FT                   /translation="MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLY
FT                   QTERMQGVPNRANQAIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQ
FT                   IEAADGSTLYSRAGAFNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGN
FT                   AADFTQLGQLTIANFANEAGLKPLGDNLFSQTPASGAPVVGVPDDPSYGYVKQSYLEGS
FT                   NVDAVKEITDLITAQRAYEMNSKVITTADEMASIVSKNLK"
FT   gene            complement(540724..541062)
FT                   /gene="fliE"
FT                   /locus_tag="Atu0553"
FT                   /old_locus_tag="AGR_C_974"
FT   CDS_pept        complement(540724..541062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="Atu0553"
FT                   /old_locus_tag="AGR_C_974"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86365"
FT                   /db_xref="GOA:Q44337"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44337"
FT                   /protein_id="AAK86365.1"
FT                   /translation="MIDGIKQLGSLSLTRGASGVSSLTESLFGGEQQSTPAQQTGASFA
FT                   SVLGNVSMDAMNNLKKAEVASFEGIQGKANTREVVDAVLSAEQSLQTAIALRDKIVSAY
FT                   LDITKMQI"
FT   gene            complement(541059..541478)
FT                   /gene="flgC"
FT                   /locus_tag="Atu0554"
FT                   /old_locus_tag="AGR_C_975"
FT   CDS_pept        complement(541059..541478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="Atu0554"
FT                   /old_locus_tag="AGR_C_975"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86366"
FT                   /db_xref="GOA:Q44336"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44336"
FT                   /protein_id="AAK86366.1"
FT                   /translation="MDPLSAASKIAGSGLEVQSTRLRIVSENIANARSTGDTPGADPYR
FT                   RKTVTFGSELDHVSGVERVKVKKLGVDRGDFVHEYDPGNPAADTNGMVKMPNVNVLIEM
FT                   ADMREANRSYDANLQVIRQTRDLVASTIDLLKASQ"
FT   gene            complement(541482..541874)
FT                   /gene="flgB"
FT                   /locus_tag="Atu0555"
FT                   /old_locus_tag="AGR_C_976"
FT   CDS_pept        complement(541482..541874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="Atu0555"
FT                   /old_locus_tag="AGR_C_976"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86367"
FT                   /db_xref="GOA:Q44335"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44335"
FT                   /protein_id="AAK86367.2"
FT                   /translation="MQPIQLFELASRQAEWLSVRQEVVATNIANANTPKFHAKDVSPFE
FT                   AVMQATSQQVGMARTNPAHLGESTLSENIAVRDNPVNNEIGMQESGNSVGLAEEMTKTG
FT                   EIKRQYDLNASLVKSFHRMMLMTVKR"
FT   gene            complement(542045..542449)
FT                   /locus_tag="Atu0556"
FT                   /old_locus_tag="AGR_C_978"
FT   CDS_pept        complement(542045..542449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0556"
FT                   /old_locus_tag="AGR_C_978"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86368"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK72"
FT                   /protein_id="AAK86368.2"
FT                   /translation="MKVAGGDRTRDLPHTGPREVFSVSPMAMTNRNKEDTPPAAELPDM
FT                   LTTATVNAGGKERQNNVAAGIEDQPFPGQTSFRLLHVSNGRALIEDSSGMYMVRVGSTL
FT                   PDNALLTKIEQRNGEWLIETSSGKTYHPEK"
FT   gene            complement(542613..544034)
FT                   /gene="fliI"
FT                   /locus_tag="Atu0557"
FT                   /old_locus_tag="AGR_C_980"
FT   CDS_pept        complement(542613..544034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="Atu0557"
FT                   /old_locus_tag="AGR_C_980"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86369"
FT                   /db_xref="GOA:O34171"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34171"
FT                   /protein_id="AAK86369.1"
FT                   /translation="MTMPESMLSESKLSGWAISPKLAQLASLAGHYADPEFSVAHGGHV
FT                   RTIAAGHYTVSGLSRHVRLGEFVAHRSATGIHLGEVVRVEPDICYVCPIEPGEPIGIHD
FT                   TVIRKGAFRVSPDESWCGRTINALGEPIDGQGPLASGIVRRSISNNAPPSMTRKRVETP
FT                   FKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSMLAKADAFDKVVIALVGERGREVR
FT                   EFIEDTMGDNMSKSVAVVATSDESPMLRKMAPLSAVTIAEHFRDQGDNVLLIIDSVTRF
FT                   AHAIREVAVASGEPPVARGYPASVFTELPRLLERAGPGAEGTGTITAIVSILVDGDNHN
FT                   DPIADSTRGILDGHIVLDRSLAEEGRYPPINPLASISRLAKKAWTPDQEKLVSRLKALV
FT                   HRFEETRDLRLIGGYRPGTDPDLDMAVKQVPIIYETLKQLPDEPAAQDAYADLATALRG
FT                   GAQNGQPQVNPRMRG"
FT   gene            complement(544046..544780)
FT                   /gene="flgF"
FT                   /locus_tag="Atu0558"
FT                   /old_locus_tag="AGR_C_982"
FT   CDS_pept        complement(544046..544780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="Atu0558"
FT                   /old_locus_tag="AGR_C_982"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86370"
FT                   /db_xref="GOA:Q7D183"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D183"
FT                   /protein_id="AAK86370.1"
FT                   /translation="MQSGLYVALSSQIALERRLTTISDNMANVNTVGFRGSEVKFDEMV
FT                   AKNHNDMNAKVAFVSQGNDYLSTRQGAFEQTGNSFDFAIKGDAWFALDTPDGQILTRDG
FT                   RFTMRPDGALISSSGYPVLDAGGGPIRLNPNGGPITVGLDGAIRQNDTIAASLGIFQAD
FT                   FSKGFLRHPNSGVKPVAQPVPVVNNHEVGVVQGYLEQSNVNGISQMTQLIQVNRAFESI
FT                   SSMMRDTESTFGEGIKTLGGAR"
FT   gene            complement(544782..545417)
FT                   /locus_tag="Atu0559"
FT                   /old_locus_tag="AGR_C_984"
FT   CDS_pept        complement(544782..545417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0559"
FT                   /old_locus_tag="AGR_C_984"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86371"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D182"
FT                   /protein_id="AAK86371.2"
FT                   /translation="MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLS
FT                   DNRYAELAKSLDFAGLGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERK
FT                   APTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGK
FT                   LLERFTIMWEMQNPSTTYDPLAVFGSSSGYGISPDLLISINSLKLGGK"
FT   gene            545748..546620
FT                   /gene="motA"
FT                   /locus_tag="Atu0560"
FT                   /old_locus_tag="AGR_C_985"
FT   CDS_pept        545748..546620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Atu0560"
FT                   /old_locus_tag="AGR_C_985"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86372"
FT                   /db_xref="GOA:Q44456"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44456"
FT                   /protein_id="AAK86372.1"
FT                   /translation="MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGF
FT                   IMANPMKVVKDSGKALGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNP
FT                   EESSIFQSAPSVLKNKELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYH
FT                   AITTMGDSFPAIGIVAAVLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNP
FT                   LASQVKIVRTKQHRLYIIVKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMM
FT                   NPGGENKAA"
FT   gene            546623..547582
FT                   /gene="fliM"
FT                   /locus_tag="Atu0561"
FT                   /old_locus_tag="AGR_C_987"
FT   CDS_pept        546623..547582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="Atu0561"
FT                   /old_locus_tag="AGR_C_987"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86373"
FT                   /db_xref="GOA:Q44457"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44457"
FT                   /protein_id="AAK86373.2"
FT                   /translation="MAKAAAQKASAPTIDTALLAKLTGGLTDRKTIAKIGADIGHLYSE
FT                   FLPDTFHSETGIAIDVEYIGSESGLMTDLIANVGQNVAVADCSLRNWCPNFMMAVGNGF
FT                   VIALMERMLGASPDSIGDPDERNLSHIELDLAAMVLGRIAGVLRSGVNAPGGFEATIDP
FT                   PFNANGKSAFDEMIAGLYGVTIRMKIDIGKVSSEFSLIVPQRPLLKTSIVAPKASAQAL
FT                   KKQEEWMDMISQQVKRSQVTLEARIKLETLTLRTISRLVAGDVIPFQDLKQDDIGVEVS
FT                   ANGSKLYNCEFGKSGDRYMVRVKNNVSTDDEILRHLMG"
FT   gene            547646..548185
FT                   /gene="fliN"
FT                   /locus_tag="Atu0562"
FT                   /old_locus_tag="AGR_C_988"
FT   CDS_pept        547646..548185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="Atu0562"
FT                   /old_locus_tag="AGR_C_988"
FT                   /product="flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86374"
FT                   /db_xref="GOA:Q57259"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q57259"
FT                   /protein_id="AAK86374.2"
FT                   /translation="MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDF
FT                   GDFGDFGSTDEVSTDNDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMD
FT                   IPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDD
FT                   TRFGVKLIEVLSTRKA"
FT   gene            548213..549256
FT                   /gene="fliG"
FT                   /locus_tag="Atu0563"
FT                   /old_locus_tag="AGR_C_989"
FT   CDS_pept        548213..549256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="Atu0563"
FT                   /old_locus_tag="AGR_C_989"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86375"
FT                   /db_xref="GOA:Q44458"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44458"
FT                   /protein_id="AAK86375.1"
FT                   /translation="MMDFEDFGNPLAGKPLSQADKAAAVLLAMGKGVAGKLLKFFTQHE
FT                   LQMIISSAQTLRVIPPDELAQIVAEFEDLFTEGTGLMDNAKAIESILEEGLTPEEVDSL
FT                   LGRRAAFQAYEASIWDRLQEAEPEFVGKFLLREHPQTIAYILSMLPSSFGAKVLLTIPE
FT                   EQRADIMNRTVNMKEVSPTAAQIIEKRVVNLINEIEAERNAGGSTKVADLMNELDKPQV
FT                   DTLLSSLETLSKEAANKVKPKIFLFDDLMFMPQRSRVLLLNDVSADVLTMALRGATVEI
FT                   KECVLSSISPRQRRMIESDLAVPQASLNTREVAIARRAVAQEAIRLANSGQIQLKDVAA
FT                   EEQSAAA"
FT   gene            549382..550464
FT                   /gene="flhB"
FT                   /locus_tag="Atu0564"
FT                   /old_locus_tag="AGR_C_991"
FT   CDS_pept        549382..550464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="Atu0564"
FT                   /old_locus_tag="AGR_C_991"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86376"
FT                   /db_xref="GOA:Q7D181"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D181"
FT                   /protein_id="AAK86376.1"
FT                   /translation="MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYC
FT                   YLVFFLPEGAGRLGVTLKDLFGQPEQWNLSTRPDALALLYFLGTSVAYLLMPAMIMFIV
FT                   FGLASSFLQNLPSPVLERVRPQWSRISPAKGFTRIYSKQGFVEFAKSVFKIMIVSIIMF
FT                   FALRGDFYSLIDLMFSDPQVIFVRVVEIVKKMMVVILLSTALLAAVDVLWTRHHWFSQL
FT                   KMTKHEVKEEYKQSQGDPVVKSRQRSIARDRARRRMINNVPRATLVIANPTHFAVALRY
FT                   VREEGDAPVVVAKGQDLIALKIRQIAEENNIPVFEDPPLARSMFAQVSVDSVIPPVFYK
FT                   AVAELVHRVYARTSSKIRVQ"
FT   gene            550470..550907
FT                   /locus_tag="Atu0565"
FT                   /old_locus_tag="AGR_C_992"
FT   CDS_pept        550470..550907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0565"
FT                   /old_locus_tag="AGR_C_992"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86377"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34167"
FT                   /protein_id="AAK86377.1"
FT                   /translation="MKKSAYSEQREMIVAEAINPIATELRLLDPADLISLLRFECYGSI
FT                   ADLVSSAAELYYHPGTINFGAGGEYKLEWEGVPEIVLDLELKPKGATVYARLILADRHA
FT                   AVEINHVSFQNPSENPDENTEFLQRSLTAARFVASRQGEAA"
FT   gene            550988..551200
FT                   /locus_tag="Atu0566"
FT   CDS_pept        550988..551200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41583"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UHW3"
FT                   /protein_id="AAL41583.1"
FT                   /translation="MARACPKPAGLCETRLRETGTPCKSVSLFVTYRINDLLTNGRSRW
FT                   LFQAIVDTHDAPARCRHRAGFFLKF"
FT   gene            551215..552507
FT                   /gene="flaD"
FT                   /locus_tag="Atu0567"
FT                   /old_locus_tag="AGR_C_996"
FT   CDS_pept        551215..552507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaD"
FT                   /locus_tag="Atu0567"
FT                   /old_locus_tag="AGR_C_996"
FT                   /product="flagellin protein FlaD"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86378"
FT                   /db_xref="GOA:Q7D179"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D179"
FT                   /protein_id="AAK86378.2"
FT                   /translation="MTSILTNAAAMAALQTLRMIDKNLETTQARVSSGFRVETAADNAA
FT                   YWSIATTMRSDNSALSAVQDALGLGAAKVDTAYDALESTIEVVKQIKAKLVAAYGVGAD
FT                   RGKIQDEIKQLQEQLKSISESASFSGENWLQASISNSGTPPVAESITKKVVASFTRTGS
FT                   GNVGVTTVDYTLDSSTVLFDLSGGKLGILDKNAVFVSKTETEVMQTSTTAGKTSQAGYV
FT                   VEKLSDAQIGALNATTTDTNTDPNLYSNGTDNYLRLAENVWVKATATNPSSGGTTVSPA
FT                   YRDTGSTDWFYDVSAGTASANRSLGFSVSTLDLGNLDVVAAAMGGFAGGGTTYTGADAI
FT                   DMMMSFVDKQLEAMTSTASSLGSLQSRISMQENFVSSLMDVIDKGVGRLVDADMNEEST
FT                   RLKALQTQQQLGIQALSIANANAENILQLFK"
FT   gene            552787..553443
FT                   /locus_tag="Atu0568"
FT                   /old_locus_tag="AGR_C_1000"
FT   CDS_pept        552787..553443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0568"
FT                   /old_locus_tag="AGR_C_1000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86379"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D178"
FT                   /protein_id="AAK86379.1"
FT                   /translation="MSASIARFLKDFGEAQPASPAFGDGLADADTDFASGFADITSGFD
FT                   DLTPVDAEGEKQAAYARGYEDATREITEKMQAEREELLAAHAAELEELRSVYLEETAVF
FT                   LSRRLREGIDAIAANLSEQTANILAPLLTEKLSLKAVSSLADVVRASMPDGEAVTLVVK
FT                   GPKNLFEQLKTQPGFEEETMKFTETADIDLSIELGESVFVTRMSAWASSLRKVMK"
FT   gene            553440..554741
FT                   /gene="motB"
FT                   /locus_tag="Atu0569"
FT                   /old_locus_tag="AGR_C_1002"
FT   CDS_pept        553440..554741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Atu0569"
FT                   /old_locus_tag="AGR_C_1002"
FT                   /product="flagellar motor protein, PAL/OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86380"
FT                   /db_xref="GOA:A9CK71"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK71"
FT                   /protein_id="AAK86380.1"
FT                   /translation="MSEGENHHHGKNEIIIVKRHKGGHDGAHGGAWKIAYADFMTAMMA
FT                   FFLVMWLVNAANEETKASVASYFNPIKLSDEKPSSKGLEKPADKEEGVQKKDQSNIQAE
FT                   KVTKGSAAATGEDLTSQTGEQSNFSEADFFENPYSVLAEIAQQVGQQANVSAKGEGGAA
FT                   DSGPATGASGGEAYRDPFDPDFWTQQVKITRADQKQVPSEAAQAADGKQQDVAAKEADK
FT                   SAEAVTLVQAGKPADKAEDGKSMEIAAVVPQQRPDAAEQAALAKPNPDQASKASDAEWE
FT                   KADTLREEIEKQISGITGKLSEGLVVTPAEGGLLLTISDQAETPMFNIGSAVPRGELVL
FT                   AMEKIGKLLQERGGSVVIRGHTDGRQFKGEANDNWRLSMDRAHSAYYMLVRGGLSEERV
FT                   KQVSGFADRRLQVPSNPLADANRRIEILLEADRG"
FT   gene            554738..556018
FT                   /locus_tag="Atu0570"
FT                   /old_locus_tag="AGR_C_1003"
FT   CDS_pept        554738..556018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0570"
FT                   /old_locus_tag="AGR_C_1003"
FT                   /product="Chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86381"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D176"
FT                   /protein_id="AAK86381.1"
FT                   /translation="MSVTKTSKRWLLLAATLCGLGSEPSKAFSQSQDNLMPYAMLRSLQ
FT                   FVQDSVAMGDHSASEMQRFLLQTIDERLKSAPSAIFKDPRNVDAALIYAMSGGNPATLE
FT                   LLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVPEYRGTRIGAYLALIGGNVTI
FT                   PRDPLAALTFYDIARLEAPGTIVEEAALRRSLAIAVEDGDATKGVDYAQRYARRFLHSP
FT                   YASQFADLLVSLVVKRADSIGEEAIQETFAMMDAERQKEAYLRLSRLAAISGKDSLARM
FT                   AAVKAKTLSPALPGTPEVQANLYESLSNIGTPDVVSAIEAIGQIPEAQLSDRDRALRDA
FT                   ARAIADQVVRPPSAETGVEAKAAATNEPGGTAPAKEAAVAADTKSIWRVETQKADDAGE
FT                   NVRQLVTSGRSKLDEIDSLLKKGEGAP"
FT   gene            556015..557364
FT                   /gene="motD"
FT                   /locus_tag="Atu0571"
FT                   /old_locus_tag="AGR_C_1005"
FT   CDS_pept        556015..557364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motD"
FT                   /locus_tag="Atu0571"
FT                   /old_locus_tag="AGR_C_1005"
FT                   /product="chemotaxis MotD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86382"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK70"
FT                   /protein_id="AAK86382.1"
FT                   /translation="MIDATINAIVNAPPPDARASGANARDDAKGGSFGDALSTVRDERS
FT                   PQSRHQDAGSAKEQHAKPDDEPEKTDAPVKRPPTFLNAIARDHAGEPRNHETVAEFQNA
FT                   LKTVRTSADNGKTGKKLKDETDRDAETAADTIDPKLAELKTVMIGAGDIATAKSPLEEI
FT                   AQAIAGKVDSVKSDRAEPVHGKAEPSLKDMPTKMELAKNETDTGAEGGNDASAFRFSSS
FT                   RSGTARALDMGTVQREGRVEFDVRDSSGKVADNVTVVDSRRFIGLAPSTNASALTGLIV
FT                   NDPEWVSAMQPGSSLSNAAAQSSTGKVVHTLKLHMTPIELGSVTMSLRLAGDELAVHMT
FT                   VESMAAYKKLQDDSKSILEGLKAQGLTVDNITISIASSDKSDQTGTQGNNQQNQQAQQQ
FT                   GQQASAGRNRDESGARDGRQGNGDNLGVHNEGMDGALGSGRSSADNGVYL"
FT   gene            557435..557878
FT                   /locus_tag="Atu0572"
FT                   /old_locus_tag="AGR_C_1007"
FT   CDS_pept        557435..557878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0572"
FT                   /old_locus_tag="AGR_C_1007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86383"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D174"
FT                   /protein_id="AAK86383.2"
FT                   /translation="MPEGILYSVGLTETGRKGRLDPNAMNIEGKPVFAASTEEAMVTFE
FT                   AAKRNGAKLIDLGCMQINHYFHGENFTSAREMFDPRRNVEYAAMFLRNLHNRHETWTMA
FT                   VARYHAGPNNDPAQKKYVCRVIANLVATGYGKWTANAKNFCDG"
FT   gene            558161..558832
FT                   /locus_tag="Atu0573"
FT                   /old_locus_tag="AGR_C_1009"
FT   CDS_pept        558161..558832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0573"
FT                   /old_locus_tag="AGR_C_1009"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86384"
FT                   /db_xref="GOA:A9CK69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK69"
FT                   /protein_id="AAK86384.1"
FT                   /translation="MIVVVDERELVKDGYTSLFGREGIPSTGFDPVEFGEWVSTAADSD
FT                   LAAVEAFLIGQGDRSFSLPKAIRDRTTAPVIAVSDQPSLEATLALFDSGVDDVVRKPVH
FT                   PREILARAAAIRRRLQVISNFTDAGPIRVFSDGRDPEVCGEVFALPRRERRILEYLIAN
FT                   RGRRVSKSQIFNAIYGIFDDDVEENVVESHISKLRKKLRKKLGYDPVDSKRFLGYSIDW
FT                   Q"
FT   gene            558938..560215
FT                   /gene="flgE"
FT                   /locus_tag="Atu0574"
FT                   /old_locus_tag="AGR_C_1012"
FT   CDS_pept        558938..560215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="Atu0574"
FT                   /old_locus_tag="AGR_C_1012"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86385"
FT                   /db_xref="GOA:A9CK68"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK68"
FT                   /protein_id="AAK86385.1"
FT                   /translation="MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSS
FT                   LVLPSSSGSYASGGVQSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGSGTPYLTR
FT                   AGSFQKNSEGYLENAAGFQLMGYPYGSNPPAAVVNGFTGLEAINVNNFGLTASPSTQGS
FT                   FPANLNRDDKAATAPLPSGNSATAAFGNKTSLTAFDSGGAKVLYDFYYTKTGDNTWEVA
FT                   VYRQDQSTNGGFPYTATPAANLVQTKVDLEFDPATNKLTTASPKSITIDDQVSGVPQAI
FT                   NIDLSQMTQFSAKFTPGTAVLNGNGPSQIKDVEIGKDGLVTAVYQDGGRRNIYQLALAT
FT                   VPSVDNLTPQNGNVYLPSNDSGVVTIGFPQSGSFGYIQKGALEGSNVDIASELTDMIES
FT                   QRIYTANSKVFQTGSDLMDVLINLKR"
FT   gene            560238..561716
FT                   /gene="flgK"
FT                   /locus_tag="Atu0575"
FT                   /old_locus_tag="AGR_C_1014"
FT   CDS_pept        560238..561716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="Atu0575"
FT                   /old_locus_tag="AGR_C_1014"
FT                   /product="flagellar hook associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86386"
FT                   /db_xref="GOA:A9CK67"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK67"
FT                   /protein_id="AAK86386.1"
FT                   /translation="MSLTSAMNTAQSIFNNTGKQTDVTSKNIANVGNANYVKRTAILGT
FT                   TMAGASIVSNGRAQNESLLRQTISSSSLASGQSSVLSGLEEIKSIFGGNNYESSPANYM
FT                   KELLKSLDGYAAKPSDAALAATAVTSASDVASSLNNASSELQGMRLRADKEMSLQVDKL
FT                   NGLLAKFEEANNEVKAQTAIGGDASDALDQRETLLKDISSIVGINVVNRPNNDVALYTT
FT                   DGATLFEIVPRSVTFKTQPGYDATTTGNAIYIDGVALKAGTGTNTTAAGSLQGLMQVRD
FT                   DLAPTMQSQLDEIARGLITMFAEKPADPTSGLPNMPGLFTYGSPAATTIPPDGVVSPGL
FT                   AASITVNPALIISKGGNPELLRDGGINGTDYVINTATSGGTGFSALIRSYVTAFDAPMN
FT                   FAASTRIDTNTSILKYGTNSMGWLEQERSGATSANEAKGALYERSAKSYSNNTAVSLDE
FT                   ELSLLMDIEQSYKAATKLVTTVDEMLKSLMDMVR"
FT   gene            561720..562823
FT                   /gene="flgL"
FT                   /locus_tag="Atu0576"
FT                   /old_locus_tag="AGR_C_1016"
FT   CDS_pept        561720..562823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="Atu0576"
FT                   /old_locus_tag="AGR_C_1016"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86387"
FT                   /db_xref="GOA:A9CK66"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK66"
FT                   /protein_id="AAK86387.1"
FT                   /translation="MKTSFISSLAMQNSMRSTILKAQLEMTNLNTELTTGKHADLGLTL
FT                   GANTARSLDLNRDIDRISSLVSVNSIATQRLKSSQTALDGMAKAAQEIQKVLVPNTSSE
FT                   APTLTTVSQTISNAFNNFTSFANTAVNGEFLFSGINTDVKPVDDYFADGSPLKAAYETE
FT                   LNAFMAAQTPPVGDFASLSKTQVEGFMTHIEGVFKGTTTVTNPPHTSLTAGQNYDFWTT
FT                   FGSKASNTNMTSRISQNEIVETSSNSNSQGMRYFALTAMTSMTFLDPKVDSGIREMVAM
FT                   KSVTNIGTAINGLNQQQSQLGLSESRVSKANDSLEAQKKIIETHLLDIEGIDTYEAKTR
FT                   LDLLQQQIEIAYSLTSRLQKMSLVNYL"
FT   gene            562858..563202
FT                   /gene="flaF"
FT                   /locus_tag="Atu0577"
FT                   /old_locus_tag="AGR_C_1017"
FT   CDS_pept        562858..563202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="Atu0577"
FT                   /old_locus_tag="AGR_C_1017"
FT                   /product="FLAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86388"
FT                   /db_xref="GOA:A9CK65"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK65"
FT                   /protein_id="AAK86388.1"
FT                   /translation="MYQFSYAEIMEDGVANAKDRERQALTKSIDLLVEARDSSSQRHSI
FT                   EALFYTRRVWIRFIEDLKQPDNQLAMELRANLISIAIWILKECELIRKRQSTNFQGIID
FT                   VTTIIRDGLK"
FT   gene            563199..563648
FT                   /gene="flbT"
FT                   /locus_tag="Atu0578"
FT                   /old_locus_tag="AGR_C_1018"
FT   CDS_pept        563199..563648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="Atu0578"
FT                   /old_locus_tag="AGR_C_1018"
FT                   /product="FlbT post-transcriptional regulator of flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86389"
FT                   /db_xref="GOA:Q8UHV1"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHV1"
FT                   /protein_id="AAK86389.1"
FT                   /translation="MKSTLRISLKSGEKIFINGAVLRVDRKVALEFLNDVTFLLENHVL
FT                   QPDQATTPLRQLYFIAQMILINPEGREQSTNMFRKSVSMLLNCFQHDEILAELKRIDGL
FT                   VASGKAFEALKAIRGLYTIEEKILSNQEMTPATIEQIRKEIAPWR"
FT   gene            563639..564112
FT                   /gene="flgD"
FT                   /locus_tag="Atu0579"
FT                   /old_locus_tag="AGR_C_1021"
FT   CDS_pept        563639..564112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="Atu0579"
FT                   /old_locus_tag="AGR_C_1021"
FT                   /product="hook formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86390"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK64"
FT                   /protein_id="AAK86390.1"
FT                   /translation="MAVDAVNSAAANPWANAGASSSDKNAASLNYDSFLKLLIAQMKNQ
FT                   DPTSPMDAGQQMSQLASFSQVEQTIKTNTHLKSMLQAEALTRASDLVGKTVMSADDKVT
FT                   GVVKEVQVFSDGIVAVTEAGDKVLLQAGVVFSNGPITTKSDETTADSNNSAGS"
FT   gene            564158..564424
FT                   /gene="fliQ"
FT                   /locus_tag="Atu0580"
FT                   /old_locus_tag="AGR_C_1023"
FT   CDS_pept        564158..564424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="Atu0580"
FT                   /old_locus_tag="AGR_C_1023"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86391"
FT                   /db_xref="GOA:A9CK63"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK63"
FT                   /protein_id="AAK86391.1"
FT                   /translation="MNEADALDIMQAAVWTVLVAAGPAVLAAMIVGVAIAFIQALTQVQ
FT                   EMTLTFVPKIVTIMIVLGVAAPFVGAQIVLFSNLVFSRIQSGF"
FT   gene            564582..566669
FT                   /gene="flhA"
FT                   /locus_tag="Atu0581"
FT                   /old_locus_tag="AGR_C_1027"
FT   CDS_pept        564582..566669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="Atu0581"
FT                   /old_locus_tag="AGR_C_1027"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86392"
FT                   /db_xref="GOA:Q7D165"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D165"
FT                   /protein_id="AAK86392.2"
FT                   /translation="MAQPPVISLPKVSPSMRDIGFALGIISILCVLFLPIPVMLVDIGL
FT                   AFSIALSVLILMVALWIQRPLDFSSFPTVLLIATMIRLSLNIATTRVILSHGNEGPTAA
FT                   GGVIAGFSSLVMSGDFVIGLIVFLILITVNFIVITKGATRIAEVGARFTLDAIPGKQMS
FT                   IDADLSAGIIDEKEAQRRRRELEEESSFFGSMDGASKFVRGDAIAGLIITAINVFGGII
FT                   IGYFRHGMPIGEAADVFVKLSVGDGIVSQIPALIVSLAAGLLVSRGGTAGSTDQAVINQ
FT                   LSGYPRALMVSAMLMGLLAVIPGLPFVPFIFLGGIMAFGSWYIPRQAEAESALRRQEEE
FT                   NKVLQTTEAEKDSVKQVLKTAEIELALGKQVSTRLLGAHQELAFRVGKMRKKFATQYGF
FT                   VVPEIKVSDDIMIPEKAYQIRVHGTTIASSNLRVGDVLVVTGAGRKPSIPGDEIREPAF
FT                   GMPAVSILETFTEDLKREGFHPIDNVSVVLTHLSEVIRNNLPQLLSYKDVKILIDRLDP
FT                   EYKKLADEICSSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRVRMSQQLCGDLADNGVLRVLRLGNKWDMVFHQALKRDQKGEIVEFDIDPRHLEEFSE
FT                   QASKVIREFMDRGLPFVLVTSPETRSYVRMIIERLFATLPVLSHVELAKGLEIKILGAI
FT                   S"
FT   gene            566699..567421
FT                   /gene="fliR"
FT                   /locus_tag="Atu0582"
FT                   /old_locus_tag="AGR_C_1028"
FT   CDS_pept        566699..567421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="Atu0582"
FT                   /old_locus_tag="AGR_C_1028"
FT                   /product="flagellar biosynthetic protein FLIR"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86393"
FT                   /db_xref="GOA:A9CK62"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK62"
FT                   /protein_id="AAK86393.2"
FT                   /translation="MFLAICRIGACFMTMPGFSSSRISPQIRMLLCVAVSMALLPVLWD
FT                   TIYPKVSGASQGAVVGLIFSEVLIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGAD
FT                   PIEDVQENQIANFITFGGLLVLFMMDFHHIVLKALVDSYSATPVGALISGQKMLITLTD
FT                   TLRASFSIMLRLASPFVIYGLMFNVAVGLINKLAPQIPVFFISTPFVLAGGLFMLYLSV
FT                   AALIRQFVDGFGPVFIGF"
FT   gene            567437..567856
FT                   /locus_tag="Atu0583"
FT                   /old_locus_tag="AGR_C_1030"
FT   CDS_pept        567437..567856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0583"
FT                   /old_locus_tag="AGR_C_1030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86394"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D163"
FT                   /protein_id="AAK86394.2"
FT                   /translation="MASDKRSEKLKRLVTVQRHMEKMAEVELADTTRVRSEVAQSMEST
FT                   FEAMSSMEPVHQTFSKHYSDRYSRLVVQDRQLEGVQQFQENKVLKEKTKADRLEDRMHI
FT                   ARDLEDREAGDNAIYDLLEITNVSHTPASSKVGDP"
FT   gene            567999..568526
FT                   /locus_tag="Atu0584"
FT                   /old_locus_tag="AGR_C_1032"
FT   CDS_pept        567999..568526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0584"
FT                   /old_locus_tag="AGR_C_1032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86395"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D162"
FT                   /protein_id="AAK86395.2"
FT                   /translation="MDVVRAADPQEVQVAQEKLKANKAAFAATSLADAGKGFGAAVDML
FT                   DGASSKAGLGDTNIRSARTEIPETYRKYEASVLQTFVANMLPKDSEEVYGKGNAGEIWK
FT                   SMMAEQFADTISRNGGVGIAEQAYKDALRKAESKGITDVSMNDKDHNAAIRMVAEFERQ
FT                   VLGVSNDKTDEA"
FT   gene            568556..568924
FT                   /locus_tag="Atu0585"
FT                   /old_locus_tag="AGR_C_1034"
FT   CDS_pept        568556..568924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0585"
FT                   /old_locus_tag="AGR_C_1034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86396"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D161"
FT                   /protein_id="AAK86396.2"
FT                   /translation="MDLMSNDHRIQSVLGRLEMIIDNENDNIGKDPQFDFKVSNAHKSR
FT                   CLYELTMLVRDTPHEDIAAGYMEQVKGIKSKLATNATRVEAHLNAVRAVADLLKNAIQE
FT                   ADTDGTYSQEQFLYGAAS"
FT   gene            568924..569457
FT                   /locus_tag="Atu8132"
FT                   /old_locus_tag="AGR_C_1036"
FT   CDS_pept        568924..569457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8132"
FT                   /old_locus_tag="AGR_C_1036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8132"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J5"
FT                   /protein_id="AAK86397.1"
FT                   /translation="MLKLLLTGVWVCAVTLGAVYFSVQMATAPAPDEAGAKKADLQLVK
FT                   GESITIPVINDGGVNGYFLSRISLRVDKAKMAKIELPATQLMTDELFTLLAGSSMVNIA
FT                   NISTFDPEAFKQRIREGLNKRLDDEVVEDVLIEQLDYLSKADIREQKGNGSPHSVKLVE
FT                   GEKAEAGEAAAPSH"
FT   gene            569641..570315
FT                   /gene="tagA"
FT                   /locus_tag="Atu0587"
FT                   /old_locus_tag="AGR_C_1038"
FT   CDS_pept        569641..570315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="Atu0587"
FT                   /old_locus_tag="AGR_C_1038"
FT                   /product="teichoic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86398"
FT                   /db_xref="GOA:A9CK61"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK61"
FT                   /protein_id="AAK86398.1"
FT                   /translation="MNFASGVTRRGLQRNIHGLRVCDLDWNGALELVSGKASACEGHTM
FT                   LSFLTIEKTKLSLKDNAYRQILESCLLLPQGKGMKAAARAEHGEPLPATIDGVAFTMAL
FT                   LTYMAVPKRIGVAGDDAAQIGEVLARLRAHAPWHDFVMLNRDAAGVKVDVLLAGMLKEN
FT                   QETWLHRSVSREDARVTIAVGPLFKVLSSEVAGMPDIFRKLHMSWLYSLCAEPWHIALG
FT                   KS"
FT   gene            570443..572206
FT                   /locus_tag="Atu0588"
FT                   /old_locus_tag="AGR_C_1041"
FT   CDS_pept        570443..572206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0588"
FT                   /old_locus_tag="AGR_C_1041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86399"
FT                   /db_xref="GOA:A9CK60"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK60"
FT                   /protein_id="AAK86399.1"
FT                   /translation="MVDDNPDMIAIRPEGDDVSAPVSQWRRHCLRLLTAGCVAAATFAG
FT                   AAIPLLLIDSGFRGYVSQARIEVTQTGYDAPDASRFLAMARRTLLSPSGLERVTADLKL
FT                   KPADMIGVRNQGELGLLVDLLTGAHARVVSPREALNGAVGEAIRLELTPDENMLVVTAK
FT                   AATPDMAMRLTDYLSMRVMADGKAGTMTPAMREMERARKKLDEAEAALNGFQMRHGDAV
FT                   MTEAQQLEQQLRDVNDSLARATRQQQSLQADLASALALKPNDVYSKPLPAGAAFSALED
FT                   VRQKQASASMALAGVSVDYGPKHPRRIAAQNAVDAAQALAAPALRQLLDGLRADEKRLN
FT                   QEIATATGEQKAYLDRLNALGVAPGEFSRLQSELETARNTYLEASERRDLTASATPALE
FT                   TRLAKKAAPGELSRDLTQAAMLAGGGALLGLLGSLYLLSYRRHDEEEEAVSAAETGKEP
FT                   APSVAAPQFSEFEQIEPAVFDDLQPVAAETTVEAEEDSFADYYGGAANDADDMPLDERV
FT                   RQVLMGNRTVRTVDPASSGLPPLLAEALAGRFDHAQAEAEELMELRRELAFLRERLADY
FT                   ADHREDYRKTA"
FT   gene            572284..573183
FT                   /gene="folD"
FT                   /locus_tag="Atu0589"
FT                   /old_locus_tag="AGR_C_1042"
FT   CDS_pept        572284..573183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="Atu0589"
FT                   /old_locus_tag="AGR_C_1042"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86400"
FT                   /db_xref="GOA:Q8UHU0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHU0"
FT                   /protein_id="AAK86400.2"
FT                   /translation="MAVVIDGKAKAASVTEAVRKSAEALEAEKGVKPGLAVVIVGNDPA
FT                   SHAYVNSKSKMAKQCGFNSIQHTLPEETTQAALLKLVGELNTDASIHGILVQLPLPKHF
FT                   NSDEIIQSILPEKDVDGLSVLNAGKLATGDLATGLISCTPAGAMLLVRGIHGDDLSGLN
FT                   AVVIGRSNLFGKPMGQLLLNANATVTMAHSRTKDLVTVCKTADILVAAVGRAAMVKGDW
FT                   VKPGATVIDVGINRIAAPEKGEGKSKLVGDVAFDEASAVAAAITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRALGKTAPKF"
FT   gene            complement(573201..574226)
FT                   /gene="aglR"
FT                   /locus_tag="Atu0590"
FT                   /old_locus_tag="AGR_C_1043"
FT   CDS_pept        complement(573201..574226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglR"
FT                   /locus_tag="Atu0590"
FT                   /old_locus_tag="AGR_C_1043"
FT                   /product="transcriptional regulator repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86401"
FT                   /db_xref="GOA:Q7D157"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D157"
FT                   /protein_id="AAK86401.2"
FT                   /translation="MNLKQLSQLLGISQTTISRALNGYPEVSAETRRRVMEAAEKTGYR
FT                   PNAAAQRLATGKVGSIGLVMPIGEHHRSDVHFGEFLSGLGEEASRSGFHLVIMPTEPEN
FT                   ERDALRGLAASGSVDGIYLAYMKNNDPRIAMMQSLSLPFLVHGRSVGVEEDYPYLDVDN
FT                   EGAFHDATQLLLQLGHTRIGLLNGPEGYDFTYRRCLGVEKALAANGLSLHPDNKRHSSM
FT                   TDEEGYLGMEALLSRPEKPTAILCASTALALGAIRSLNQRGLKPGRDISLIAHDDVLPL
FT                   LKPDNFSVPLTTTRSSLRAAGVRVGQRLINRIKLNQTEPHQELWKAELVVRASTGPAPK
FT                   A"
FT   gene            574504..575865
FT                   /gene="aglE"
FT                   /locus_tag="Atu0591"
FT                   /old_locus_tag="AGR_C_1045"
FT   CDS_pept        574504..575865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglE"
FT                   /locus_tag="Atu0591"
FT                   /old_locus_tag="AGR_C_1045"
FT                   /product="ABC transporter, substrate binding protein
FT                   (alpha-glucoside)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86402"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK59"
FT                   /protein_id="AAK86402.1"
FT                   /translation="MRKTLLATAASMVLLSGSVFAADLKFAPGADAKFNWKSYEDFKAA
FT                   HADLKGQTLTIFGPWRGEDEALFQSVLAYFADATGVNVRYSSSENYEQQIVIDTQAGSP
FT                   PNIAILPQPGLLADLAAKGFLVPLGDDTAKWVEENYGAGKSWVDLGSYKGKDGNKAYFA
FT                   FPFKADVKSLVWYVPENFEEAGYKVPESMEDLLKLTDQIVADGGTPWCIGLGSGGATGW
FT                   PATDWVEDLMLRTQPLDVYQKWTTNEVKFTDPAVVAAINEFGKFAKNEKYVSGGVAAVA
FT                   STDFRDSPKGLFDIPPKCYLHHQASFIPSFFPEGTKVGTDADFFYMPTYASKPELGKPV
FT                   LGAGTLVTVTKEAPAAKAFVEFLKTPIAHEVWMAQSSFLTPYKGVNVDTYANEQMKRQG
FT                   EILTTATTFGFDGSDLMPGKIGAGAFWTGMIDFVGGKSADQVAADIQKAWDGLK"
FT   gene            576114..577034
FT                   /gene="aglF"
FT                   /locus_tag="Atu0592"
FT                   /old_locus_tag="AGR_C_1048"
FT   CDS_pept        576114..577034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglF"
FT                   /locus_tag="Atu0592"
FT                   /old_locus_tag="AGR_C_1048"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86403"
FT                   /db_xref="GOA:Q7D155"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D155"
FT                   /protein_id="AAK86403.2"
FT                   /translation="MIFPVRSGDVIHASRNLNRRAAVRPWLFIGPALILLLVYLVYPVI
FT                   ATLILSFYDRTGAEFVGLANYRWAFFDAGFRQSIFNNILWLAVVPAACTFFGLVIAVMT
FT                   DRIWWGNIAKSIVFMPMAISFVGASVIWKFIYEYRAEGQVQIGLLNAVVEFFGGSPEVW
FT                   ISMPFWNNFFLMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGANGWQIFWKIMVP
FT                   QIWGTIAVVWTTITILVLKVFDIVLTMTNGQWNTMVLANLMFDWMFRGGGDSGRSAVIA
FT                   LIIMAAVTPIMVWNIRQANREMEGR"
FT   gene            577036..578196
FT                   /gene="aglG"
FT                   /locus_tag="Atu0593"
FT                   /old_locus_tag="AGR_C_1050"
FT   CDS_pept        577036..578196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglG"
FT                   /locus_tag="Atu0593"
FT                   /old_locus_tag="AGR_C_1050"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86404"
FT                   /db_xref="GOA:A9CK58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK58"
FT                   /protein_id="AAK86404.1"
FT                   /translation="MNIIKRLRRVGLPRLIVHASVLLVVLLWLLPTLGILVSSLRDKDQ
FT                   ITVSGWWTAFSSSEQTAAVRLADASVQKQDGSRYVIAGNVFENGQGGKVAAFGVRVQEP
FT                   TAFKAGEAADIGDGETLLVNSDGTYEYSKAVSFEGSRGKRVYISVATPPVFTLDNYRTV
FT                   LTSEGIGQSFVNSLTVAVPATVIPILIAAFAAYALSWMNFSGRNLLIAMVVGLIVVPLQ
FT                   MSLIPLLRLYNEIGTIFGVPSKTYAGIWLAHTAFGLPLAIYLLRNYISGLPKEIIESAR
FT                   VDGASDFEIFVKIILPLSFPALASFAIFQFLWTWNDLLVAMVFLGTQKDELVLTGALNA
FT                   LLGSRGGNWEILTASAFVTIIVPLGVFFALQRYLVRGLLAGSVKGG"
FT   gene            578234..579889
FT                   /gene="aglA"
FT                   /locus_tag="Atu0594"
FT                   /old_locus_tag="AGR_C_1051"
FT   CDS_pept        578234..579889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglA"
FT                   /locus_tag="Atu0594"
FT                   /old_locus_tag="AGR_C_1051"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86405"
FT                   /db_xref="GOA:Q7D153"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D153"
FT                   /protein_id="AAK86405.2"
FT                   /translation="MTASVTSALTPNKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITD
FT                   RLHHIAGLGADAIWISPFFTSPMKDFGYDVSNYVDVDPMFGTLADFDGLIAEAHRLGIR
FT                   VMIDLVLSHTSDQHPWFVESRASRNNPKSDWYVWSEAKPDGTPPNNWLSIFGGSGWQWD
FT                   PTRMQYYMHNFLTSQPDLNLHNPEVQEELLNITRFWLKRGVDGFRLDTINFYFHDLELR
FT                   DNPALAPERRNASTAPAVNPYNFQEHLYDKNRPENIAFLKRFRAVLDEFPDIAAVGEVG
FT                   DSQRGLEIVGEYTSGDDKMQMCYAFEFLAPDALTPQRVADVQADFARAAPEGWACWAFS
FT                   NHDVVRHVSRWGEHVEDKDAFAKLLSALLMTQRGSVCIYEGEELGLTEADIAFEDLQDP
FT                   YGIQFWPEFKGRDGCRTPMVWDAGHAQAGFSTSDKIWLPIPAEHKQRAVSAQQGNEASV
FT                   LEHYRRFLAFRKQHPAFAKGGIEFQPLEGDVLSYTRKLGNETILCLFNLSATPANATLP
FT                   KGNWEVLEGHGFASGLEGTSVELPAWGAFFARYA"
FT   gene            579911..580999
FT                   /gene="aglK"
FT                   /locus_tag="Atu0595"
FT                   /old_locus_tag="AGR_C_1052"
FT   CDS_pept        579911..580999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglK"
FT                   /locus_tag="Atu0595"
FT                   /old_locus_tag="AGR_C_1052"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86406"
FT                   /db_xref="GOA:A9CK57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK57"
FT                   /protein_id="AAK86406.1"
FT                   /translation="MTSLVLKDIRKSYGQVKVLHGIDLQIEQGEFIVFVGPSGCGKSTL
FT                   LRMIAGLEEITGGEMFIDGQLVNEIPPSRRGIAMVFQSYALYPHMTVYDNMAFGMKIAK
FT                   ENKQEIDRRVRAAAEILQLTQYLERLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSN
FT                   LDAALRVATRIEIAKLNEQMADTTMIYVTHDQVEAMTLADRIVVLNAGRVEQVGPPLEL
FT                   YERPANLFVAKFIGSPAMNIIAAKIVGTGERTSIELAGGKTLAVDVPTPATEQGKAASF
FT                   GVRPEDLSIVTGDDYLFEGKVAIVEALGEVTLLYLEAPKGQEPIIVKVPGIVSVGKGET
FT                   LRFAAPQEKLHLFDAAGKTYRP"
FT   gene            581170..581589
FT                   /locus_tag="Atu8133"
FT                   /old_locus_tag="AGR_C_1054"
FT   CDS_pept        581170..581589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8133"
FT                   /old_locus_tag="AGR_C_1054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8133"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86407"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J4"
FT                   /protein_id="AAK86407.1"
FT                   /translation="MGVQSGAGVIRNHYLSKEESFMYDRESRFRMEDTMNAARIEYTEK
FT                   AVMHMAARRCDVIRISQTEAVLALLTKYNLPNQFYLDIPDARISKIGCVILRVNANNTI
FT                   HVRFLRMLTQKELDRIFVFSTHPAHKDRKLDIRSF"
FT   gene            complement(581615..582976)
FT                   /locus_tag="Atu0597"
FT                   /old_locus_tag="AGR_C_1055"
FT   CDS_pept        complement(581615..582976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0597"
FT                   /old_locus_tag="AGR_C_1055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86408"
FT                   /db_xref="GOA:Q7D151"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D151"
FT                   /protein_id="AAK86408.2"
FT                   /translation="MIFSSKRRDVLKLMAGTAMLPLLLTATPVMAQDVALRAIIISDLH
FT                   SAYERIGQLLAAIETRIATDRVPHIILLNGDLFEIGNAVAARSAGEIEWTFLTALARLA
FT                   PTVINIGNHEPDIDNDLANFVTRAQALGITVLSNIIDKRSGKPYAPDRAEVKVGDRKVI
FT                   LAGLATNAINTYPKATREMLDIPQPVEWAKVNLPEIVKADAINIVLSHAGVVADRDILP
FT                   LLPDGTLLVGGHDHLNFVHEQGATRYVHTGSWCTSMTVATIAGPGKAAAIETVTIDRDA
FT                   PASPALKTLIEQTLEKHLTAEEREVVGKSVKAMTVDEAGRHVAQLIAAKTGADVGFVAH
FT                   TSFGAGLPNGDIRRYDFNASLRFDGKLMVTEVDGEALAQILKRCNQDGDIPLTERTGDY
FT                   LYAMPEKPEQKGRYKLVCNDWSATNQKSYFGRGDLTFTEVADVKLKQTVLGGLS"
FT   gene            complement(583195..585015)
FT                   /gene="edd"
FT                   /locus_tag="Atu0598"
FT                   /old_locus_tag="AGR_C_1060"
FT   CDS_pept        complement(583195..585015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="Atu0598"
FT                   /old_locus_tag="AGR_C_1060"
FT                   /product="phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86409"
FT                   /db_xref="GOA:A9CK56"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK56"
FT                   /protein_id="AAK86409.1"
FT                   /translation="MSADSRIQAITARIVERSKPYRETYLERLRLQVSKGVHRSVLSCG
FT                   NLAHGFAVCSPADKDILAGDRVPNLGIITAYNDMLSAHQPYETFPAIIRDAAKEAGGIA
FT                   QVAGAVPAMCDGVTQGQPGMELSLFSRDAIAMAAGIGLSHNMFDAAVYLGVCDKIVPGL
FT                   VIAALAFGHLPAVFVPAGPMTSGLPNDEKSRIRQLYAEGKVGRAELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHMPGSSFINPGTPLRDALTREAANRALAITAQGNEFTPAG
FT                   EMIDERSVVNGVVGLHATGGSTNHTMHLIAMARAAGIILTWQDISDLSDIVPLLARVYP
FT                   NGLADVNHFHAAGGMGFLIKQLLKQGFVHDDVRTVFGQGLSAYTVDAMLDEKGAVTRQP
FT                   SPEQSHDPKVLSSIETPFQSTGGLKMLTGNLGKSVIKISAVKPERHIIEAPAIVFHDQQ
FT                   ELQDAFKDGKLNRDFIAVVRFQGPKANGMPELHRLTPPLGVLQDRGFKVALVTDGRMSG
FT                   ASGKVPAAIHVTPEASDCGPISLIRDGDIIRLDAISGTLEVLVSAAELAKREPARADLS
FT                   GNEWGMGRELFAPFRRNAGPADQGASVLFH"
FT   gene            complement(585140..585838)
FT                   /gene="pgl"
FT                   /locus_tag="Atu0599"
FT                   /old_locus_tag="AGR_C_1063"
FT   CDS_pept        complement(585140..585838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="Atu0599"
FT                   /old_locus_tag="AGR_C_1063"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86410"
FT                   /db_xref="GOA:Q7D149"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D149"
FT                   /protein_id="AAK86410.2"
FT                   /translation="MSETIHVFDTAAALATALAAEVAKRLDAATKERGTASIAVSGGST
FT                   PKLFFQALSRHDLDWPNISVTLVDERFVPPESDRSNHRLVADNLLQDKAKAAYFVPLFQ
FT                   PAASPEDAATLATVKTEAICDPFDVVILGMGTDGHTASFFPGGDNLYEALDLDEPRGVL
FT                   TMAAENAGEERLTFNFSSLHDADFLVLHIEGAAKKATLEKAQSGEDEDEMPVRAVLNRA
FT                   ETPVDIYWAP"
FT   gene            complement(585849..587324)
FT                   /gene="zwf"
FT                   /locus_tag="Atu0600"
FT                   /old_locus_tag="AGR_C_1065"
FT   CDS_pept        complement(585849..587324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="Atu0600"
FT                   /old_locus_tag="AGR_C_1065"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86411"
FT                   /db_xref="GOA:Q7D148"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D148"
FT                   /protein_id="AAK86411.2"
FT                   /translation="MSSQIIPVEPFDCVVFGGTGDLAERKLLPALYHRQVEGQFTEPTR
FT                   IIGASRSVMTHEEYRKFAQDALKEHLKAGEYDDAQVTLFLNRLFYVPVDAKSGNGWDVL
FT                   KKLLDEGKERIRAFYLAVAPGIFGDIADKIREHKLITRSTRIVVEKPIGRDLASAQELN
FT                   DTIGHVFKEEQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAEAVGL
FT                   EGRAGYYDKAGALRDMVQNHILQLLCLVAMEPPASMKSEAVRDEKLKVLRSLKPIDTSN
FT                   VEKLTVRGQYRAGASAGGPVKGYLEELEGGVSNTETFVAIKAEIANWRWAGVPFYIRTG
FT                   KRLATRVSEIVVTFKQIPHSIFDDAAGKIEANKLVIRLQPDEGVKQSLLIKDPGPGGMR
FT                   LRQVSLDMSFAEAFNVRSPDAYERLLMDTIRSNQTLFMRRDEVEAAWDWIDPILKSWEE
FT                   LGQSVQGYTAGTWGPSGSIALIERDGRTWHDAD"
FT   gene            complement(587461..588747)
FT                   /gene="ordL"
FT                   /locus_tag="Atu0601"
FT                   /old_locus_tag="AGR_C_1066"
FT   CDS_pept        complement(587461..588747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="Atu0601"
FT                   /old_locus_tag="AGR_C_1066"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86412"
FT                   /db_xref="GOA:A9CK55"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK55"
FT                   /protein_id="AAK86412.1"
FT                   /translation="MTWQSPIAPGLSWYQATVGERPDYPALDGSKQVDVAIIGGGYTGL
FT                   QAACNLAENGVSVALIEAHRFGDGASGRNGGQFGTGQRSFPDEMEGEIGFEQSKLLFDI
FT                   AEDAKNYVRDFASSRGIDMDYLPGQLYVAHKAAYEDDYRRSVDAMNNRYGYPHISYMER
FT                   GEARKRVGSTHYFGGTRDTGTGHIHPLKLLVGLAKAAKAAGADIYEMTPAKSIRQIGGK
FT                   TIIKTPFGTISAPRVLIATNAYIGNLEPVTAAHIMPIRSFIGATAPLDAYPDIIPGKEA
FT                   VADSRFVVRYFRKTTDNRLLFGGREAYTADAPRDISSHIRRQIAEIYPELKAVEITHSW
FT                   GGSVGITLPRKVFVREVMPGVTSIGGYSGHGVMLSNYCGKLYADLVLGKKDMLAPFARL
FT                   KVPAFPGGASLRAPLLFMALSWFALRDRF"
FT   gene            complement(588760..590199)
FT                   /gene="glnA"
FT                   /locus_tag="Atu0602"
FT                   /old_locus_tag="AGR_C_1068"
FT   CDS_pept        complement(588760..590199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="Atu0602"
FT                   /old_locus_tag="AGR_C_1068"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86413"
FT                   /db_xref="GOA:Q7D146"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D146"
FT                   /protein_id="AAK86413.1"
FT                   /translation="MPAKKTMLRPKKQATMAKKSPPLDLSSTRGVSSWREAAQWLRVRG
FT                   IEDIECITPDLAGVARGKMMPTAKFTGDTSLALPSALYRHTISGEYPDETANFRYEPRD
FT                   SDLKLVPDLSTLSVVPWESDPTAQVICDVVDAEGNFVPYTPRNVLKNVLSLYTEKGWKP
FT                   VVAPEIEFYLVAMNDDPDYPLHPPKGRSGRSIVGGQSYSIAGINEFDELIDDIYHFSEK
FT                   QGLEIDTLIHEEGPAQLEINLRHGDPIELADQVFLFKRTIREAALKHGIYATFMAKPMQ
FT                   GQPGSAMHIHQSVVEIDGGRNIFSNADGSPSKVFFSFVGGMQRYVPNALVMLAPYVNSY
FT                   RRLTPDMACPVNNAWGYDNRTTAFRVPISSPQARRVENRLPSSDANPYLALAASLGCGW
FT                   LGIVNNIEPTEPTADTANEGSIELPRGLLEAVALLEGEEQFDRVFGHEFVGLYAGLKRG
FT                   EFETFMQVISPWEREFLLLNV"
FT   gene            590323..591507
FT                   /locus_tag="Atu0603"
FT                   /old_locus_tag="AGR_C_1070"
FT   CDS_pept        590323..591507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0603"
FT                   /old_locus_tag="AGR_C_1070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86414"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D145"
FT                   /protein_id="AAK86414.2"
FT                   /translation="MMTEKCDVLILGAGAAGMMGAIRAGKRGRSVIILDHARAPGEKIR
FT                   ISGGGRCNFTNIHAGPKNYLSSNPHFAKSALARYTPHDFIALVEKHRIAWHEKTLGQLF
FT                   CDDSAKDIIRMLLAEMQAVNAKLRLETSVSAVTHDGGRFRVTTSGGVIEAESLVVATGG
FT                   KSIPKMGATGFAYQIAEQFGLKLIEPRPGLVPLTLDPAALEKLSPLAGVAVPAEVSHGK
FT                   TSFEEALLFTHRGLSGPSILQISSYWREGDAIRLKLEPARDIVSLLRQAKQKNGRQSAQ
FT                   TALSEILPKRLAQHVVEQTGITGNLADMSEKVLAKLAAQVQDWQIKPAGSEGYRTAEVT
FT                   LGGVDTTGLDSRSMAAKSVPGLYFIGECVDVTGWLGGYNFQWAWASGQAAGEFA"
FT   gene            complement(591618..591965)
FT                   /locus_tag="Atu0604"
FT                   /old_locus_tag="AGR_C_1072"
FT   CDS_pept        complement(591618..591965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0604"
FT                   /old_locus_tag="AGR_C_1072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86415"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J3"
FT                   /protein_id="AAK86415.2"
FT                   /translation="MHAIFAAQAIIDNQKPRTRREAILQEEKFYADMAEASRAWRLFSA
FT                   LAGLINVTSRRSIKESDQGCDGTGCDDAEVEGQLPALAFGAGDGNGARAAMCRSVHARA
FT                   PDEKLNRPMPC"
FT   gene            592053..592925
FT                   /locus_tag="Atu0605"
FT                   /old_locus_tag="AGR_C_1075"
FT   CDS_pept        592053..592925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0605"
FT                   /old_locus_tag="AGR_C_1075"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86416"
FT                   /db_xref="GOA:A9CK54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK54"
FT                   /protein_id="AAK86416.1"
FT                   /translation="MKNVTWDSYQLFLDVSRSGGLTGAAALTGLSPATVGRRMVELEER
FT                   IGKALFLRSQTGYALTADGRALFDRLQAMENAAKDIEGWQKASLASSTVRIAVGTWNAW
FT                   LLTGNFSAICTDRDDFRIDLFIAEQRASLAHRENDIGIRAFEPQEKNLAAIKTGEVAYA
FT                   PYRLRNVAAAVADRWLAVAEESAISTYLRWPHENRRSDIAVTVNRPVALLDLVLAGAGV
FT                   AVLPCFVGDADARLLREGGEIEPLRHNQWIVMNNDDRHRRDIRTVADRMTRLIKGHSDL
FT                   YAGRKSRPA"
FT   gene            complement(592941..593198)
FT                   /locus_tag="Atu0606"
FT                   /old_locus_tag="AGR_C_1076"
FT   CDS_pept        complement(592941..593198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0606"
FT                   /old_locus_tag="AGR_C_1076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D143"
FT                   /protein_id="AAK86417.2"
FT                   /translation="MNAHNPIKTHVKERAEEQSSAMTQDQQAAIRMLANDLHRLNQAVM
FT                   KAVEAGVSVELVRSARHHGGGGNWGDLLIPVIVAQGSAAA"
FT   gene            complement(593283..594572)
FT                   /gene="aceA"
FT                   /locus_tag="Atu0607"
FT                   /old_locus_tag="AGR_C_1079"
FT   CDS_pept        complement(593283..594572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="Atu0607"
FT                   /old_locus_tag="AGR_C_1079"
FT                   /product="isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86418"
FT                   /db_xref="GOA:A9CK53"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK53"
FT                   /protein_id="AAK86418.2"
FT                   /translation="MTDFYKLVPGAPKGRFDGIERTYTAADVARLRGSVEIRHSLAEMG
FT                   ANRLWKLINEENFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSL
FT                   YPANAAPELAKRINRTLQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMK
FT                   AFIEAGAAGVHYEDQLASEKKCGHLGGKVLIPTAAHIRNLTAARLAADVMGVPTLVIAR
FT                   TDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVKNGLEPCIARAVAYAPYCDLIWCE
FT                   TSKPDLEQARRFAEGVHKVHPGKKLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQ
FT                   FITLAGFHQLNFGMFELARGYKDRQMAAYSELQEAEFAAEVNGYTATKHQREVGTGYFD
FT                   AVSLAISGGTSSTTAMKESTEHDQFRPAAE"
FT   gene            594823..596238
FT                   /locus_tag="Atu0608"
FT                   /old_locus_tag="AGR_C_1081"
FT   CDS_pept        594823..596238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0608"
FT                   /old_locus_tag="AGR_C_1081"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86419"
FT                   /db_xref="GOA:A9CK52"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK52"
FT                   /protein_id="AAK86419.1"
FT                   /translation="MSENKIFAGPRVRRIRNGLALTQTAMAEALAISPSYLNLIERNQR
FT                   PLTVQLLLKLASVYKVDLDDLQGESAGSAGQLREVFADPLLVGEVPSPQELIEVADAAP
FT                   NAASGVLKLYRAYREQAQRLSDLSDLLAREGHETALSSTRLPIDEVRHVFENRPAYFHA
FT                   IDAAAEELHKQLSTGDDLASGLRAWLQKNHGIVVRTLPVHAMPNLRRRYDRHSMRLFLS
FT                   ERLSQPDQLREMAMETCLLALREEIGTELEALGLKGEEARRIARFELARYAAHALMMPY
FT                   GAFLAAAQRAKYDLDVLRSRFNVSFEQAANRLVSLQRPTTAAIPFFLMEIDNAGNRFRL
FT                   AGAGGFPRARFGGLCPRLNIHAAFAQPGQVLVESVEMPDGDAFLTVSRTLEGPQAGFGE
FT                   RVRRTAVLLGCDLGQAGETVYGPAASGAAPVAIGPSCRLCERQGCLSRAEAPLTRPLGL
FT                   DEMVTGLSVFDFQ"
FT   gene            596390..597487
FT                   /gene="potF"
FT                   /locus_tag="Atu0609"
FT                   /old_locus_tag="AGR_C_1084"
FT   CDS_pept        596390..597487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="Atu0609"
FT                   /old_locus_tag="AGR_C_1084"
FT                   /product="ABC transporter, substrate binding protein
FT                   (putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86420"
FT                   /db_xref="GOA:A9CK51"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK51"
FT                   /protein_id="AAK86420.1"
FT                   /translation="MKNRSLRLTLALTTALVAAGSAMAQEKVVHVYNWSDYIDPVILED
FT                   FTKETGIKVVYDVYDGNEVLETKLLAGSSGYDVVAPTSPFLARQIKAGVYQKLDKSKLP
FT                   NLKNAWPDITERLAKYDPGNEYAVNYMWGTTGIGYNVAKVKAALGDVPVDSWDVLFKPE
FT                   NAEKLKSCGINILDASDETFAIAMNYLGKNPDSKETADLEAGGEVYSKIRPYVKTFNSS
FT                   PYINDLANGDTCISIGWSGDILQAKTRAEEAKNGVEVNYVIPKEGTYIWMDSFAIPADA
FT                   KNVDEAHAFINYMMKPEVAAKASDYVQYANGNLPSQALMDPSVAKNPGVYPDPETMKKL
FT                   FTISPYGPKEQRVLNRVWTQIKTGT"
FT   gene            597569..598726
FT                   /gene="potG"
FT                   /locus_tag="Atu0610"
FT                   /old_locus_tag="AGR_C_1086"
FT   CDS_pept        597569..598726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="Atu0610"
FT                   /old_locus_tag="AGR_C_1086"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86421"
FT                   /db_xref="GOA:A9CK50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK50"
FT                   /protein_id="AAK86421.1"
FT                   /translation="MAKTLGPVKRKFSPWDNPDAVPFIRFENVTKRFGDFVAVNNLTLD
FT                   IYEREFFSLLGPSGCGKTTLMRMLAGFEEPTEGRILLQGKDISGVPPYKRPTNMMFQSY
FT                   ALFPHMSVEKNVAFGLEQDGLPKADIAARVEEMLRLVKLTEFAKRKPSQLSGGQRQRVA
FT                   LARSLAKRPKVLLLDEPLGALDKKLREETQFELMDIQTNLGLTFLIVTHDQEEAMTVSD
FT                   RIAVMDKGNVVQVATPAEIYEAPNTRYVADFIGDINIFDAHVVANASDIGKPGLVTMDC
FT                   DGLKVSVEQECAAAAGSQVAYAIRPEKVRISLDQPADSSINSAYGEVWDIGYLGDFSVF
FT                   IVKLADGRVIRAAQANVSRLVDRPITFGDMVWLNWKPDSGLVLTR"
FT   gene            598738..599646
FT                   /gene="potB"
FT                   /locus_tag="Atu0611"
FT                   /old_locus_tag="AGR_C_1087"
FT   CDS_pept        598738..599646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="Atu0611"
FT                   /old_locus_tag="AGR_C_1087"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86422"
FT                   /db_xref="GOA:Q7D138"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D138"
FT                   /protein_id="AAK86422.2"
FT                   /translation="MAITTPENRQSPWRWLVVAVPYFWLLLFFAAPFLIIVKISLSDTA
FT                   ISMPPYTPVFEGFSKLGEFFSQLDFENYLFLTEDPLYIEAYLSSLRIAFISTFLLLLIG
FT                   YPMALAMARAPSSVRPTLVMLVILPFWTSFLIRVYAWIGILKPEGLLTVLFQWLGFLGP
FT                   DQQVNIFRTETAIFIGIVYSYLPFMVLPLYSALEKLDNTLLEAAADLGCPPWKAFWKIT
FT                   FPLSLPGVVAGAMICFIPITGEFVIPDLLGGAQTLMIGKTLWTEFFGNRDWPLASAVAV
FT                   LLLILLVVPIAIFQNQQKKVG"
FT   gene            599651..600463
FT                   /locus_tag="Atu0612"
FT                   /old_locus_tag="AGR_C_1089"
FT   CDS_pept        599651..600463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0612"
FT                   /old_locus_tag="AGR_C_1089"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86423"
FT                   /db_xref="GOA:A9CK49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK49"
FT                   /protein_id="AAK86423.1"
FT                   /translation="MKRGKFDITVLTLGFAFLYIPIIILIIYSFNASKLVTVWGGFSLQ
FT                   WYKSMWSNQGLMDAAWVTLRVGILSATIGTILGTLAALSLTRFARFPGRVLFSGMIYAP
FT                   LVMPEVITGLSLLLLFVAVGVDRGFWTVVIAHTTFTMCYVAIVVQSRLLTFDRSLEEAA
FT                   LDLGCPPVKTFFRITLPLIFPAVIAGWMLAFTLSLDDLVIASFATGPGATTLPIKIYSQ
FT                   VRLGVTPEINAICTILIGLVTIGVIAASVASKRTELQRMRDEHAAARN"
FT   gene            complement(600771..602351)
FT                   /locus_tag="Atu0613"
FT                   /old_locus_tag="AGR_C_1092"
FT   CDS_pept        complement(600771..602351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0613"
FT                   /old_locus_tag="AGR_C_1092"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86424"
FT                   /db_xref="GOA:Q7D136"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D136"
FT                   /protein_id="AAK86424.2"
FT                   /translation="MPILAIFWLALTGSTEGWQHLLANVLPRAGFRTFILLGLTAATTA
FT                   FFGIVCAWLVTTFEFPLRRILSAALVLPLAIPSYLAAYAFGEFLDFTGPVQSAVRAAFG
FT                   YHSIRDYWFPDIRSLGGAVIVLSSVLYPYVYLSARAALSMQGRFAAEAARTLGAKPLNV
FT                   FFSVQLPMARPAIAIGLSLVLMETLNDIGAVEYLGVQTLTFTIYETWLNRGNLANATQI
FT                   AAVILIIVSALIVIERNAREKQRFGAPKATSMAQRHRLKALAGWRRWCASLFCFLPVAS
FT                   GFFIPVIVLGGYAAKRLDALFQPKLLKALGHSLEVSLSAAFLTLIAAFVFSYAIRTERS
FT                   RLSKVAARLGSMGYGVPGTVLAIGVLIPLASLDNGVDGFIRSHFGFSSGLLLSGTAFAI
FT                   IYAHAVRFMTMAEGTLDAGFHKLSPHIDMASRSLGRNRAQTLFKVLLPNMRPAALTAFL
FT                   LVLIESMKELPATILLRPFGFNTLATLVYEDASRSRVQDAAVPAIIIIMAGLIPVLLVS
FT                   KSMDHPEHH"
FT   gene            complement(602711..606538)
FT                   /locus_tag="Atu0614"
FT                   /old_locus_tag="AGR_C_1094"
FT   CDS_pept        complement(602711..606538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0614"
FT                   /old_locus_tag="AGR_C_1094"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86425"
FT                   /db_xref="GOA:Q7D135"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D135"
FT                   /protein_id="AAK86425.1"
FT                   /translation="MPAVQYPFIDIAVHERVREGFGRGEAMALFSLDLQNVLWANGRGA
FT                   ALFGTPIVYDFLEQGPKRQDVTFRQLAATAARLSKAGDSLPFTIRITSGFRSLAVTARA
FT                   EIIEAEPGHPAILFSALTDQAAPDVAECARRMIEGFDDPDIHMAVLNGDNEIIAASSGF
FT                   SSLGITPHTARTLIKMAAGQSGHLVKRPVPTGKGYLPAATGQITTSPELNLLFVVETAL
FT                   GTLDPVNGFAEDRGFSEDRDVAEDRNVAESRPQEIPAAAEPALPIAEAAPVIAATTSFD
FT                   SVLDAVAGIEDVEDIQELPSDFEEDVAAEQDEDGLLSMPDDKVETPAEPPVLDADAAAD
FT                   MAMTDDIEDLFELDADETVAPSIERTVTEDHTLEAQAEENTFADDEIAETEAEEATTAA
FT                   DDELTTETETANIGTGEEARPFVFNAGARASRFVWKIDAEGRFSSISHEFAEAVGAKAA
FT                   AVEGMGFADVAALFNLDPDGKIRELLGRRDTWSGKTIYWPVEGTSLMVPIDLAALPTYT
FT                   RAREFDGFRGFGIVRLADATEDPHATGLTFLNSEETEPAEVLPQQAVEDESHELLAFVD
FT                   EDTETDDNPHPALPDEPAVDIDIAGDAADGVLTEEQLDDETSPEVESPIEAPAPEPSYS
FT                   DKVVHLEDRRSRSREGLTAGEQAAFREIGRALAPSDMASEEKHEADAEGISAEPVVQDI
FT                   QQDIAAETAKDASSDTGNDAETTEPVEEDDLFADYVRGEQPAPVRAPTDEPTSAEKQVV
FT                   TTDEKPVADIAASMVSPPVRTPSALTAETLDQMPVALLVHAGDRLIHANPDFLRLTGYT
FT                   SLTELEEVGGLEALLQRQELENMPDNEGGMVVVSAENDIIPVKARLQSIRWEETKALML
FT                   SLVPLEEKPAAVMAANENTAENAEAGSNLSLLQGEMEELHSILETATDGVVLLGDDGEI
FT                   RSLNRSASALFNYDNGEIAGKPFVTLFAHESQRAVLDYLSGLANNGVASVLNDGREVIG
FT                   REASGGFLPLFMTIGRLKSSHGYCAVIRDITQWKRTEEELRNAKRAAETANAHKTDFLA
FT                   RVSHEIRTPLNAIIGFSDMMATERFGPIGNPRYVEYANDIGRSGRHVLDIVNDLLDISK
FT                   IEAGQMDVDFIAVPLNETVAEAVSLVQPQANNQRVIIRTALAQSVPQIVADLRSIKQIV
FT                   LNILSNAIRFTPSGGQIVVSTAYEANGSVSLRIRDTGIGMTRAELEQAMKPFRQVASSG
FT                   KRVRGDGTGLGLPLTKAMVDANRANFSITSTPNEGTLVEITFPSQRVLAN"
FT   gene            606856..606932
FT                   /locus_tag="Atu0616"
FT   tRNA            606856..606932
FT                   /locus_tag="Atu0616"
FT                   /product="tRNA-His"
FT   gene            607141..608841
FT                   /locus_tag="Atu0619"
FT                   /old_locus_tag="AGR_C_1098"
FT   CDS_pept        607141..608841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0619"
FT                   /old_locus_tag="AGR_C_1098"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86427"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D134"
FT                   /protein_id="AAK86427.1"
FT                   /translation="MYSLPKTIWLKSPALVLSTQRNLMKASSIASTLVRGEMDKTVIDP
FT                   GNGPKPSEQGASVANKGKAKRSRRGKKHKRDGKPRDAVVLSHDVAADVPAGSSYVSALE
FT                   PDAEPRKRKRRRRSRGKGTSQQAAAAVNGEVQAPAAPDGANSSSVPPIGARKSRNRKRG
FT                   HRDPRGRDPQGRPLVPSHAPKHGGKQNGRANGSAQEAHRSQSEISARHAGRQHEHGQEP
FT                   PADMYAALDLGTNNCRLLIAQPTRPGQFRVVDAFSRIVRLGEGLISSGRLSDDAMDRAV
FT                   EALKVCSSKLAGRPIRRMRLIATEACRAASNGEEFLERVTRETGLKLEIISRETEARLA
FT                   VSGCASLVGREARSVVLFDIGGGSSEIAVIKVGENRSNRLANHITHWTSLPVGVVTLSE
FT                   RHGGRDVTPDVFAAMVREVEGLLDAFHCPPLAPQLHHEDFHLIGTSGTVTTLAGVHLDL
FT                   PRYDRRKVDGLWLSDVEVTAMQDKLLAWDFAGRAANACIGPDRADLVLAGCAILEAIRR
FT                   RWPARRMRVADRGLREGLLTDMMADDGAWRRNRIRRMQMVRQDRTEGLT"
FT   gene            608838..609578
FT                   /gene="ftsJ"
FT                   /locus_tag="Atu0620"
FT                   /old_locus_tag="AGR_C_1101"
FT   CDS_pept        608838..609578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="Atu0620"
FT                   /old_locus_tag="AGR_C_1101"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86428"
FT                   /db_xref="GOA:Q8UHR0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHR0"
FT                   /protein_id="AAK86428.2"
FT                   /translation="MSKAPTSTNRTGRKIGQKVKKTKLKASSRRWLERHINDPYVQRAK
FT                   LEGYRARAAFKLLEINDKHQILKGATRIIDLGAAPGSWSQIASKVTDSTEDDIRVAAID
FT                   FLEIDPIPGVKILQLDFLDPTAPDQLMEAVGGTPDLVLSDMAAPTTGHQKTDHIRTMHL
FT                   CEVAADFAVQVLAEGGHFLAKTFQGGTEKALLDMLKKNFKQVLHIKPASSRSESVEMFL
FT                   LAKHFKGRRHEPAIDADAEESTED"
FT   gene            complement(609579..610976)
FT                   /locus_tag="Atu0621"
FT                   /old_locus_tag="AGR_C_1103"
FT   CDS_pept        complement(609579..610976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0621"
FT                   /old_locus_tag="AGR_C_1103"
FT                   /product="MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86429"
FT                   /db_xref="GOA:A9CK48"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK48"
FT                   /protein_id="AAK86429.2"
FT                   /translation="MNRIIPLILAVALFMEQMDSTVIATSLPAIAKDLHVGPITLKLAL
FT                   TAYMVALAIFIPISGWMADKYGAKKIFRIAIGVFVVGSICCAVSSSVFEFVLSRFLQGM
FT                   GGAMMTPVGRLVLLRTTKRSELVSAMALLTIPGLVGPLTGPPIGGFITTYFSWHWIFLI
FT                   NVPIGIIGIWLSTIFLPEIETTNPPPMDGKGFILSGIAASGVVFGVSVVSLPALPPAIG
FT                   IASTVIGFICGFLYMRHAARHPAPILDFRIFQNATFRAASVGGTVFRISTGAIPFLMPL
FT                   MLQIGFGLNPFQSGMITFAGAIGAITTKFMAKRVFAATGFRSTLIGAGIVGAFTTLANS
FT                   FFTPETPYPLIMIFLVTAGFARSFFFTGSNALSYSDIEDSQASQATSMASVLQQISLAL
FT                   GVAFAASILEVSSMMSGTHLQLADFHIAFTIVALVSLFAIVPIIRMDAQAGAAVSGHRG
FT                   KVSQPAE"
FT   gene            611204..612187
FT                   /locus_tag="Atu0622"
FT                   /old_locus_tag="AGR_C_1105"
FT   CDS_pept        611204..612187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0622"
FT                   /old_locus_tag="AGR_C_1105"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86430"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D131"
FT                   /protein_id="AAK86430.2"
FT                   /translation="MSRRGLIGAAGASVLGAPLLMARGANAQTNQPQTSMEIKHAMPPE
FT                   TNRFKLGNFEVLVVKDGARAAPNPGETFGTDQSAETVGKLLEDNFLPKDQFVNSFSPVL
FT                   INTGSDLVLFDTGFGEAGRGAGNGRLTEGMAAAGYTPEDVTVVVLTHMHGDHIGGLMEK
FT                   GAPAFSKARYVFGQAEYDFWTDEKRAGTPAEGGQKGVLANVKPLAEKATFIGDGANVVS
FT                   GITGIAAFGHSPGHMIFRVESEGKQLILTADTANHFVLSLQKPDWEVKFDMDKAAAAAT
FT                   RKKVYDMIATDRLPFLGYHMPFPSVGYAEKLDTGYRFVPKSYQFDI"
FT   gene            612258..612416
FT                   /locus_tag="Atu0623"
FT   CDS_pept        612258..612416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAL41639"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UHQ7"
FT                   /protein_id="AAL41639.2"
FT                   /translation="MNVLPALANFQAILAGRRGELFVPERPRIFIMKEFGHGTHHSNTH
FT                   WFGRSHI"
FT   gene            612499..613872
FT                   /gene="guaB"
FT                   /locus_tag="Atu0624"
FT                   /old_locus_tag="AGR_C_1108"
FT   CDS_pept        612499..613872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="Atu0624"
FT                   /old_locus_tag="AGR_C_1108"
FT                   /product="inosine-5`-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86431"
FT                   /db_xref="GOA:Q7D130"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D130"
FT                   /protein_id="AAK86431.2"
FT                   /translation="MNLPILSSAMDTVTEGRLAIAMAQAGGIGVIHRNLTPIEQAEEVR
FT                   QVKKFESGMVVNPVTIGPDATLAEAQALMKAHGISGIPVVENGGAGGHKNGRLVGILTN
FT                   RDVRFASDPQQKIYELMTRENLVTVKESSVDQQEARRLLHKHRIEKLLVVDGKGNCVGL
FT                   ITVKDIEKSQLNPNATKDAQGRLRAAAAISVGADAIERAERLIDAGVDLLVVDTAHGHS
FT                   QRVLDAVAQVKKMSNSVRIIAGNVATADGTKALIDAGADAVKVGIGPGSICTTRIVAGV
FT                   GVPQLAAVMAAVEAASLADIPVIADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPG
FT                   EVFLYQGRSFKAYRGMGSVGAMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGV
FT                   LHQLAGGLKAAMGYVGGSNIKEFQERATFVRISSAGLRESHAHDVTITRESPNYPGAV"
FT   gene            613968..614387
FT                   /locus_tag="Atu8134"
FT                   /old_locus_tag="AGR_C_1110"
FT   CDS_pept        613968..614387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8134"
FT                   /old_locus_tag="AGR_C_1110"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8134"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86432"
FT                   /db_xref="GOA:Q8U5J1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J1"
FT                   /protein_id="AAK86432.1"
FT                   /translation="MSPTTAMFWPMIAHAFLVFILYALLLHRRKNHTLTSREAVTQYRE
FT                   RGEEGQASYLVNRNIANQFELPVLFHAICLLLYITDADNVVTVVLAWLFVISRYAHSYV
FT                   HVTSNRLRYRAPLFGIGFALLVCLWGWLAIWLALE"
FT   gene            614537..615565
FT                   /gene="adhP"
FT                   /locus_tag="Atu0626"
FT                   /old_locus_tag="AGR_C_1112"
FT   CDS_pept        614537..615565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="Atu0626"
FT                   /old_locus_tag="AGR_C_1112"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86433"
FT                   /db_xref="GOA:A9CK47"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK47"
FT                   /protein_id="AAK86433.1"
FT                   /translation="MTKTMKAAVVRAFGKPLTIEEVAIPDPGPGEILINYKATGVCHTD
FT                   LHAATGDWPVKPNPPFIPGHEGAGYVAKIGAGVTGIKEGDRAGTPWLYTACGCCIPCRT
FT                   GWETLCPSQKNSGYSVNGSFAEYGLADPKFVGRLPDNLDFGPAAPVLCAGVTVYKGLKE
FT                   TEVRPGEWVVISGIGGLGHMAVQYAKAMGMHVVAADIFDDKLALAKKLGADVVVNGRAP
FT                   DAVEQVQKATGGVHGALVTAVSPKAMEQAYGFLRSKGTMALVGLPPGFISIPVFDTVLK
FT                   RITVRGSIVGTRQDLEEALTFAGEGKVAAHFSWDKLENINDIFHRMEEGKIDGRIVVDL
FT                   AA"
FT   gene            615684..616559
FT                   /gene="dlhH"
FT                   /locus_tag="Atu0627"
FT                   /old_locus_tag="AGR_C_1114"
FT   CDS_pept        615684..616559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dlhH"
FT                   /locus_tag="Atu0627"
FT                   /old_locus_tag="AGR_C_1114"
FT                   /product="carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86434"
FT                   /db_xref="GOA:Q7D128"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D128"
FT                   /protein_id="AAK86434.2"
FT                   /translation="MDKPKITQAMIDAYDEYTHLSLDRRKFMEKLSLLAGSGAAAAAIA
FT                   PLLSANSARAAIVAPDDAGIVAEDVTYPAPGGEMKGYLVTPKSVSGPIGSVIVIHENRG
FT                   LNDHIRDVARRVALAGFRALAVDFLSPQGGTPSDEDKAREMFSGLDMEATVANAEAGRV
FT                   WLAARQGANGKVGAVGFCWGGGLVNRFATKSAGLNAGVAYYGQQPPVADVRDIKAPLLL
FT                   HYAGLDERINAGIDAYKKALEANGKTFEIFVYDGVNHAFNNDTSSARYDKAAADLAWGR
FT                   TTDFFKKYLA"
FT   gene            complement(616678..618033)
FT                   /locus_tag="Atu0628"
FT                   /old_locus_tag="AGR_C_1116"
FT   CDS_pept        complement(616678..618033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0628"
FT                   /old_locus_tag="AGR_C_1116"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86435"
FT                   /db_xref="GOA:A9CK46"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK46"
FT                   /protein_id="AAK86435.1"
FT                   /translation="MPGASFLKSTAVRLAIIYIVLFVTASLGANITAYQMVVRFLDERL
FT                   NANVQERYREIASAFEARGLQGAVDMIDNHGLAIRGQETIYALRNPAGQLLAGSNRFSN
FT                   VPSGYSILEPDDHHGSASHYKLFSGPLGPNTLVVGINSGDTDELARIVLISFGCATAIV
FT                   LSVGMAGAAILAYRTRHRISSLAQIAHAIGHGELSRRLPVSSRMDEIDILSAEINVALA
FT                   RLDSSVAALKQVTIDVAHDLKTPIGRTFLVLEDALNAHTVDEMRIGVETALEELQSIAN
FT                   TFDALLRIAQIEARSRTARFIAFDLCDVVGDIYETYEVIAEEEGYELSMRGAASGCRIN
FT                   GDPDLIRQLLANLLSNAMRHTPAGSSISLGVSRQDGRILLDIADNGPGISDEDRAQVFD
FT                   RFYRVEKSRTTAGSGLGLSLVKAIAELHGAIVTLADNNPGLRVVVQFQELRV"
FT   gene            complement(618020..618697)
FT                   /locus_tag="Atu0629"
FT                   /old_locus_tag="AGR_C_1118"
FT   CDS_pept        complement(618020..618697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0629"
FT                   /old_locus_tag="AGR_C_1118"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86436"
FT                   /db_xref="GOA:A9CK45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK45"
FT                   /protein_id="AAK86436.1"
FT                   /translation="MKILLVEDDNTTGNYVTKGLASAGHIVDWVKDGREALAAGLDGGY
FT                   DVAIVDRMIPGLDGLNLVKSLRAASIRIPILFLTAMSGVDDRVEGLEAGGDDYLVKPFA
FT                   FSELTARINALVRRPPITTEKTRLRVGDLEMNLVTRTTSRGGQRIDLLPREFSLLELLM
FT                   RNEGRILTKTMFLEKIWNFNFDPQSSVVETHISRLRAKIDKPFDQPLLHTVKNTGYTLH
FT                   ARR"
FT   gene            618896..619165
FT                   /locus_tag="Atu0630"
FT                   /old_locus_tag="AGR_C_1119"
FT   CDS_pept        618896..619165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0630"
FT                   /old_locus_tag="AGR_C_1119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86437"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D125"
FT                   /protein_id="AAK86437.2"
FT                   /translation="MIKNIAIAAFALVAATSVASANGLLSDSAPPVAKITENHGKPGDT
FT                   AVSVSNPEVTYRVLKNGMVERTNSRFDTTTYVDPTAVLRDRNRR"
FT   gene            complement(619257..619826)
FT                   /gene="moaB"
FT                   /locus_tag="Atu0631"
FT                   /old_locus_tag="AGR_C_1121"
FT   CDS_pept        complement(619257..619826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaB"
FT                   /locus_tag="Atu0631"
FT                   /old_locus_tag="AGR_C_1121"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86438"
FT                   /db_xref="GOA:A9CK44"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK44"
FT                   /protein_id="AAK86438.1"
FT                   /translation="MRAGYFEDKAIAGDRPFIPLGIAVLTVSDSRTLENDKSGDTLVAR
FT                   LEEAGHRLAARAIVPDDKAAIAETVREWTLSEGVDVVITTGGTGFTGRDVTPEALEPLF
FT                   EKRMDGFSALFHRISYDKIGTATIQSRATGGVANATFIFVLPGSPGACKDAWDGILKAQ
FT                   LDYRHLPCNFVEIMPRLDEHLKRGKS"
FT   gene            complement(619823..620722)
FT                   /gene="ipk"
FT                   /locus_tag="Atu0632"
FT                   /old_locus_tag="AGR_C_1122"
FT   CDS_pept        complement(619823..620722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="Atu0632"
FT                   /old_locus_tag="AGR_C_1122"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86439"
FT                   /db_xref="GOA:Q8UHP8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHP8"
FT                   /protein_id="AAK86439.1"
FT                   /translation="MRLHEVSGATETVEAAPAKINLALHVTGQRADGYHLLETLVTFTA
FT                   AGDMIRIRDAATDSFSISGPFGDLLSAGDSGDNLVTRARDILRDALASTGQPARPVDIH
FT                   LEKNLPVASGIGGGSADAAATLRGLLRHWDAAIAPEKLKSLALKLGADVPMCLASRPLI
FT                   ARGIGEDIEALTDLPELSMVLANPLKAVSTPEIFRRLQNKVNPHLPTPSTIGWATTGWM
FT                   DFLAQSRNDLQPPAQALLPEIGEITGLLSEEGATLVRMSGSGATCFGIFHSFDAAKNAE
FT                   TSLRKKRPGWYFHATRTI"
FT   gene            complement(620729..622573)
FT                   /locus_tag="Atu0633"
FT                   /old_locus_tag="AGR_C_1124"
FT   CDS_pept        complement(620729..622573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0633"
FT                   /old_locus_tag="AGR_C_1124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86440"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D123"
FT                   /protein_id="AAK86440.2"
FT                   /translation="MRRKPALRLLCSAALAAALAIGAGASPGFAETKAKPEDKAVTFDP
FT                   GKVNTFSGAFLAGRNADVDQDYPTAISLYKKALEYDPANSEIRQRLMIAELLSGNFEAG
FT                   AKIADSMKDDTSVERVTTIVRGLDAIKDKEFTKAEKILKYTGPNDLDRMVNTLLTAWAR
FT                   AGSGKPKEALALVNNMKGPGWISIFQKYNAAAIALVSGNTEAARKSLNEAVTDREGGAT
FT                   ASDTYMRAVMALARLEASAGNKQKALDAIAVGDTFAPNYAPLKALREAIEKGEKPEQQI
FT                   TNAVEGAASVMFSIAGALNREGAEEIVTLYLQTSRALDPKSPDTLILLGGLAEAMKQPE
FT                   RAITFYREVPKDSPMHRISELQLGLTLAQTGKVEESRKHLLSLLESDPKDIRSYLAYGS
FT                   VLSDAKDYKAMAENYDKAVEVIGAVPQKSDWSVFFQRGIAYERLKQWDKAEPNFKRALE
FT                   LNPEQPQVLNYLGYSWVDKGINLDEGMKMISRAVELRPNDGYIVDSLGWAHYRLGDFDQ
FT                   SVTELERAIELKAGDPTINDHLGDAYWRVGRKIEAVYQWNRALIGDNDDVDKAKVKEKI
FT                   ANGLPPVEKDAENTAKKDVAPQPPAPPAPATPTPDKKS"
FT   gene            complement(622765..623781)
FT                   /gene="ispB"
FT                   /locus_tag="Atu0634"
FT                   /old_locus_tag="AGR_C_1125"
FT   CDS_pept        complement(622765..623781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="Atu0634"
FT                   /old_locus_tag="AGR_C_1125"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86441"
FT                   /db_xref="GOA:Q7D122"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D122"
FT                   /protein_id="AAK86441.2"
FT                   /translation="MGVVIPLEESKNKLASVKPLVDLTRPDMERVNQLILSRAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLASASMFGYEGDNHIKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARTIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSTAASVIAEGEVLQ
FT                   LSVAKNMETTEDDYLQVIRAKTAALFAAAAEVGPIVAKTDKASRSALKSYGMNLGLAFQ
FT                   LVDDVLDYGGKSADLGKNTGDDFREGKITLPVILSYRRGTQDERAFWRNAIEKGESSDE
FT                   NLEKALGLITKYNGLGDTIGRATHYGTIARDALAPLPQSPWKNALLEVIDFCIERLN"
FT   gene            623826..624122
FT                   /locus_tag="Atu0635"
FT                   /old_locus_tag="AGR_C_1126"
FT   CDS_pept        623826..624122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0635"
FT                   /old_locus_tag="AGR_C_1126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86442"
FT                   /db_xref="GOA:A9CK43"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK43"
FT                   /protein_id="AAK86442.1"
FT                   /translation="MPCAARGELPLAIQKDGNLGLSMRELIRTNDAVLLSFAESLMKDA
FT                   GIHCLIADQAMSILEGSLGLLPRRFLVEEDRAGEARRILVDAGLGDELRNEEA"
FT   gene            624219..624929
FT                   /locus_tag="Atu0636"
FT                   /old_locus_tag="AGR_C_1128"
FT   CDS_pept        624219..624929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0636"
FT                   /old_locus_tag="AGR_C_1128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86443"
FT                   /db_xref="GOA:Q7D120"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2OZV"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D120"
FT                   /protein_id="AAK86443.1"
FT                   /translation="MDAMLLASLVADDRACRIADLGAGAGAAGMAVAARLEKAEVTLYE
FT                   RSQEMAEFARRSLELPDNAAFSARIEVLEADVTLRAKARVEAGLPDEHFHHVIMNPPYN
FT                   DAGDRRTPDALKAEAHAMTEGLFEDWIRTASAIMVSGGQLSLISRPQSVAEIIAACGSR
FT                   FGGLEITLIHPRPGEDAVRMLVTAIKGSRARLTFRAPLIMHETGSHAFTPFVDDLNNGR
FT                   AAYARNVRAIRTAS"
FT   gene            625105..625887
FT                   /gene="sohB"
FT                   /locus_tag="Atu0637"
FT                   /old_locus_tag="AGR_C_1130"
FT   CDS_pept        625105..625887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="Atu0637"
FT                   /old_locus_tag="AGR_C_1130"
FT                   /product="proteinase sohB"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86444"
FT                   /db_xref="GOA:Q7D119"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D119"
FT                   /protein_id="AAK86444.2"
FT                   /translation="MAGGNQFRPALNLASYAPLLEKAFAVKDAPAVAISLNSPGGSPVQ
FT                   ARMIYNRIRQLAEEKDKKVLIFVEDVAASGGYMIALAGDEIIADPTSIVGSIGVVSGGF
FT                   GFPEMLRKIGVERRVYTAGENKVILDPFQPEKEGDIDYLKSLQVEIHNVFIDMVKMRRG
FT                   SKLKGDDALFSGLFWTGMRGLDLGLIDGLGDMREVLRRRYGTKVKLQLISGGRSLFGKK
FT                   VPGVNMALGLNAERLAAGAVSGLAEVAEEKALWSRFGL"
FT   gene            625908..626102
FT                   /locus_tag="Atu0638"
FT                   /old_locus_tag="AGR_C_1131"
FT   CDS_pept        625908..626102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0638"
FT                   /old_locus_tag="AGR_C_1131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86445"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK42"
FT                   /protein_id="AAK86445.1"
FT                   /translation="MAQLITILLLLVGSIILYRRFVRDAEKLSAKSKQREKERETGAIG
FT                   TLIKDPDTGEYRVKREDEA"
FT   gene            626233..627165
FT                   /gene="glyQ"
FT                   /locus_tag="Atu0639"
FT                   /old_locus_tag="AGR_C_1133"
FT   CDS_pept        626233..627165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="Atu0639"
FT                   /old_locus_tag="AGR_C_1133"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86446"
FT                   /db_xref="GOA:Q8UHP1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHP1"
FT                   /protein_id="AAK86446.2"
FT                   /translation="MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLR
FT                   ALGPKPWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLKAIG
FT                   LDPLLHDVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGREGEEKISYGDVFLQAEQEYSRHNFEFADTSMLHRHF
FT                   IDAEKECLALLAAGAPGDNDNQRLHKCVFPAYDQCIKASHIFNLLNARGVISVTERERY
FT                   IARVRDLAKACGEAFLLTDAGGLNWNRAA"
FT   gene            627263..627580
FT                   /locus_tag="Atu0640"
FT                   /old_locus_tag="AGR_C_1136"
FT   CDS_pept        627263..627580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0640"
FT                   /old_locus_tag="AGR_C_1136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86447"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D117"
FT                   /protein_id="AAK86447.2"
FT                   /translation="MDLIMNIRSLRFLPVLMLGCLLSNAAAAETTEWMSGKDAFPRADK
FT                   LRTFGMIVTRMDCKDSGQRSLDVDSALVRMHYTRNTKMLDWRIDGWNHLQENKDYWAER
FT                   G"
FT   gene            627774..628325
FT                   /locus_tag="Atu0641"
FT                   /old_locus_tag="AGR_C_1138"
FT   CDS_pept        627774..628325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0641"
FT                   /old_locus_tag="AGR_C_1138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86448"
FT                   /db_xref="GOA:A9CK41"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK41"
FT                   /protein_id="AAK86448.1"
FT                   /translation="MFITLAIIAAIALYVVFIYNGLVKARQMKEEAWSGIDVQLKRRAD
FT                   LIPNLIETVKGYAAHEKTTFEEVIAMRNRAQAVPAGDVEGRAQAEGLLSQALGKLFALA
FT                   EAYPDLKANTNFLELQRSLETIEGELQMSRRYYNGAARDLNVKVESFPSNLVAGQFGFA
FT                   KAPYFEIDNPADRAVPTVKF"
FT   gene            628400..629677
FT                   /gene="aroA"
FT                   /locus_tag="Atu0642"
FT                   /old_locus_tag="AGR_C_1140"
FT   CDS_pept        628400..629677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="Atu0642"
FT                   /old_locus_tag="AGR_C_1140"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86449"
FT                   /db_xref="GOA:A9CK40"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK40"
FT                   /protein_id="AAK86449.1"
FT                   /translation="MIELTITPPGHPLSGKVEPPGSKSITNRALLLAGLAKGKSHLSGA
FT                   LKSDDTLYMAEALREMGVKVTEPDATTFVVEGTGVLQQPEKPLFLGNAGTATRFLTAAG
FT                   ALVDGAVIIDGDEHMRKRPILPLVQALRALGVEADAPTGCPPVTVRGKGMGFPKGSVTI
FT                   DANLSSQYVSALLMAAACGDKPVDIILKGEEIGAKGYIDLTTSAMEAFGAKVERVSNAI
FT                   WRVHPTGYTATDFHIEPDASAATYLWGAELLTGGAIDIGTPADKFTQPDAKAYEVMAQF
FT                   PHLPAEIDGSQMQDAIPTIAVIAAFNETPVRFVGIANLRVKECDRIRAVSLGLNEIREG
FT                   LAHEEGDDLIVHADPSLAGQTVDASIDTFADHRIAMSFALAALKIGGIAIQNPACVAKT
FT                   YPGYWKALASLGVDYTEKESAAEPQH"
FT   gene            complement(629640..629715)
FT                   /gene="suhB"
FT                   /locus_tag="Atu8102"
FT   misc_RNA        complement(629640..629715)
FT                   /gene="suhB"
FT                   /locus_tag="Atu8102"
FT                   /product="suhB"
FT   gene            629700..631637
FT                   /locus_tag="Atu0643"
FT                   /old_locus_tag="AGR_C_1142"
FT   CDS_pept        629700..631637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0643"
FT                   /old_locus_tag="AGR_C_1142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86450"
FT                   /db_xref="GOA:Q7D114"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D114"
FT                   /protein_id="AAK86450.2"
FT                   /translation="MKTIAARLLALFVFLGVAFPAFAEEFIRSYHSVVEVAADGKLTVT
FT                   ETITARAEGQNIKRGIFRDFPLYALDANNRRTRVDFNVVSVERDGAPENWRTENIDGGI
FT                   RIYTGSAEHFLPTGEHIFQITYTTARQIRFFSDYDELTWNVTGNGWQFPMGEISATITL
FT                   PRGVKATDTAVFTGPLGAKGRDARILSEGNEVFFATTRPFSVGEGMTVAVKLPKGAIAA
FT                   PDTSQEAGWWLRDNLAILLSGGGLFVVLLYYLRAWFAVGRDPAKGVVVPRWDAPEGLSP
FT                   ALVNYVDNRGFSGAGWTALSASALDLAVKGYVVLEDLKNSIVIRRTQKQAGAELPSGQK
FT                   TLLSSIGSPGETLTIDKAHGTEVEKVGKQFRAAIEKEHRGKYYRSNAGYIVFGILLSIA
FT                   IIVATLVFGDLDENAIVAVMVFGFFGFFFSVLSIGIGRQFSRGASLSKRIGGIVMLAFA
FT                   GFVAFSVIGGIATQILLDVTHDTKSLALAAIGGIVLTNALFLFLMGAPTPLGRKLMDGI
FT                   EGLRTYLTLAEKDRMNMAGAPAMSPQHFETLLPYAVALGVEKPWSRTFETWLATAAAGA
FT                   AVASYAPGWYAGSNYGSFGDRIGGFSTSMASTIASTIPQPVSSSGSSFSGGGGGGSSGS
FT                   GGGGGGGGGW"
FT   gene            631738..633891
FT                   /gene="glyS"
FT                   /locus_tag="Atu0644"
FT                   /old_locus_tag="AGR_C_1144"
FT   CDS_pept        631738..633891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="Atu0644"
FT                   /old_locus_tag="AGR_C_1144"
FT                   /product="glycyl-tRNA synthetase, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86451"
FT                   /db_xref="GOA:A9CK39"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CK39"
FT                   /protein_id="AAK86451.1"
FT                   /translation="MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVERGLTYEGARE
FT                   YWTPRRLTLDIRGLNARSADVREEKKGPRTDANEKAIEGFLRGAGLNDISEAQVVSDPK
FT                   KGDFYIAIINKPGRPAEEIIAEVMPGIIRSFPWPKSMRSGPASMPKGSSYAGIEGKGSE
FT                   SLRWVRPLQSIVCLFGPEHDETQVIPFVIDGIVAGNITYGHRFHAPGPITVRRFEDYVS
FT                   NLEKAKVILDADRRKDIILHDAKDLAFANGLELVEDEGLLEEVSGLVEWPQVLMGTFEE
FT                   DYLQIPAEIIRLTIKTNQKCFVTRNQGAEEGLSNRFILISNIEASDGGKEIIHGNGKVV
FT                   RARLSDARHFWNRDQGDLPDLETLKDSAAKFDLDLKKPLDQRMAKLDALNVTFHAKLGT
FT                   QGERVARIRELAKALAPVVGADGALVDRAVVLAKADLRTEAVGEFPELQGLMGRKYAVL
FT                   QGENESVAAAIEDHYKPQGPSDRLPADKVAITVALADKLDTLVGFWAIDEKPTGSKDPF
FT                   ALRRAALGVVRILLEKNVRLPLLSVARDSDLLSFFHDRLKVYLRDLGARYDLIDAVLTP
FT                   ESDDLLMIARRVEALTAFITGEDGRNLLAGAKRATQLLAAEEKKGTVVADGVSEELLKL
FT                   DAEKALYAAIKTASADAAKAVEGEDFRSAMQALSTLRAPVDKFFEDVLVNDEDAAIRAN
FT                   RLALLKAIREATGTVADFSKITG"
FT   gene            634124..634618
FT                   /locus_tag="Atu0645"
FT                   /old_locus_tag="AGR_C_1146"
FT   CDS_pept        634124..634618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0645"
FT                   /old_locus_tag="AGR_C_1146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86452"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D112"
FT                   /protein_id="AAK86452.2"
FT                   /translation="MTHTPPKILISACLLGQPVRYDGKGKPLPHPAIERWRKEGRLVTI
FT                   CPEMAGGMPVPRPPAEIEKGASGLDVLEGRARVLEVSGGDVTAEFIAGAEKALALAEAN
FT                   GCTHALLIDGSPSCGSVAIYDGSFSGIKHAGNGVTAALLEKAGIAVFSPADIDRLDALT
FT                   S"
FT   gene            complement(634672..636495)
FT                   /gene="mcpA"
FT                   /locus_tag="Atu0646"
FT                   /old_locus_tag="AGR_C_1147"
FT   CDS_pept        complement(634672..636495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA"
FT                   /locus_tag="Atu0646"
FT                   /old_locus_tag="AGR_C_1147"
FT                   /product="methyl-accepting chemotaxis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86453"
FT                   /db_xref="GOA:Q7D111"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D111"
FT                   /protein_id="AAK86453.2"
FT                   /translation="MKNLSISRQLIVLVVALMAAFGAATFYQLKSATDAIYEERYGMLR
FT                   TQVQSAISILQSFHDKEKAGTLSRDEAMKQAYATVSAMRFTPDGYLFGYDYDVTMKFHP
FT                   DTKRVGENYKGKPDSKGFAYRDELVRLGRNGGGQTDFYGPKPGMEGNDYAKSSYALAFE
FT                   PWQVVVVTGVYIDDLNAQVRGEVMKALSIGALIFVLALAAAFYVIRGISKPLGDIHRAL
FT                   GEVANENVSLAIPHTGLTNEVGMMAKATASLQDKVRERHAMQRREEEQQQQLDAERQNN
FT                   LDMQRDEAALQARVVATIGEALEKLAGGDLTVRCGDLGNRYAALRDNFNEALTHLDAAM
FT                   AKVNTKSIDIGGSKDEIRKASNELSQRTERQAANLEETSAALDELTVAVRQTAEGAADA
FT                   AKRVTTVSSEATRSDRVVEEAITAMSGIEQSSDQISNIIGVIDVIAFQTNLLALNAGVE
FT                   AARAGEAGKGFAVVAQEVRELAQKSAAAAKEIKDQIARSSAQVENGVRLVGEAGDALKR
FT                   ISDQIKSANEIVSKIAHSAAEQDTTLRSISTSLNQLDVATQHNAAMAEETTASAEALAV
FT                   DTEELLNLIRGFRVSSGHQLHGMAREMRMAG"
FT   gene            complement(636820..637329)
FT                   /locus_tag="Atu8084"
FT                   /old_locus_tag="AGR_C_1150"
FT   CDS_pept        complement(636820..637329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8084"
FT                   /old_locus_tag="AGR_C_1150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8084"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86454"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5J0"
FT                   /protein_id="AAK86454.2"
FT                   /translation="MQRLFLTAIVVLTSGSAMASSIEYINDVQVTNGSFVRLNCAGCQP
FT                   LKNKPAAQGYAVPSIEPGTQHTEMHEVDGKRTLVRTEAWLGGAPVTFVSTNPAWMTDPS
FT                   GTVIATYDDAAPEAHPAETASTPAGIDVTATTAAVNAISSDNASKPANASVIDTPQFPD
FT                   FQLRGN"
FT   gene            complement(637485..638756)
FT                   /gene="purD"
FT                   /locus_tag="Atu0647"
FT                   /old_locus_tag="AGR_C_1152"
FT   CDS_pept        complement(637485..638756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="Atu0647"
FT                   /old_locus_tag="AGR_C_1152"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86455"
FT                   /db_xref="GOA:Q8UHN3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8UHN3"
FT                   /protein_id="AAK86455.2"
FT                   /translation="MKVLLIGSGGREHALAWKIAQSPLIDALYAAPGNPGIADHATLVS
FT                   LDVEDHAAVIAFAKEKAIDFVVIGPEAPLVAGLADDLRAAGIATFGPSKAAAQLEGSKG
FT                   FTKDLCARYDIPTGAYERFKAAEPAKDYVRAQGAPIVIKADGLAAGKGVTVAMTEAEAL
FT                   AAIDDCFDGAFGTAGTEVVVEAFLDGEEASFFCLSDGKTALALATAQDHKRVGDGDTGP
FT                   NTGGMGAYSPAPVMTPAMVERTMKEIIEPTISGMAKDGNPFSGVFFAGLMITAKGPELI
FT                   EYNVRFGDPECQVLMMRLKSDLLPILYATATGTLDKVQAEWRDDAALTVVLASKGYPGA
FT                   YDKNTPIAHIPEASEEAKVFHAGTALKDGKLVATGGRVLNVTAFGRNVTEAQARAYALA
FT                   DKVEWENGFCRRDIGWQAIAREKA"
FT   gene            638958..641282
FT                   /locus_tag="Atu0648"
FT                   /old_locus_tag="AGR_C_1153"
FT   CDS_pept        638958..641282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0648"
FT                   /old_locus_tag="AGR_C_1153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86456"
FT                   /db_xref="GOA:Q7D110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D110"
FT                   /protein_id="AAK86456.2"
FT                   /translation="MTADNARLASLIASEINARPDQVKAAVALLDEGATVPFIARYRKE
FT                   VTGGLDDTQLRTLAERLVYLRELNARRASIVDSITGQGKMTDELMVKIMQAGTKAELED
FT                   LYLPYKPKRRTRAEIARERGLGPLAEAIWENRAADPAKLAEAYVKGEVADVKAALEGAR
FT                   DIVAETMTENADLLGRLRDYMRRNATFRAKVVDGKQATGEKFSDYFDHSERWATVPGHR
FT                   ALAMLRGWNEEVLTLTIDVDADDPSPVKPSQRTIAAAFDIRSAGPADQWLMEVAGWTWR
FT                   VKLSMSLSLDLMRELRERAEEEAINVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVA
FT                   IVDGTGKLLDTSTVYPFPPKNDVRGTQAELASLIRKHNVELIAIGNGTGSRETEKLVAD
FT                   LLAQLPASASGAKPTKVIVSEAGASVYSASERAAAEFPNLDVSLRGAVSIARRLQDPLA
FT                   ELVKIEPKSIGVGQYQHDVDQGRLSRSLDAVVEDAVNAVGVDLNTASSPLLARVSGLGS
FT                   SIADAIVAHRDQTGPFASRKELLKVPRLGQRTFEQCAGFLRIPNGKEPLDSSSVHPEAY
FT                   GVAKKIVAACGRDLRSLMGDSAALKALDPKRFIDEQFGLPTVKDIIAELEKPGRDPRPS
FT                   FKTATFADGVDEITDLKPGMLLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDP
FT                   HEVVKAGDVVKVRVVEVDVKRKRIGLTMRKDGGEAVPQPMREKNNAGAMRHATAKPKER
FT                   NEGSQSGGALAAALAEAMKRR"
FT   gene            641451..642707
FT                   /gene="cfa"
FT                   /locus_tag="Atu0649"
FT                   /old_locus_tag="AGR_C_1155"
FT   CDS_pept        641451..642707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="Atu0649"
FT                   /old_locus_tag="AGR_C_1155"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86457"
FT                   /db_xref="GOA:A9CK38"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK38"
FT                   /protein_id="AAK86457.1"
FT                   /translation="MASSLHVLLEKIIKIGDLTVNSPGGSRTFGDGTGKKVVLNFTDEA
FT                   AMQEIAADPALKLAEMYMEGRAKVAKGDIYDFLALVKGNTLSEALSFGMIWRGMARIIA
FT                   ARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQYSCAYFNPPDIGLYEAQVAKKRH
FT                   IAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRVSRDRAAKRGLAG
FT                   NVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIGQ
FT                   PYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERF
FT                   VARKAEAVALYDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQN
FT                   EAKLLEFEKTRPPLEKVSF"
FT   gene            642860..643660
FT                   /locus_tag="Atu0650"
FT                   /old_locus_tag="AGR_C_1156"
FT   CDS_pept        642860..643660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0650"
FT                   /old_locus_tag="AGR_C_1156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86458"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK37"
FT                   /protein_id="AAK86458.2"
FT                   /translation="MFKPSAAVAACVLSLFAVGNAHAEGWFSGDWYLKLGGAGFTAPKY
FT                   QGDNKNEFGFSPIISLGRQGQGARFTSRNDSASISLLDNGPISMGLAGKLVSPRDEGDS
FT                   ADLKGMTRIKRGGELGGFAEAYPTDWLRIRGEARQGIRSHSGVVADLNADVFTDIAPGI
FT                   QVSVGPRATWVSSKYNERYYGVSAAQTAAGAPSPYSPGGGLHSAGVGAAITWKVTENAE
FT                   VGSFAEYRRLMGDAADSSLVRERGSKNQFIVGVQASYKFNFSLP"
FT   gene            643780..644733
FT                   /gene="ubiA"
FT                   /locus_tag="Atu0651"
FT                   /old_locus_tag="AGR_C_1159"
FT   CDS_pept        643780..644733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="Atu0651"
FT                   /old_locus_tag="AGR_C_1159"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86459"
FT                   /db_xref="GOA:A9CK36"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK36"
FT                   /protein_id="AAK86459.1"
FT                   /translation="MVHHSDLSDRVSDAPSNNWVYRILPRPLWPYAQLARWDRPIGWQL
FT                   LMWPCFWAAALAANAAVATGGFSWGTLIWHLVLFFIGSVAMRGAGCTYNDLADHKIDMA
FT                   VARTRSRPLPSGRVSRGQAKLFIVLQALAGLVVLLQFNGFAVITGIASLVFVAIYPFAK
FT                   RFTNWPQFFLGLAFSWGALMGWAGQFGSLAWPAVLLYVGSIAWTIGYDTIYAHQDKEDD
FT                   TAVGIGSTALLFGENTHRWLVVLYGTALVMIFLSFWTAGVNIIAYSGLAAAAIMLFRQV
FT                   WVLDIDNVDQCLVLFKSNNRVGVLIFAGLILPLLLA"
FT   gene            complement(644810..645376)
FT                   /locus_tag="Atu0652"
FT                   /old_locus_tag="AGR_C_1160"
FT   CDS_pept        complement(644810..645376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0652"
FT                   /old_locus_tag="AGR_C_1160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86460"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK35"
FT                   /protein_id="AAK86460.1"
FT                   /translation="MTKTVLKPDWAVATLRLDPARFPQQVTYGKANGATDVAVTLDERG
FT                   AVLRKVLTSSGLPLSFALPARAFKGVAARAIDHGDGQVTVTLELHHDDPDLCVPLLVAH
FT                   DLYDIAADWRSWSEAYRIPMLMVEADGVARPLEEHLGKVRTQNTRPRRRHSYFADRRPR
FT                   FLVRRSTGSLGMSMKIEGKEIIARS"
FT   gene            645744..648182
FT                   /locus_tag="Atu0653"
FT                   /old_locus_tag="AGR_C_1161"
FT   CDS_pept        645744..648182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0653"
FT                   /old_locus_tag="AGR_C_1161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86461"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D105"
FT                   /protein_id="AAK86461.1"
FT                   /translation="MVSTFLSYDLINRDMKSSISRVSQQGLVERQTKYYKENIGNVKSV
FT                   DEFLGNYQLYSYAMDAFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASF
FT                   NFTASTKTVQTDAQLDKMIGLYDTSITNLNGSLAEETRYYKAIIGTVTNADQLLRNDRT
FT                   RAYIFQVFNIDEKTYSYAHIKGLMTSDVNDPNSYINQNYGAAYNDAVEKLTMKGNIELH
FT                   AQVTARITAIDTDLAGTGLTAEERTKLEAEKVTRQNQLTQLEAVLPPKDQWDAKLAAIK
FT                   AEQTTLSNAVTQYNKMAQIANAFEFKNDGTVDAGGAQTADKLKAITDSYIGSAPRVTPT
FT                   VATLNRDYFESKIGSITTVEELMSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSDP
FT                   NNYIATMGKNDKRYLALKNAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAA
FT                   DAKALSLFKSSISKVTSVNDFLGTNAVYTYALRAVGLDPAKVNISDIQRVLTSDLQDKK
FT                   SYVYTLKDDRYVKLAELFNFTKDGSVGSPILAQSEIELQTMSADYIKKKSAFGTEKDKE
FT                   AAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTKEQLQKIFTSNLDDK
FT                   NSYVNKEMDPVFRRLVTAFNFDTEGKLLHEDRSAIQTRRGLYETLDNYLTQTLESQAGE
FT                   ENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGIPDELGNANVDTQVAMMKKY
FT                   FDIKDFQDPDKVKKLIARFTIMYDNKQNVADPIMTLFNGSGSAGISGDTLLAVATLRAR
FT                   "
FT   gene            complement(648223..649173)
FT                   /locus_tag="Atu0654"
FT                   /old_locus_tag="AGR_C_1163"
FT   CDS_pept        complement(648223..649173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0654"
FT                   /old_locus_tag="AGR_C_1163"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86462"
FT                   /db_xref="GOA:A9CK34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK34"
FT                   /protein_id="AAK86462.1"
FT                   /translation="MSAPLDIDQLHTFIAIIDTGSFTKAADRVFKTQSAVSMQMRRLEE
FT                   RIGKQLFAKDGRGNRLTAEGEKLMNYARRIIRLNNEAIAAFDDNRLEGTLRIGTPDDYA
FT                   DRYMPEIIGRFAKTHPNVELYIVCEPSVSLAEKMARGELDIALVTHNPRARSSDVVRTE
FT                   PLCWVASANHPLKDDAPVPLAVGRRDCHWRQLACSALDADGRDYQVLFTSWSSTVVAAA
FT                   VLAGMAVSVLPESALRTGMKVLTAADGFPPLPPVQIGLMKRPGLSPSLVNAITDHITAC
FT                   LDNISPMSVVDEMDSDVKTYPKMPRLRAGHMLPGW"
FT   gene            649376..649669
FT                   /locus_tag="Atu8135"
FT                   /old_locus_tag="AGR_C_1165"
FT   CDS_pept        649376..649669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu8135"
FT                   /old_locus_tag="AGR_C_1165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu8135"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86463"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q8U5I9"
FT                   /protein_id="AAK86463.2"
FT                   /translation="MRTAERRMELELVTARPGDAWRRAAVLGVSGVKTFVQRIYNRIVA
FT                   NGLTELDDRLLADIGLVRSDVSDALNTGLLEDPTSHLTRAARKRAVTRFKTL"
FT   gene            complement(649842..651215)
FT                   /gene="gsh1"
FT                   /locus_tag="Atu0656"
FT                   /old_locus_tag="AGR_C_1167"
FT   CDS_pept        complement(649842..651215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsh1"
FT                   /locus_tag="Atu0656"
FT                   /old_locus_tag="AGR_C_1167"
FT                   /product="glutamate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86464"
FT                   /db_xref="GOA:A9CK33"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK33"
FT                   /protein_id="AAK86464.1"
FT                   /translation="MARDTTDQTPLSSVTELTDYLAAGCRAEADFRIGTEHEKFAFFRK
FT                   DNSPVPYFGEASISALLKGMQEKLGWEPIMDGENIIGLGEQHGMGAISIEPGGQFELSG
FT                   APLENLHQTCKESNQHLATLREVAEPMGIRFLGIGGSPLWTSDETPRMPKSRYAIMTRY
FT                   MPKVGTKGLDMMYRTCTIQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPN
FT                   GLLSWRGDIWRDTDNRRSGVLPFTFSDDFGFKDYVEWALDVPMYFIVRDGKYHDCTHVT
FT                   FRQFMNGALKGEIAAWEPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYNQEALDAADALTADWSFDEVIALRNAVPAKGLAAEIAGKPLLGIARQVLDISR
FT                   TGLKNRKRLNGEGQDETVFLSSLDEVLAKKTTLAEDLLALYNGRWGGSVVPVFEEYQY"
FT   gene            complement(651334..652053)
FT                   /locus_tag="Atu0657"
FT                   /old_locus_tag="AGR_C_1169"
FT   CDS_pept        complement(651334..652053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0657"
FT                   /old_locus_tag="AGR_C_1169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86465"
FT                   /db_xref="GOA:Q7D102"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D102"
FT                   /protein_id="AAK86465.2"
FT                   /translation="MQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRD
FT                   GEWKAKLSFPSRKKISLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLL
FT                   QPVMTQHVQGKIHNSEKLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYC
FT                   DEGDAGQNPLPILQAVKERKIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILRADT
FT                   AAVAALAVIQAVIGDWN"
FT   gene            complement(652090..653595)
FT                   /gene="pit"
FT                   /locus_tag="Atu0658"
FT                   /old_locus_tag="AGR_C_1171"
FT   CDS_pept        complement(652090..653595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="Atu0658"
FT                   /old_locus_tag="AGR_C_1171"
FT                   /product="phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86466"
FT                   /db_xref="GOA:A9CK32"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK32"
FT                   /protein_id="AAK86466.2"
FT                   /translation="MATKPPSNMKPTLDKDLDKITRVEEATLHVTQQLAGLGAGFMFVV
FT                   LAAVFAGAFVTGTAGSVIIIAAVALGAYMAINIGANDVTNNVGPAVGAKAMPLAVALIV
FT                   AAICEIAGALITGGNVVETISSGIINVETIPDRTAFSWAMLSALLAAGLLVNISTWTRA
FT                   PISTTHTVVGGVAGAGMAAYGAKAVEWLSLGSIAFAWVLAPFISAAIAIAILTFIKEFI
FT                   VYRDDKIDAARRWVPVLIGLMAGVFMAYLIWVGLRQLMHVSLGHASIIGLVTGLLAWRL
FT                   CVPIIRKQSEGLENRNQSLRILFQWPLVLAAGLMSFAHGANDVSNAIGPVVAIVRALHD
FT                   EAVQTSARAPLWVMLVGAFGLSCGILLYGPRLIRLVGEQITKLNPMRAFCVSVATALTV
FT                   LVASRFGLPVSTTHTAIGAVFGVGFFREWYTQASRRRQELVQSGTGEPRRTPRYLDNPS
FT                   EVRRRYLVRRSHFMTIIAAWVVTVPASATLAALLYWLLSFLFL"
FT   gene            complement(653758..654237)
FT                   /locus_tag="Atu0659"
FT                   /old_locus_tag="AGR_C_1173"
FT   CDS_pept        complement(653758..654237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0659"
FT                   /old_locus_tag="AGR_C_1173"
FT                   /product="NTP pyrophosphohydrolase, MutT family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86467"
FT                   /db_xref="GOA:A9CK31"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK31"
FT                   /protein_id="AAK86467.1"
FT                   /translation="MKILNRLATDVGLMLRRPPRQQYAALCYRLSKSNPEPEVLLLTSR
FT                   DTGRWVIPKGWPMANKKAHAVAEQEAYEEAGVKGTVEKAPFGYYEYEKKLNSGINVPCK
FT                   VQVHLLEVSEMRDSFPEKDARRLEWVSPREAGKRVNEPELKALMLAFDKRMAHSQ"
FT   gene            complement(654495..655241)
FT                   /locus_tag="Atu0660"
FT                   /old_locus_tag="AGR_C_1175"
FT   CDS_pept        complement(654495..655241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0660"
FT                   /old_locus_tag="AGR_C_1175"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86468"
FT                   /db_xref="GOA:A9CK30"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9CK30"
FT                   /protein_id="AAK86468.1"
FT                   /translation="MKPLRLLSTDLDGTVVGDNDATRRFRDFWHALPDDLRPVLVFNSG
FT                   RLIDDQLALLEEVPLPQPDYIIGGVGTMLHAKKRSELETAYTQSLGTGFDPRKIADVMN
FT                   RIAGVTMQEERYQHGLKSSWFLHDADAAALGEIEAALLAADIDARIVYSSDRDLDILPK
FT                   AADKGAALAWLCGQLRIGLDESVVSGDTGNDRAMFELKTIRGVIVGNALPELVSLAHQD
FT                   NRFFHSTAKEADGVIEGLRHWGLNPR"
FT   gene            complement(655238..656575)
FT                   /locus_tag="Atu0661"
FT                   /old_locus_tag="AGR_C_1178"
FT   CDS_pept        complement(655238..656575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0661"
FT                   /old_locus_tag="AGR_C_1178"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86469"
FT                   /db_xref="GOA:A7TZT2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7TZT2"
FT                   /protein_id="AAK86469.2"
FT                   /translation="MTTTSETERYPRIALISTHGYVAAHPPLGAADTGGQVVYVLELAR
FT                   KLGQLGYTVDLYTRRFEDQPEFDEVDERVRVVRIPCGGRDFIPKEYLHRHLMEWCENAL
FT                   RFIKKNDLNYSFINSHYWDAGVAGQRLSEALKIPHLHTPHSLGIWKKRQMETDYPEKAD
FT                   TFELEFNFKERIQHELIIYRSCDMVIATTPVQLDVLIEDYGLKRKHIHMIPPGYDDNRF
FT                   FPVSDATRQMIRQRFGFEGKVVLALGRLATNKGYDLLIDGFSVLAEREPEARLHLAVGG
FT                   ENMDEQETTILNQLKERVKSLGLEDKVAFSGYVADEDLPDIYRAADLFVLSSRYEPFGM
FT                   TAIEAMASGTPTVVTIHGGLFRAISYGRHALFADPFDKEDLGITMMKPFKHERLYGRLS
FT                   RMGAHKARSLFTWTGIAQQLLALVEGRTMMPVLEEADWAEPWNDGD"
FT   gene            complement(656688..657461)
FT                   /locus_tag="Atu0662"
FT                   /old_locus_tag="AGR_C_1182"
FT   CDS_pept        complement(656688..657461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0662"
FT                   /old_locus_tag="AGR_C_1182"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86470"
FT                   /db_xref="GOA:A9CK28"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK28"
FT                   /protein_id="AAK86470.1"
FT                   /translation="MDETLFARIEHSRTSREVILRFEELILDGILRDGDRLPGERELAQ
FT                   KLDVSRPILREALKELENRGLLTSRHGGGTYVADIVGPVFSDPLSALITRHSRATRDFL
FT                   EYRRYIEGMTAELAAQRATEPDRRNLAAIVERMREAHEAGRFEEELSGDVEFHNAIGEA
FT                   AHNIVLMHTLRSCYRLLSDDIFYNRHLIFTIAGAHDEVLRQHIAIHDAIATGDPAAARA
FT                   AAEAHIDFIMETTSRAHQAREWDRISRLRQQQRSS"
FT   gene            657753..659027
FT                   /locus_tag="Atu0663"
FT                   /old_locus_tag="AGR_C_1185"
FT   CDS_pept        657753..659027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0663"
FT                   /old_locus_tag="AGR_C_1185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86471"
FT                   /db_xref="GOA:A9CK27"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK27"
FT                   /protein_id="AAK86471.1"
FT                   /translation="MAKGRFAFASAPERSLALGEVHARPTVLLAPSRIIVQLAFMMDGG
FT                   SAVHHSVIAEMSRSRGVAPPERDARHHAMPWGQGTLRWERHTEFSTWFWDGPAPEKFGG
FT                   EIAGDPFGDSFSPPGSLISGVRLEIRPENGVTSQAQAMFEPTSLCHSDVRDGQAAILTD
FT                   FRQDRDGLTQILVIDRGLSDYSRGALVQRLLDIETYRTLAMLGLPMAQTLSPEIRRIED
FT                   GLTGITQRMKSDARDEADALLAEMTRLAAELEANAALSLYRFGASRAYDGIVRERIRAL
FT                   AETPVQGHETMGSFLERRMAPAMRTCQSVEERQANLSRKLYRATALVRSWIDVELERQN
FT                   TVLLNTMNKRAAMQLRLQQTVEGLSVAAISYYVVGLIGYLTKAISHDVLPVDPAVVTGI
FT                   SVPFAVLGVWWVVRRIRRSHAEGGH"
FT   gene            complement(659193..660092)
FT                   /locus_tag="Atu0664"
FT                   /old_locus_tag="AGR_C_1186"
FT   CDS_pept        complement(659193..660092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Atu0664"
FT                   /old_locus_tag="AGR_C_1186"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86472"
FT                   /db_xref="GOA:Q7D0Z5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D0Z5"
FT                   /protein_id="AAK86472.2"
FT                   /translation="MANLGDLEVFASVAASGSMSLAAKELGYSPAVISKRIKRLEEKLG
FT                   ARLFQRTTRQISLTEAGQGFYERVLAVLAGLEEAEDFVSGRANTVNGTLKVSAPTSFGR
FT                   MHIAPHLKGFMERHPDLSVNLVLSDEFIDIIEGGYDLAIRIADLNSSSLVARRLAPVRR
FT                   VLCASADYVVAHGMPATIEDLKKHRCLPAHNNDIWRLEGPGGALSIRPEGMLVTNSSEV
FT                   IREAVISGLGIALRSTWDIGHELRSGKLVQVLPGYEGSRNVTLSAVYPSRQFLPAKVRL
FT                   FIDYLAGLYGPSPYWEQG"
FT   gene            660204..661637
FT                   /gene="glcD"
FT                   /locus_tag="Atu0665"
FT                   /old_locus_tag="AGR_C_1189"
FT   CDS_pept        660204..661637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="Atu0665"
FT                   /old_locus_tag="AGR_C_1189"
FT                   /product="glycolate oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86473"
FT                   /db_xref="GOA:A9CK26"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9CK26"
FT                   /protein_id="AAK86473.2"
FT                   /translation="MTQPIKFLEPRAKVVASRDRIIADLKDILPEDCLVHEPRELVPFE
FT                   TDAFVSYRRLPLAVALPKTTEEVAAVMRYCHRYGIPVVPRGAGTSLSGGAIPQEDAVVI
FT                   GLSKMSAILDLDFYNRTARVQAGVTNLSISDAAGAEGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVKMVLVDGTVLELGGNHLDAAGYDLLALVCGSEGQLGIVTE
FT                   ATVRLIARPEGARPVLFGFETSEEAGSCVADIIGAGIIPVAIEFMDKPAIEICEAFAKA
FT                   GYPLDVGALLIIEVEGSEAEMDAMLADIVTIARKHGVKTVKECQSAMEAAAIWKGRKSA
FT                   FGATGRIADYICMDGTVPLSQLSYVLKKTSEITDRLGLRVANVFHAGDGNMHPLILFNA
FT                   NDPDDAARAEEAGNEILKLCVDAGGCLTGEHGVGIEKRDLMRHQYGEADLAQQMAVRAA
FT                   FDEGWLMNPSKVFPLEGRG"
FT   gene            661873..663075
FT                   /gene="glcE"
FT                   /locus_tag="Atu0666"
FT                   /old_locus_tag="AGR_C_1191"
FT   CDS_pept        661873..663075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="Atu0666"
FT                   /old_locus_tag="AGR_C_1191"
FT                   /product="glycolate oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Atu0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAK86474"
FT                   /db_xref="GOA:Q7D0Z3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7D0Z3"
FT                   /protein_id="AAK86474.2"
FT                   /translation="MLTPYAEIQVADIIRDHATRKTPLKIIGGNTRSGFGNAVAAAEAL
FT                   SSRAMAGIVAYNAAEMVMTVRAGTPLAAVEAALAENRQMMAFEPMDHRPIMATEGEPTI
FT                   GGVFAANVSGPRRYVAGAARDSLLGIRFVNGSGEIIKAGGRVMKNVTGLDLSKFLAGSF
FT                   GTLGFLTEVTFRVLPKPPAEKTVVVSGLDDEAATRIMAAAMAMSVEVSGAAHLPESVRS
FT                   HFIDGALPEGPATILRLEGLAASVEARAAKLLSVMDRVGPWTLLEGEDSRLLWRQVRDV
FT                   APYAGQGAKPLWKVSVAPAAGHRLVAALRMEAGIDAFYDWQGGLVWMQMEADPEADLLR
FT                   GAIRALGGGHATLLRASDAVRASVAAFEPRPAAEALLSARIREKLDPAGIFNPGKMAVT
FT                   V"
FT   gene            663091..664392
FT                   /gene="glcF"
FT                   /locus_tag="Atu0667"
FT                   /old_locus_tag="AGR_C_1194"
FT