(data stored in ACNUC8465 zone)

EMBL: AE008691

ID   AE008691; SV 1; circular; genomic DNA; STD; PRO; 2689445 BP.
XX
AC   AE008691; AE012974-AE013217;
XX
PR   Project:PRJNA249;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Thermoanaerobacter tengcongensis MB4, complete genome.
XX
KW   .
XX
OS   Caldanaerobacter subterraneus subsp. tengcongensis MB4
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacteraceae; Caldanaerobacter.
XX
RN   [1]
RP   1-2689445
RX   DOI; 10.1101/gr.219302.
RX   PUBMED; 11997336.
RA   Bao Q., Tian Y., Li W., Xu Z., Xuan Z., Hu S., Dong W., Yang J., Chen Y.,
RA   Xue Y., Xu Y., Lai X., Huang L., Dong X., Ma Y., Ling L., Tan H., Chen R.,
RA   Wang J., Yu J., Yang H.;
RT   "A complete sequence of the T. tengcongensis genome";
RL   Genome Res. 12(5):689-700(2002).
XX
RN   [2]
RP   1-2689445
RA   Bao Q., Xu Z., Hu S., Dong W., Chen Y., Wang J., Yu J., Yang H.;
RT   ;
RL   Submitted (07-OCT-2001) to the INSDC.
RL   Beijing Genomics Institute/Genomics and Bioinformatics Center, Institute of
RL   Genetics and Development, Chinese Academy of Sciences, Beijing Airport
RL   Industrial Zone B6, Beijing 101300, China
XX
RN   [3]
RP   1-2689445
RA   Li W., Xuan Z., Yang J., Ling L., Chen R.;
RT   ;
RL   Submitted (07-OCT-2001) to the INSDC.
RL   Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China
XX
RN   [4]
RP   1-2689445
RA   Tian Y., Xue Y., Xu Y., Lai X., Huang L., Dong X., Ma Y., Tan H.;
RT   ;
RL   Submitted (07-OCT-2001) to the INSDC.
RL   Institute of Microbiology, Chinese Academy of Sciences, Beijing 100080,
RL   China
XX
DR   MD5; 8af654293a8ff3dba55c40ff19eb158e.
DR   BioSample; SAMN02603009.
DR   EnsemblGenomes-Gn; EBG00001069062.
DR   EnsemblGenomes-Gn; EBG00001069063.
DR   EnsemblGenomes-Gn; EBG00001069064.
DR   EnsemblGenomes-Gn; EBG00001069065.
DR   EnsemblGenomes-Gn; EBG00001069066.
DR   EnsemblGenomes-Gn; EBG00001069067.
DR   EnsemblGenomes-Gn; EBG00001069068.
DR   EnsemblGenomes-Gn; EBG00001069069.
DR   EnsemblGenomes-Gn; EBG00001069070.
DR   EnsemblGenomes-Gn; EBG00001069071.
DR   EnsemblGenomes-Gn; EBG00001069072.
DR   EnsemblGenomes-Gn; EBG00001069073.
DR   EnsemblGenomes-Gn; EBG00001069074.
DR   EnsemblGenomes-Gn; EBG00001069075.
DR   EnsemblGenomes-Gn; EBG00001069076.
DR   EnsemblGenomes-Gn; EBG00001069077.
DR   EnsemblGenomes-Gn; EBG00001069078.
DR   EnsemblGenomes-Gn; EBG00001069079.
DR   EnsemblGenomes-Gn; EBG00001069080.
DR   EnsemblGenomes-Gn; EBG00001069081.
DR   EnsemblGenomes-Gn; EBG00001069082.
DR   EnsemblGenomes-Gn; EBG00001069083.
DR   EnsemblGenomes-Gn; EBG00001069084.
DR   EnsemblGenomes-Gn; EBG00001069085.
DR   EnsemblGenomes-Gn; EBG00001069086.
DR   EnsemblGenomes-Gn; EBG00001069087.
DR   EnsemblGenomes-Gn; EBG00001069088.
DR   EnsemblGenomes-Gn; EBG00001069089.
DR   EnsemblGenomes-Gn; EBG00001069090.
DR   EnsemblGenomes-Gn; EBG00001069091.
DR   EnsemblGenomes-Gn; EBG00001069092.
DR   EnsemblGenomes-Gn; EBG00001069093.
DR   EnsemblGenomes-Gn; EBG00001069094.
DR   EnsemblGenomes-Gn; EBG00001069095.
DR   EnsemblGenomes-Gn; EBG00001069096.
DR   EnsemblGenomes-Gn; EBG00001069097.
DR   EnsemblGenomes-Gn; EBG00001069098.
DR   EnsemblGenomes-Gn; EBG00001069099.
DR   EnsemblGenomes-Gn; EBG00001069100.
DR   EnsemblGenomes-Gn; EBG00001069101.
DR   EnsemblGenomes-Gn; EBG00001069102.
DR   EnsemblGenomes-Gn; EBG00001069103.
DR   EnsemblGenomes-Gn; EBG00001069104.
DR   EnsemblGenomes-Gn; EBG00001069105.
DR   EnsemblGenomes-Gn; EBG00001069106.
DR   EnsemblGenomes-Gn; EBG00001069107.
DR   EnsemblGenomes-Gn; EBG00001069108.
DR   EnsemblGenomes-Gn; EBG00001069109.
DR   EnsemblGenomes-Gn; EBG00001069110.
DR   EnsemblGenomes-Gn; EBG00001069111.
DR   EnsemblGenomes-Gn; EBG00001069112.
DR   EnsemblGenomes-Gn; EBG00001069113.
DR   EnsemblGenomes-Gn; EBG00001069114.
DR   EnsemblGenomes-Gn; EBG00001069115.
DR   EnsemblGenomes-Gn; EBG00001069116.
DR   EnsemblGenomes-Gn; EBG00001069117.
DR   EnsemblGenomes-Gn; EBG00001069118.
DR   EnsemblGenomes-Gn; EBG00001069119.
DR   EnsemblGenomes-Gn; EBG00001069120.
DR   EnsemblGenomes-Gn; EBG00001069121.
DR   EnsemblGenomes-Gn; EBG00001069122.
DR   EnsemblGenomes-Gn; EBG00001069123.
DR   EnsemblGenomes-Gn; EBG00001069124.
DR   EnsemblGenomes-Gn; EBG00001069125.
DR   EnsemblGenomes-Gn; EBG00001069126.
DR   EnsemblGenomes-Gn; EBG00001069127.
DR   EnsemblGenomes-Gn; EBG00001069128.
DR   EnsemblGenomes-Gn; EBG00001069129.
DR   EnsemblGenomes-Gn; EBG00001069130.
DR   EnsemblGenomes-Gn; EBG00001069131.
DR   EnsemblGenomes-Gn; EBG00001069132.
DR   EnsemblGenomes-Gn; EBG00001069133.
DR   EnsemblGenomes-Gn; EBG00001069134.
DR   EnsemblGenomes-Gn; EBG00001069135.
DR   EnsemblGenomes-Gn; EBG00001069136.
DR   EnsemblGenomes-Gn; EBG00001069137.
DR   EnsemblGenomes-Gn; EBG00001069138.
DR   EnsemblGenomes-Gn; EBG00001069139.
DR   EnsemblGenomes-Gn; EBG00001069140.
DR   EnsemblGenomes-Gn; EBG00001069141.
DR   EnsemblGenomes-Gn; EBG00001069142.
DR   EnsemblGenomes-Gn; EBG00001069143.
DR   EnsemblGenomes-Gn; EBG00001069144.
DR   EnsemblGenomes-Gn; EBG00001069145.
DR   EnsemblGenomes-Gn; EBG00001069146.
DR   EnsemblGenomes-Gn; EBG00001069147.
DR   EnsemblGenomes-Gn; EBG00001069148.
DR   EnsemblGenomes-Gn; EBG00001069149.
DR   EnsemblGenomes-Gn; EBG00001069150.
DR   EnsemblGenomes-Gn; EBG00001069151.
DR   EnsemblGenomes-Gn; EBG00001069152.
DR   EnsemblGenomes-Gn; EBG00001069153.
DR   EnsemblGenomes-Gn; EBG00001069154.
DR   EnsemblGenomes-Gn; EBG00001069155.
DR   EnsemblGenomes-Gn; EBG00001069156.
DR   EnsemblGenomes-Gn; EBG00001069157.
DR   EnsemblGenomes-Gn; EBG00001069158.
DR   EnsemblGenomes-Gn; EBG00001069159.
DR   EnsemblGenomes-Gn; EBG00001069160.
DR   EnsemblGenomes-Gn; EBG00001069161.
DR   EnsemblGenomes-Gn; EBG00001069162.
DR   EnsemblGenomes-Gn; EBG00001069163.
DR   EnsemblGenomes-Gn; EBG00001069164.
DR   EnsemblGenomes-Gn; EBG00001069165.
DR   EnsemblGenomes-Gn; EBG00001069166.
DR   EnsemblGenomes-Gn; EBG00001069167.
DR   EnsemblGenomes-Gn; EBG00001069168.
DR   EnsemblGenomes-Gn; EBG00001069169.
DR   EnsemblGenomes-Gn; EBG00001069170.
DR   EnsemblGenomes-Gn; EBG00001069171.
DR   EnsemblGenomes-Gn; EBG00001069172.
DR   EnsemblGenomes-Gn; EBG00001069173.
DR   EnsemblGenomes-Gn; EBG00001069174.
DR   EnsemblGenomes-Gn; EBG00001069175.
DR   EnsemblGenomes-Gn; EBG00001069176.
DR   EnsemblGenomes-Gn; EBG00001069177.
DR   EnsemblGenomes-Gn; EBG00001069178.
DR   EnsemblGenomes-Gn; EBG00001069179.
DR   EnsemblGenomes-Gn; EBG00001069180.
DR   EnsemblGenomes-Gn; EBG00001069181.
DR   EnsemblGenomes-Gn; EBG00001069182.
DR   EnsemblGenomes-Gn; EBG00001069183.
DR   EnsemblGenomes-Gn; EBG00001069184.
DR   EnsemblGenomes-Gn; EBG00001069185.
DR   EnsemblGenomes-Gn; EBG00001069186.
DR   EnsemblGenomes-Gn; EBG00001069187.
DR   EnsemblGenomes-Gn; EBG00001069188.
DR   EnsemblGenomes-Gn; EBG00001069189.
DR   EnsemblGenomes-Gn; EBG00001069190.
DR   EnsemblGenomes-Gn; EBG00001069191.
DR   EnsemblGenomes-Gn; EBG00001069192.
DR   EnsemblGenomes-Gn; EBG00001069193.
DR   EnsemblGenomes-Gn; EBG00001069194.
DR   EnsemblGenomes-Gn; EBG00001069195.
DR   EnsemblGenomes-Gn; EBG00001069196.
DR   EnsemblGenomes-Gn; EBG00001069197.
DR   EnsemblGenomes-Gn; EBG00001069198.
DR   EnsemblGenomes-Gn; EBG00001069199.
DR   EnsemblGenomes-Gn; EBG00001069200.
DR   EnsemblGenomes-Gn; EBG00001069201.
DR   EnsemblGenomes-Gn; EBG00001069202.
DR   EnsemblGenomes-Gn; EBG00001069203.
DR   EnsemblGenomes-Gn; EBG00001069204.
DR   EnsemblGenomes-Gn; EBG00001069205.
DR   EnsemblGenomes-Gn; EBG00001069206.
DR   EnsemblGenomes-Gn; EBG00001069207.
DR   EnsemblGenomes-Gn; EBG00001069208.
DR   EnsemblGenomes-Gn; EBG00001069209.
DR   EnsemblGenomes-Gn; EBG00001069210.
DR   EnsemblGenomes-Gn; EBG00001069211.
DR   EnsemblGenomes-Gn; EBG00001069212.
DR   EnsemblGenomes-Gn; EBG00001069213.
DR   EnsemblGenomes-Gn; EBG00001069214.
DR   EnsemblGenomes-Gn; EBG00001069215.
DR   EnsemblGenomes-Gn; EBG00001069216.
DR   EnsemblGenomes-Gn; EBG00001069217.
DR   EnsemblGenomes-Gn; EBG00001069219.
DR   EnsemblGenomes-Gn; EBG00001069221.
DR   EnsemblGenomes-Gn; EBG00001069223.
DR   EnsemblGenomes-Gn; EBG00001069225.
DR   EnsemblGenomes-Gn; EBG00001069227.
DR   EnsemblGenomes-Gn; EBG00001069229.
DR   EnsemblGenomes-Gn; EBG00001069231.
DR   EnsemblGenomes-Gn; EBG00001069233.
DR   EnsemblGenomes-Gn; EBG00001069235.
DR   EnsemblGenomes-Gn; EBG00001069237.
DR   EnsemblGenomes-Gn; EBG00001069239.
DR   EnsemblGenomes-Gn; EBG00001069241.
DR   EnsemblGenomes-Gn; EBG00001069243.
DR   EnsemblGenomes-Gn; EBG00001069246.
DR   EnsemblGenomes-Gn; EBG00001069248.
DR   EnsemblGenomes-Gn; EBG00001069250.
DR   EnsemblGenomes-Gn; EBG00001069252.
DR   EnsemblGenomes-Gn; EBG00001069254.
DR   EnsemblGenomes-Gn; EBG00001069256.
DR   EnsemblGenomes-Gn; EBG00001069258.
DR   EnsemblGenomes-Gn; EBG00001069260.
DR   EnsemblGenomes-Gn; EBG00001069262.
DR   EnsemblGenomes-Gn; EBG00001069264.
DR   EnsemblGenomes-Gn; EBG00001069266.
DR   EnsemblGenomes-Gn; EBG00001069269.
DR   EnsemblGenomes-Gn; EBG00001069271.
DR   EnsemblGenomes-Gn; EBG00001069273.
DR   EnsemblGenomes-Gn; EBG00001069278.
DR   EnsemblGenomes-Gn; EBG00001069280.
DR   EnsemblGenomes-Gn; EBG00001069282.
DR   EnsemblGenomes-Gn; EBG00001069284.
DR   EnsemblGenomes-Gn; EBG00001069286.
DR   EnsemblGenomes-Gn; EBG00001069288.
DR   EnsemblGenomes-Gn; EBG00001069290.
DR   EnsemblGenomes-Gn; EBG00001069292.
DR   EnsemblGenomes-Gn; EBG00001069294.
DR   EnsemblGenomes-Gn; EBG00001069296.
DR   EnsemblGenomes-Gn; EBG00001069298.
DR   EnsemblGenomes-Gn; EBG00001069300.
DR   EnsemblGenomes-Gn; EBG00001069301.
DR   EnsemblGenomes-Gn; EBG00001069302.
DR   EnsemblGenomes-Gn; EBG00001069303.
DR   EnsemblGenomes-Gn; EBG00001069304.
DR   EnsemblGenomes-Gn; EBG00001069305.
DR   EnsemblGenomes-Gn; EBG00001069306.
DR   EnsemblGenomes-Gn; EBG00001069307.
DR   EnsemblGenomes-Gn; EBG00001069308.
DR   EnsemblGenomes-Gn; EBG00001069309.
DR   EnsemblGenomes-Gn; EBG00001069310.
DR   EnsemblGenomes-Gn; EBG00001069311.
DR   EnsemblGenomes-Gn; EBG00001069312.
DR   EnsemblGenomes-Gn; EBG00001069313.
DR   EnsemblGenomes-Gn; EBG00001069314.
DR   EnsemblGenomes-Gn; EBG00001069315.
DR   EnsemblGenomes-Gn; EBG00001069316.
DR   EnsemblGenomes-Gn; EBG00001069317.
DR   EnsemblGenomes-Gn; EBG00001069318.
DR   EnsemblGenomes-Gn; EBG00001069319.
DR   EnsemblGenomes-Gn; EBG00001069320.
DR   EnsemblGenomes-Gn; EBG00001069321.
DR   EnsemblGenomes-Gn; EBG00001069322.
DR   EnsemblGenomes-Gn; EBG00001069323.
DR   EnsemblGenomes-Gn; EBG00001069324.
DR   EnsemblGenomes-Gn; EBG00001069325.
DR   EnsemblGenomes-Gn; EBG00001069326.
DR   EnsemblGenomes-Gn; EBG00001069327.
DR   EnsemblGenomes-Gn; EBG00001069328.
DR   EnsemblGenomes-Gn; EBG00001069329.
DR   EnsemblGenomes-Gn; EBG00001069330.
DR   EnsemblGenomes-Gn; EBG00001069331.
DR   EnsemblGenomes-Gn; EBG00001069332.
DR   EnsemblGenomes-Gn; EBG00001069333.
DR   EnsemblGenomes-Gn; EBG00001069334.
DR   EnsemblGenomes-Gn; EBG00001069335.
DR   EnsemblGenomes-Gn; EBG00001069336.
DR   EnsemblGenomes-Gn; EBG00001069337.
DR   EnsemblGenomes-Gn; EBG00001069338.
DR   EnsemblGenomes-Gn; EBG00001069339.
DR   EnsemblGenomes-Gn; EBG00001069340.
DR   EnsemblGenomes-Gn; EBG00001069341.
DR   EnsemblGenomes-Gn; EBG00001069342.
DR   EnsemblGenomes-Gn; EBG00001069343.
DR   EnsemblGenomes-Gn; EBG00001069344.
DR   EnsemblGenomes-Gn; EBG00001069345.
DR   EnsemblGenomes-Gn; EBG00001069346.
DR   EnsemblGenomes-Gn; EBG00001069347.
DR   EnsemblGenomes-Gn; EBG00001069348.
DR   EnsemblGenomes-Gn; EBG00001069349.
DR   EnsemblGenomes-Gn; EBG00001069350.
DR   EnsemblGenomes-Gn; EBG00001069351.
DR   EnsemblGenomes-Gn; EBG00001069352.
DR   EnsemblGenomes-Gn; EBG00001069353.
DR   EnsemblGenomes-Gn; EBG00001069354.
DR   EnsemblGenomes-Gn; EBG00001069355.
DR   EnsemblGenomes-Gn; EBG00001069356.
DR   EnsemblGenomes-Gn; EBG00001069357.
DR   EnsemblGenomes-Gn; EBG00001069358.
DR   EnsemblGenomes-Gn; EBG00001069359.
DR   EnsemblGenomes-Gn; EBG00001069360.
DR   EnsemblGenomes-Gn; EBG00001069361.
DR   EnsemblGenomes-Gn; EBG00001069362.
DR   EnsemblGenomes-Gn; EBG00001069363.
DR   EnsemblGenomes-Gn; EBG00001069364.
DR   EnsemblGenomes-Gn; EBG00001069365.
DR   EnsemblGenomes-Gn; EBG00001069366.
DR   EnsemblGenomes-Gn; EBG00001069367.
DR   EnsemblGenomes-Gn; EBG00001069368.
DR   EnsemblGenomes-Gn; EBG00001069369.
DR   EnsemblGenomes-Gn; EBG00001069370.
DR   EnsemblGenomes-Gn; EBG00001069371.
DR   EnsemblGenomes-Gn; EBG00001069372.
DR   EnsemblGenomes-Gn; EBG00001069373.
DR   EnsemblGenomes-Gn; EBG00001069375.
DR   EnsemblGenomes-Gn; EBG00001069376.
DR   EnsemblGenomes-Gn; EBG00001069378.
DR   EnsemblGenomes-Gn; EBG00001069381.
DR   EnsemblGenomes-Gn; EBG00001069383.
DR   EnsemblGenomes-Gn; EBG00001069385.
DR   EnsemblGenomes-Gn; EBG00001069387.
DR   EnsemblGenomes-Gn; EBG00001069389.
DR   EnsemblGenomes-Gn; EBG00001069391.
DR   EnsemblGenomes-Gn; EBG00001069393.
DR   EnsemblGenomes-Gn; EBG00001069395.
DR   EnsemblGenomes-Gn; EBG00001069397.
DR   EnsemblGenomes-Gn; EBG00001069398.
DR   EnsemblGenomes-Gn; EBG00001069400.
DR   EnsemblGenomes-Gn; EBG00001069402.
DR   EnsemblGenomes-Gn; EBG00001069404.
DR   EnsemblGenomes-Gn; EBG00001069407.
DR   EnsemblGenomes-Gn; EBG00001069409.
DR   EnsemblGenomes-Gn; EBG00001069411.
DR   EnsemblGenomes-Gn; EBG00001069413.
DR   EnsemblGenomes-Gn; EBG00001069415.
DR   EnsemblGenomes-Gn; EBG00001069417.
DR   EnsemblGenomes-Gn; EBG00001069419.
DR   EnsemblGenomes-Gn; EBG00001069421.
DR   EnsemblGenomes-Gn; EBG00001069423.
DR   EnsemblGenomes-Gn; EBG00001069425.
DR   EnsemblGenomes-Gn; EBG00001069426.
DR   EnsemblGenomes-Gn; EBG00001069428.
DR   EnsemblGenomes-Gn; EBG00001069429.
DR   EnsemblGenomes-Gn; EBG00001069430.
DR   EnsemblGenomes-Gn; EBG00001069432.
DR   EnsemblGenomes-Gn; EBG00001069433.
DR   EnsemblGenomes-Gn; EBG00001069434.
DR   EnsemblGenomes-Gn; EBG00001069435.
DR   EnsemblGenomes-Gn; EBG00001069437.
DR   EnsemblGenomes-Gn; EBG00001069439.
DR   EnsemblGenomes-Gn; EBG00001069441.
DR   EnsemblGenomes-Gn; EBG00001069443.
DR   EnsemblGenomes-Gn; EBG00001069444.
DR   EnsemblGenomes-Gn; EBG00001069446.
DR   EnsemblGenomes-Gn; EBG00001069448.
DR   EnsemblGenomes-Gn; EBG00001069450.
DR   EnsemblGenomes-Gn; EBG00001069453.
DR   EnsemblGenomes-Gn; EBG00001069455.
DR   EnsemblGenomes-Gn; EBG00001069457.
DR   EnsemblGenomes-Gn; EBG00001069459.
DR   EnsemblGenomes-Gn; EBG00001069461.
DR   EnsemblGenomes-Gn; EBG00001069463.
DR   EnsemblGenomes-Gn; EBG00001069465.
DR   EnsemblGenomes-Gn; EBG00001069467.
DR   EnsemblGenomes-Gn; EBG00001069469.
DR   EnsemblGenomes-Gn; EBG00001069471.
DR   EnsemblGenomes-Gn; EBG00001069472.
DR   EnsemblGenomes-Gn; EBG00001069473.
DR   EnsemblGenomes-Gn; EBG00001069474.
DR   EnsemblGenomes-Gn; EBG00001069475.
DR   EnsemblGenomes-Gn; EBG00001069476.
DR   EnsemblGenomes-Gn; EBG00001069477.
DR   EnsemblGenomes-Gn; EBG00001069478.
DR   EnsemblGenomes-Gn; EBG00001069479.
DR   EnsemblGenomes-Gn; EBG00001069480.
DR   EnsemblGenomes-Gn; EBG00001069481.
DR   EnsemblGenomes-Gn; EBG00001069482.
DR   EnsemblGenomes-Gn; EBG00001069483.
DR   EnsemblGenomes-Gn; EBG00001069484.
DR   EnsemblGenomes-Gn; EBG00001069485.
DR   EnsemblGenomes-Gn; EBG00001069486.
DR   EnsemblGenomes-Gn; EBG00001069487.
DR   EnsemblGenomes-Gn; EBG00001069488.
DR   EnsemblGenomes-Gn; EBG00001069489.
DR   EnsemblGenomes-Gn; EBG00001069490.
DR   EnsemblGenomes-Gn; EBG00001069491.
DR   EnsemblGenomes-Gn; EBG00001069492.
DR   EnsemblGenomes-Gn; EBG00001069493.
DR   EnsemblGenomes-Gn; EBG00001069494.
DR   EnsemblGenomes-Gn; EBG00001069495.
DR   EnsemblGenomes-Gn; EBG00001069496.
DR   EnsemblGenomes-Gn; EBG00001069497.
DR   EnsemblGenomes-Gn; EBG00001069498.
DR   EnsemblGenomes-Gn; EBG00001069499.
DR   EnsemblGenomes-Gn; EBG00001069500.
DR   EnsemblGenomes-Gn; EBG00001069501.
DR   EnsemblGenomes-Gn; EBG00001069502.
DR   EnsemblGenomes-Gn; EBG00001069503.
DR   EnsemblGenomes-Gn; EBG00001069504.
DR   EnsemblGenomes-Gn; EBG00001069505.
DR   EnsemblGenomes-Gn; EBG00001069506.
DR   EnsemblGenomes-Gn; EBG00001069507.
DR   EnsemblGenomes-Gn; EBG00001069508.
DR   EnsemblGenomes-Gn; EBG00001069509.
DR   EnsemblGenomes-Gn; EBG00001069510.
DR   EnsemblGenomes-Gn; EBG00001069511.
DR   EnsemblGenomes-Gn; EBG00001069512.
DR   EnsemblGenomes-Gn; EBG00001069513.
DR   EnsemblGenomes-Gn; EBG00001069514.
DR   EnsemblGenomes-Gn; EBG00001069515.
DR   EnsemblGenomes-Gn; EBG00001069516.
DR   EnsemblGenomes-Gn; EBG00001069517.
DR   EnsemblGenomes-Gn; EBG00001069518.
DR   EnsemblGenomes-Gn; EBG00001069519.
DR   EnsemblGenomes-Gn; EBG00001069520.
DR   EnsemblGenomes-Gn; EBG00001069521.
DR   EnsemblGenomes-Gn; EBG00001069522.
DR   EnsemblGenomes-Gn; EBG00001069523.
DR   EnsemblGenomes-Gn; EBG00001069524.
DR   EnsemblGenomes-Gn; EBG00001069525.
DR   EnsemblGenomes-Gn; EBG00001069526.
DR   EnsemblGenomes-Gn; EBG00001069527.
DR   EnsemblGenomes-Gn; EBG00001069528.
DR   EnsemblGenomes-Gn; EBG00001069529.
DR   EnsemblGenomes-Gn; EBG00001069530.
DR   EnsemblGenomes-Gn; EBG00001069531.
DR   EnsemblGenomes-Gn; EBG00001069532.
DR   EnsemblGenomes-Gn; EBG00001069533.
DR   EnsemblGenomes-Gn; EBG00001069534.
DR   EnsemblGenomes-Gn; EBG00001069535.
DR   EnsemblGenomes-Gn; EBG00001069536.
DR   EnsemblGenomes-Gn; EBG00001069537.
DR   EnsemblGenomes-Gn; EBG00001069538.
DR   EnsemblGenomes-Gn; EBG00001069539.
DR   EnsemblGenomes-Gn; EBG00001069540.
DR   EnsemblGenomes-Gn; EBG00001069541.
DR   EnsemblGenomes-Gn; TTEr01.
DR   EnsemblGenomes-Gn; TTEr02.
DR   EnsemblGenomes-Gn; TTEr03.
DR   EnsemblGenomes-Gn; TTEr04.
DR   EnsemblGenomes-Gn; TTEr05.
DR   EnsemblGenomes-Gn; TTEr06.
DR   EnsemblGenomes-Gn; TTEr07.
DR   EnsemblGenomes-Gn; TTEr08.
DR   EnsemblGenomes-Gn; TTEr09.
DR   EnsemblGenomes-Gn; TTEr10.
DR   EnsemblGenomes-Gn; TTEr11.
DR   EnsemblGenomes-Gn; TTEr12.
DR   EnsemblGenomes-Gn; TTEt01.
DR   EnsemblGenomes-Gn; TTEt02.
DR   EnsemblGenomes-Gn; TTEt03.
DR   EnsemblGenomes-Gn; TTEt04.
DR   EnsemblGenomes-Gn; TTEt05.
DR   EnsemblGenomes-Gn; TTEt06.
DR   EnsemblGenomes-Gn; TTEt07.
DR   EnsemblGenomes-Gn; TTEt08.
DR   EnsemblGenomes-Gn; TTEt09.
DR   EnsemblGenomes-Gn; TTEt10.
DR   EnsemblGenomes-Gn; TTEt11.
DR   EnsemblGenomes-Gn; TTEt12.
DR   EnsemblGenomes-Gn; TTEt13.
DR   EnsemblGenomes-Gn; TTEt14.
DR   EnsemblGenomes-Gn; TTEt15.
DR   EnsemblGenomes-Gn; TTEt16.
DR   EnsemblGenomes-Gn; TTEt17.
DR   EnsemblGenomes-Gn; TTEt18.
DR   EnsemblGenomes-Gn; TTEt19.
DR   EnsemblGenomes-Gn; TTEt20.
DR   EnsemblGenomes-Gn; TTEt21.
DR   EnsemblGenomes-Gn; TTEt22.
DR   EnsemblGenomes-Gn; TTEt23.
DR   EnsemblGenomes-Gn; TTEt24.
DR   EnsemblGenomes-Gn; TTEt25.
DR   EnsemblGenomes-Gn; TTEt26.
DR   EnsemblGenomes-Gn; TTEt27.
DR   EnsemblGenomes-Gn; TTEt28.
DR   EnsemblGenomes-Gn; TTEt29.
DR   EnsemblGenomes-Gn; TTEt30.
DR   EnsemblGenomes-Gn; TTEt31.
DR   EnsemblGenomes-Gn; TTEt32.
DR   EnsemblGenomes-Gn; TTEt33.
DR   EnsemblGenomes-Gn; TTEt34.
DR   EnsemblGenomes-Gn; TTEt35.
DR   EnsemblGenomes-Gn; TTEt36.
DR   EnsemblGenomes-Gn; TTEt37.
DR   EnsemblGenomes-Gn; TTEt38.
DR   EnsemblGenomes-Gn; TTEt39.
DR   EnsemblGenomes-Gn; TTEt40.
DR   EnsemblGenomes-Gn; TTEt41.
DR   EnsemblGenomes-Gn; TTEt42.
DR   EnsemblGenomes-Gn; TTEt43.
DR   EnsemblGenomes-Gn; TTEt44.
DR   EnsemblGenomes-Gn; TTEt45.
DR   EnsemblGenomes-Gn; TTEt46.
DR   EnsemblGenomes-Gn; TTEt47.
DR   EnsemblGenomes-Gn; TTEt48.
DR   EnsemblGenomes-Gn; TTEt49.
DR   EnsemblGenomes-Gn; TTEt50.
DR   EnsemblGenomes-Gn; TTEt51.
DR   EnsemblGenomes-Gn; TTEt52.
DR   EnsemblGenomes-Gn; TTEt53.
DR   EnsemblGenomes-Gn; TTEt54.
DR   EnsemblGenomes-Gn; TTEt55.
DR   EnsemblGenomes-Tr; EBT00001671486.
DR   EnsemblGenomes-Tr; EBT00001671487.
DR   EnsemblGenomes-Tr; EBT00001671488.
DR   EnsemblGenomes-Tr; EBT00001671489.
DR   EnsemblGenomes-Tr; EBT00001671490.
DR   EnsemblGenomes-Tr; EBT00001671491.
DR   EnsemblGenomes-Tr; EBT00001671492.
DR   EnsemblGenomes-Tr; EBT00001671493.
DR   EnsemblGenomes-Tr; EBT00001671494.
DR   EnsemblGenomes-Tr; EBT00001671495.
DR   EnsemblGenomes-Tr; EBT00001671496.
DR   EnsemblGenomes-Tr; EBT00001671497.
DR   EnsemblGenomes-Tr; EBT00001671498.
DR   EnsemblGenomes-Tr; EBT00001671499.
DR   EnsemblGenomes-Tr; EBT00001671500.
DR   EnsemblGenomes-Tr; EBT00001671501.
DR   EnsemblGenomes-Tr; EBT00001671502.
DR   EnsemblGenomes-Tr; EBT00001671503.
DR   EnsemblGenomes-Tr; EBT00001671504.
DR   EnsemblGenomes-Tr; EBT00001671505.
DR   EnsemblGenomes-Tr; EBT00001671506.
DR   EnsemblGenomes-Tr; EBT00001671507.
DR   EnsemblGenomes-Tr; EBT00001671508.
DR   EnsemblGenomes-Tr; EBT00001671509.
DR   EnsemblGenomes-Tr; EBT00001671510.
DR   EnsemblGenomes-Tr; EBT00001671511.
DR   EnsemblGenomes-Tr; EBT00001671512.
DR   EnsemblGenomes-Tr; EBT00001671513.
DR   EnsemblGenomes-Tr; EBT00001671514.
DR   EnsemblGenomes-Tr; EBT00001671515.
DR   EnsemblGenomes-Tr; EBT00001671516.
DR   EnsemblGenomes-Tr; EBT00001671517.
DR   EnsemblGenomes-Tr; EBT00001671518.
DR   EnsemblGenomes-Tr; EBT00001671519.
DR   EnsemblGenomes-Tr; EBT00001671520.
DR   EnsemblGenomes-Tr; EBT00001671521.
DR   EnsemblGenomes-Tr; EBT00001671522.
DR   EnsemblGenomes-Tr; EBT00001671523.
DR   EnsemblGenomes-Tr; EBT00001671524.
DR   EnsemblGenomes-Tr; EBT00001671525.
DR   EnsemblGenomes-Tr; EBT00001671526.
DR   EnsemblGenomes-Tr; EBT00001671527.
DR   EnsemblGenomes-Tr; EBT00001671528.
DR   EnsemblGenomes-Tr; EBT00001671529.
DR   EnsemblGenomes-Tr; EBT00001671530.
DR   EnsemblGenomes-Tr; EBT00001671531.
DR   EnsemblGenomes-Tr; EBT00001671532.
DR   EnsemblGenomes-Tr; EBT00001671533.
DR   EnsemblGenomes-Tr; EBT00001671534.
DR   EnsemblGenomes-Tr; EBT00001671535.
DR   EnsemblGenomes-Tr; EBT00001671536.
DR   EnsemblGenomes-Tr; EBT00001671537.
DR   EnsemblGenomes-Tr; EBT00001671538.
DR   EnsemblGenomes-Tr; EBT00001671539.
DR   EnsemblGenomes-Tr; EBT00001671540.
DR   EnsemblGenomes-Tr; EBT00001671541.
DR   EnsemblGenomes-Tr; EBT00001671542.
DR   EnsemblGenomes-Tr; EBT00001671543.
DR   EnsemblGenomes-Tr; EBT00001671544.
DR   EnsemblGenomes-Tr; EBT00001671545.
DR   EnsemblGenomes-Tr; EBT00001671546.
DR   EnsemblGenomes-Tr; EBT00001671547.
DR   EnsemblGenomes-Tr; EBT00001671548.
DR   EnsemblGenomes-Tr; EBT00001671549.
DR   EnsemblGenomes-Tr; EBT00001671550.
DR   EnsemblGenomes-Tr; EBT00001671551.
DR   EnsemblGenomes-Tr; EBT00001671552.
DR   EnsemblGenomes-Tr; EBT00001671553.
DR   EnsemblGenomes-Tr; EBT00001671554.
DR   EnsemblGenomes-Tr; EBT00001671555.
DR   EnsemblGenomes-Tr; EBT00001671556.
DR   EnsemblGenomes-Tr; EBT00001671557.
DR   EnsemblGenomes-Tr; EBT00001671558.
DR   EnsemblGenomes-Tr; EBT00001671559.
DR   EnsemblGenomes-Tr; EBT00001671560.
DR   EnsemblGenomes-Tr; EBT00001671561.
DR   EnsemblGenomes-Tr; EBT00001671562.
DR   EnsemblGenomes-Tr; EBT00001671563.
DR   EnsemblGenomes-Tr; EBT00001671564.
DR   EnsemblGenomes-Tr; EBT00001671565.
DR   EnsemblGenomes-Tr; EBT00001671566.
DR   EnsemblGenomes-Tr; EBT00001671567.
DR   EnsemblGenomes-Tr; EBT00001671568.
DR   EnsemblGenomes-Tr; EBT00001671569.
DR   EnsemblGenomes-Tr; EBT00001671570.
DR   EnsemblGenomes-Tr; EBT00001671571.
DR   EnsemblGenomes-Tr; EBT00001671572.
DR   EnsemblGenomes-Tr; EBT00001671573.
DR   EnsemblGenomes-Tr; EBT00001671574.
DR   EnsemblGenomes-Tr; EBT00001671575.
DR   EnsemblGenomes-Tr; EBT00001671576.
DR   EnsemblGenomes-Tr; EBT00001671577.
DR   EnsemblGenomes-Tr; EBT00001671578.
DR   EnsemblGenomes-Tr; EBT00001671579.
DR   EnsemblGenomes-Tr; EBT00001671580.
DR   EnsemblGenomes-Tr; EBT00001671581.
DR   EnsemblGenomes-Tr; EBT00001671582.
DR   EnsemblGenomes-Tr; EBT00001671583.
DR   EnsemblGenomes-Tr; EBT00001671584.
DR   EnsemblGenomes-Tr; EBT00001671585.
DR   EnsemblGenomes-Tr; EBT00001671586.
DR   EnsemblGenomes-Tr; EBT00001671587.
DR   EnsemblGenomes-Tr; EBT00001671588.
DR   EnsemblGenomes-Tr; EBT00001671589.
DR   EnsemblGenomes-Tr; EBT00001671590.
DR   EnsemblGenomes-Tr; EBT00001671591.
DR   EnsemblGenomes-Tr; EBT00001671592.
DR   EnsemblGenomes-Tr; EBT00001671593.
DR   EnsemblGenomes-Tr; EBT00001671594.
DR   EnsemblGenomes-Tr; EBT00001671595.
DR   EnsemblGenomes-Tr; EBT00001671596.
DR   EnsemblGenomes-Tr; EBT00001671597.
DR   EnsemblGenomes-Tr; EBT00001671598.
DR   EnsemblGenomes-Tr; EBT00001671599.
DR   EnsemblGenomes-Tr; EBT00001671600.
DR   EnsemblGenomes-Tr; EBT00001671601.
DR   EnsemblGenomes-Tr; EBT00001671602.
DR   EnsemblGenomes-Tr; EBT00001671603.
DR   EnsemblGenomes-Tr; EBT00001671604.
DR   EnsemblGenomes-Tr; EBT00001671605.
DR   EnsemblGenomes-Tr; EBT00001671606.
DR   EnsemblGenomes-Tr; EBT00001671607.
DR   EnsemblGenomes-Tr; EBT00001671608.
DR   EnsemblGenomes-Tr; EBT00001671609.
DR   EnsemblGenomes-Tr; EBT00001671610.
DR   EnsemblGenomes-Tr; EBT00001671611.
DR   EnsemblGenomes-Tr; EBT00001671612.
DR   EnsemblGenomes-Tr; EBT00001671613.
DR   EnsemblGenomes-Tr; EBT00001671614.
DR   EnsemblGenomes-Tr; EBT00001671615.
DR   EnsemblGenomes-Tr; EBT00001671616.
DR   EnsemblGenomes-Tr; EBT00001671617.
DR   EnsemblGenomes-Tr; EBT00001671618.
DR   EnsemblGenomes-Tr; EBT00001671619.
DR   EnsemblGenomes-Tr; EBT00001671620.
DR   EnsemblGenomes-Tr; EBT00001671621.
DR   EnsemblGenomes-Tr; EBT00001671622.
DR   EnsemblGenomes-Tr; EBT00001671623.
DR   EnsemblGenomes-Tr; EBT00001671624.
DR   EnsemblGenomes-Tr; EBT00001671625.
DR   EnsemblGenomes-Tr; EBT00001671626.
DR   EnsemblGenomes-Tr; EBT00001671627.
DR   EnsemblGenomes-Tr; EBT00001671628.
DR   EnsemblGenomes-Tr; EBT00001671629.
DR   EnsemblGenomes-Tr; EBT00001671630.
DR   EnsemblGenomes-Tr; EBT00001671631.
DR   EnsemblGenomes-Tr; EBT00001671632.
DR   EnsemblGenomes-Tr; EBT00001671633.
DR   EnsemblGenomes-Tr; EBT00001671634.
DR   EnsemblGenomes-Tr; EBT00001671635.
DR   EnsemblGenomes-Tr; EBT00001671636.
DR   EnsemblGenomes-Tr; EBT00001671637.
DR   EnsemblGenomes-Tr; EBT00001671638.
DR   EnsemblGenomes-Tr; EBT00001671639.
DR   EnsemblGenomes-Tr; EBT00001671640.
DR   EnsemblGenomes-Tr; EBT00001671641.
DR   EnsemblGenomes-Tr; EBT00001671642.
DR   EnsemblGenomes-Tr; EBT00001671643.
DR   EnsemblGenomes-Tr; EBT00001671644.
DR   EnsemblGenomes-Tr; EBT00001671645.
DR   EnsemblGenomes-Tr; EBT00001671646.
DR   EnsemblGenomes-Tr; EBT00001671647.
DR   EnsemblGenomes-Tr; EBT00001671648.
DR   EnsemblGenomes-Tr; EBT00001671649.
DR   EnsemblGenomes-Tr; EBT00001671650.
DR   EnsemblGenomes-Tr; EBT00001671651.
DR   EnsemblGenomes-Tr; EBT00001671652.
DR   EnsemblGenomes-Tr; EBT00001671653.
DR   EnsemblGenomes-Tr; EBT00001671654.
DR   EnsemblGenomes-Tr; EBT00001671655.
DR   EnsemblGenomes-Tr; EBT00001671656.
DR   EnsemblGenomes-Tr; EBT00001671657.
DR   EnsemblGenomes-Tr; EBT00001671658.
DR   EnsemblGenomes-Tr; EBT00001671659.
DR   EnsemblGenomes-Tr; EBT00001671660.
DR   EnsemblGenomes-Tr; EBT00001671661.
DR   EnsemblGenomes-Tr; EBT00001671662.
DR   EnsemblGenomes-Tr; EBT00001671663.
DR   EnsemblGenomes-Tr; EBT00001671664.
DR   EnsemblGenomes-Tr; EBT00001671665.
DR   EnsemblGenomes-Tr; EBT00001671666.
DR   EnsemblGenomes-Tr; EBT00001671667.
DR   EnsemblGenomes-Tr; EBT00001671668.
DR   EnsemblGenomes-Tr; EBT00001671669.
DR   EnsemblGenomes-Tr; EBT00001671670.
DR   EnsemblGenomes-Tr; EBT00001671671.
DR   EnsemblGenomes-Tr; EBT00001671672.
DR   EnsemblGenomes-Tr; EBT00001671673.
DR   EnsemblGenomes-Tr; EBT00001671674.
DR   EnsemblGenomes-Tr; EBT00001671675.
DR   EnsemblGenomes-Tr; EBT00001671676.
DR   EnsemblGenomes-Tr; EBT00001671677.
DR   EnsemblGenomes-Tr; EBT00001671678.
DR   EnsemblGenomes-Tr; EBT00001671679.
DR   EnsemblGenomes-Tr; EBT00001671680.
DR   EnsemblGenomes-Tr; EBT00001671681.
DR   EnsemblGenomes-Tr; EBT00001671682.
DR   EnsemblGenomes-Tr; EBT00001671683.
DR   EnsemblGenomes-Tr; EBT00001671684.
DR   EnsemblGenomes-Tr; EBT00001671685.
DR   EnsemblGenomes-Tr; EBT00001671686.
DR   EnsemblGenomes-Tr; EBT00001671687.
DR   EnsemblGenomes-Tr; EBT00001671688.
DR   EnsemblGenomes-Tr; EBT00001671689.
DR   EnsemblGenomes-Tr; EBT00001671690.
DR   EnsemblGenomes-Tr; EBT00001671691.
DR   EnsemblGenomes-Tr; EBT00001671692.
DR   EnsemblGenomes-Tr; EBT00001671693.
DR   EnsemblGenomes-Tr; EBT00001671694.
DR   EnsemblGenomes-Tr; EBT00001671695.
DR   EnsemblGenomes-Tr; EBT00001671696.
DR   EnsemblGenomes-Tr; EBT00001671697.
DR   EnsemblGenomes-Tr; EBT00001671698.
DR   EnsemblGenomes-Tr; EBT00001671699.
DR   EnsemblGenomes-Tr; EBT00001671700.
DR   EnsemblGenomes-Tr; EBT00001671701.
DR   EnsemblGenomes-Tr; EBT00001671702.
DR   EnsemblGenomes-Tr; EBT00001671703.
DR   EnsemblGenomes-Tr; EBT00001671704.
DR   EnsemblGenomes-Tr; EBT00001671705.
DR   EnsemblGenomes-Tr; EBT00001671706.
DR   EnsemblGenomes-Tr; EBT00001671707.
DR   EnsemblGenomes-Tr; EBT00001671708.
DR   EnsemblGenomes-Tr; EBT00001671709.
DR   EnsemblGenomes-Tr; EBT00001671710.
DR   EnsemblGenomes-Tr; EBT00001671711.
DR   EnsemblGenomes-Tr; EBT00001671712.
DR   EnsemblGenomes-Tr; EBT00001671713.
DR   EnsemblGenomes-Tr; EBT00001671714.
DR   EnsemblGenomes-Tr; EBT00001671715.
DR   EnsemblGenomes-Tr; EBT00001671716.
DR   EnsemblGenomes-Tr; EBT00001671717.
DR   EnsemblGenomes-Tr; EBT00001671718.
DR   EnsemblGenomes-Tr; EBT00001671719.
DR   EnsemblGenomes-Tr; EBT00001671720.
DR   EnsemblGenomes-Tr; EBT00001671721.
DR   EnsemblGenomes-Tr; EBT00001671722.
DR   EnsemblGenomes-Tr; EBT00001671723.
DR   EnsemblGenomes-Tr; EBT00001671724.
DR   EnsemblGenomes-Tr; EBT00001671725.
DR   EnsemblGenomes-Tr; EBT00001671726.
DR   EnsemblGenomes-Tr; EBT00001671727.
DR   EnsemblGenomes-Tr; EBT00001671728.
DR   EnsemblGenomes-Tr; EBT00001671729.
DR   EnsemblGenomes-Tr; EBT00001671730.
DR   EnsemblGenomes-Tr; EBT00001671731.
DR   EnsemblGenomes-Tr; EBT00001671732.
DR   EnsemblGenomes-Tr; EBT00001671733.
DR   EnsemblGenomes-Tr; EBT00001671734.
DR   EnsemblGenomes-Tr; EBT00001671735.
DR   EnsemblGenomes-Tr; EBT00001671736.
DR   EnsemblGenomes-Tr; EBT00001671737.
DR   EnsemblGenomes-Tr; EBT00001671738.
DR   EnsemblGenomes-Tr; EBT00001671739.
DR   EnsemblGenomes-Tr; EBT00001671740.
DR   EnsemblGenomes-Tr; EBT00001671741.
DR   EnsemblGenomes-Tr; EBT00001671742.
DR   EnsemblGenomes-Tr; EBT00001671743.
DR   EnsemblGenomes-Tr; EBT00001671744.
DR   EnsemblGenomes-Tr; EBT00001671745.
DR   EnsemblGenomes-Tr; EBT00001671746.
DR   EnsemblGenomes-Tr; EBT00001671747.
DR   EnsemblGenomes-Tr; EBT00001671748.
DR   EnsemblGenomes-Tr; EBT00001671749.
DR   EnsemblGenomes-Tr; EBT00001671750.
DR   EnsemblGenomes-Tr; EBT00001671751.
DR   EnsemblGenomes-Tr; EBT00001671752.
DR   EnsemblGenomes-Tr; EBT00001671753.
DR   EnsemblGenomes-Tr; EBT00001671754.
DR   EnsemblGenomes-Tr; EBT00001671755.
DR   EnsemblGenomes-Tr; EBT00001671756.
DR   EnsemblGenomes-Tr; EBT00001671757.
DR   EnsemblGenomes-Tr; EBT00001671758.
DR   EnsemblGenomes-Tr; EBT00001671759.
DR   EnsemblGenomes-Tr; EBT00001671760.
DR   EnsemblGenomes-Tr; EBT00001671761.
DR   EnsemblGenomes-Tr; EBT00001671762.
DR   EnsemblGenomes-Tr; EBT00001671763.
DR   EnsemblGenomes-Tr; EBT00001671764.
DR   EnsemblGenomes-Tr; EBT00001671765.
DR   EnsemblGenomes-Tr; EBT00001671766.
DR   EnsemblGenomes-Tr; EBT00001671767.
DR   EnsemblGenomes-Tr; EBT00001671768.
DR   EnsemblGenomes-Tr; EBT00001671769.
DR   EnsemblGenomes-Tr; EBT00001671770.
DR   EnsemblGenomes-Tr; EBT00001671771.
DR   EnsemblGenomes-Tr; EBT00001671772.
DR   EnsemblGenomes-Tr; EBT00001671773.
DR   EnsemblGenomes-Tr; EBT00001671774.
DR   EnsemblGenomes-Tr; EBT00001671775.
DR   EnsemblGenomes-Tr; EBT00001671776.
DR   EnsemblGenomes-Tr; EBT00001671777.
DR   EnsemblGenomes-Tr; EBT00001671778.
DR   EnsemblGenomes-Tr; EBT00001671779.
DR   EnsemblGenomes-Tr; EBT00001671780.
DR   EnsemblGenomes-Tr; EBT00001671781.
DR   EnsemblGenomes-Tr; EBT00001671782.
DR   EnsemblGenomes-Tr; EBT00001671783.
DR   EnsemblGenomes-Tr; EBT00001671784.
DR   EnsemblGenomes-Tr; EBT00001671785.
DR   EnsemblGenomes-Tr; EBT00001671786.
DR   EnsemblGenomes-Tr; EBT00001671787.
DR   EnsemblGenomes-Tr; EBT00001671788.
DR   EnsemblGenomes-Tr; EBT00001671789.
DR   EnsemblGenomes-Tr; EBT00001671790.
DR   EnsemblGenomes-Tr; EBT00001671791.
DR   EnsemblGenomes-Tr; EBT00001671792.
DR   EnsemblGenomes-Tr; EBT00001671793.
DR   EnsemblGenomes-Tr; EBT00001671794.
DR   EnsemblGenomes-Tr; EBT00001671795.
DR   EnsemblGenomes-Tr; EBT00001671796.
DR   EnsemblGenomes-Tr; EBT00001671797.
DR   EnsemblGenomes-Tr; EBT00001671798.
DR   EnsemblGenomes-Tr; EBT00001671799.
DR   EnsemblGenomes-Tr; EBT00001671800.
DR   EnsemblGenomes-Tr; EBT00001671801.
DR   EnsemblGenomes-Tr; EBT00001671802.
DR   EnsemblGenomes-Tr; EBT00001671803.
DR   EnsemblGenomes-Tr; EBT00001671804.
DR   EnsemblGenomes-Tr; EBT00001671805.
DR   EnsemblGenomes-Tr; EBT00001671806.
DR   EnsemblGenomes-Tr; EBT00001671807.
DR   EnsemblGenomes-Tr; EBT00001671808.
DR   EnsemblGenomes-Tr; EBT00001671809.
DR   EnsemblGenomes-Tr; EBT00001671810.
DR   EnsemblGenomes-Tr; EBT00001671811.
DR   EnsemblGenomes-Tr; EBT00001671812.
DR   EnsemblGenomes-Tr; EBT00001671813.
DR   EnsemblGenomes-Tr; EBT00001671814.
DR   EnsemblGenomes-Tr; EBT00001671815.
DR   EnsemblGenomes-Tr; EBT00001671816.
DR   EnsemblGenomes-Tr; EBT00001671817.
DR   EnsemblGenomes-Tr; EBT00001671818.
DR   EnsemblGenomes-Tr; EBT00001671819.
DR   EnsemblGenomes-Tr; EBT00001671820.
DR   EnsemblGenomes-Tr; EBT00001671821.
DR   EnsemblGenomes-Tr; EBT00001671822.
DR   EnsemblGenomes-Tr; EBT00001671823.
DR   EnsemblGenomes-Tr; EBT00001671824.
DR   EnsemblGenomes-Tr; EBT00001671825.
DR   EnsemblGenomes-Tr; EBT00001671826.
DR   EnsemblGenomes-Tr; EBT00001671827.
DR   EnsemblGenomes-Tr; EBT00001671828.
DR   EnsemblGenomes-Tr; EBT00001671829.
DR   EnsemblGenomes-Tr; EBT00001671830.
DR   EnsemblGenomes-Tr; EBT00001671831.
DR   EnsemblGenomes-Tr; EBT00001671832.
DR   EnsemblGenomes-Tr; EBT00001671833.
DR   EnsemblGenomes-Tr; EBT00001671834.
DR   EnsemblGenomes-Tr; EBT00001671835.
DR   EnsemblGenomes-Tr; EBT00001671836.
DR   EnsemblGenomes-Tr; EBT00001671837.
DR   EnsemblGenomes-Tr; EBT00001671838.
DR   EnsemblGenomes-Tr; EBT00001671839.
DR   EnsemblGenomes-Tr; EBT00001671840.
DR   EnsemblGenomes-Tr; EBT00001671841.
DR   EnsemblGenomes-Tr; EBT00001671842.
DR   EnsemblGenomes-Tr; EBT00001671843.
DR   EnsemblGenomes-Tr; EBT00001671844.
DR   EnsemblGenomes-Tr; EBT00001671845.
DR   EnsemblGenomes-Tr; EBT00001671846.
DR   EnsemblGenomes-Tr; EBT00001671847.
DR   EnsemblGenomes-Tr; EBT00001671848.
DR   EnsemblGenomes-Tr; EBT00001671849.
DR   EnsemblGenomes-Tr; EBT00001671850.
DR   EnsemblGenomes-Tr; EBT00001671851.
DR   EnsemblGenomes-Tr; EBT00001671852.
DR   EnsemblGenomes-Tr; EBT00001671853.
DR   EnsemblGenomes-Tr; EBT00001671854.
DR   EnsemblGenomes-Tr; EBT00001671855.
DR   EnsemblGenomes-Tr; EBT00001671856.
DR   EnsemblGenomes-Tr; EBT00001671857.
DR   EnsemblGenomes-Tr; EBT00001671858.
DR   EnsemblGenomes-Tr; EBT00001671859.
DR   EnsemblGenomes-Tr; EBT00001671860.
DR   EnsemblGenomes-Tr; EBT00001671861.
DR   EnsemblGenomes-Tr; EBT00001671862.
DR   EnsemblGenomes-Tr; EBT00001671863.
DR   EnsemblGenomes-Tr; EBT00001671864.
DR   EnsemblGenomes-Tr; EBT00001671865.
DR   EnsemblGenomes-Tr; EBT00001671866.
DR   EnsemblGenomes-Tr; EBT00001671867.
DR   EnsemblGenomes-Tr; EBT00001671868.
DR   EnsemblGenomes-Tr; EBT00001671869.
DR   EnsemblGenomes-Tr; EBT00001671870.
DR   EnsemblGenomes-Tr; EBT00001671871.
DR   EnsemblGenomes-Tr; EBT00001671872.
DR   EnsemblGenomes-Tr; EBT00001671873.
DR   EnsemblGenomes-Tr; EBT00001671874.
DR   EnsemblGenomes-Tr; EBT00001671875.
DR   EnsemblGenomes-Tr; TTEr01-1.
DR   EnsemblGenomes-Tr; TTEr02-1.
DR   EnsemblGenomes-Tr; TTEr03-1.
DR   EnsemblGenomes-Tr; TTEr04-1.
DR   EnsemblGenomes-Tr; TTEr05-1.
DR   EnsemblGenomes-Tr; TTEr06-1.
DR   EnsemblGenomes-Tr; TTEr07-1.
DR   EnsemblGenomes-Tr; TTEr08-1.
DR   EnsemblGenomes-Tr; TTEr09-1.
DR   EnsemblGenomes-Tr; TTEr10-1.
DR   EnsemblGenomes-Tr; TTEr11-1.
DR   EnsemblGenomes-Tr; TTEr12-1.
DR   EnsemblGenomes-Tr; TTEt01-1.
DR   EnsemblGenomes-Tr; TTEt02-1.
DR   EnsemblGenomes-Tr; TTEt03-1.
DR   EnsemblGenomes-Tr; TTEt04-1.
DR   EnsemblGenomes-Tr; TTEt05-1.
DR   EnsemblGenomes-Tr; TTEt06-1.
DR   EnsemblGenomes-Tr; TTEt07-1.
DR   EnsemblGenomes-Tr; TTEt08-1.
DR   EnsemblGenomes-Tr; TTEt09-1.
DR   EnsemblGenomes-Tr; TTEt10-1.
DR   EnsemblGenomes-Tr; TTEt11-1.
DR   EnsemblGenomes-Tr; TTEt12-1.
DR   EnsemblGenomes-Tr; TTEt13-1.
DR   EnsemblGenomes-Tr; TTEt14-1.
DR   EnsemblGenomes-Tr; TTEt15-1.
DR   EnsemblGenomes-Tr; TTEt16-1.
DR   EnsemblGenomes-Tr; TTEt17-1.
DR   EnsemblGenomes-Tr; TTEt18-1.
DR   EnsemblGenomes-Tr; TTEt19-1.
DR   EnsemblGenomes-Tr; TTEt20-1.
DR   EnsemblGenomes-Tr; TTEt21-1.
DR   EnsemblGenomes-Tr; TTEt22-1.
DR   EnsemblGenomes-Tr; TTEt23-1.
DR   EnsemblGenomes-Tr; TTEt24-1.
DR   EnsemblGenomes-Tr; TTEt25-1.
DR   EnsemblGenomes-Tr; TTEt26-1.
DR   EnsemblGenomes-Tr; TTEt27-1.
DR   EnsemblGenomes-Tr; TTEt28-1.
DR   EnsemblGenomes-Tr; TTEt29-1.
DR   EnsemblGenomes-Tr; TTEt30-1.
DR   EnsemblGenomes-Tr; TTEt31-1.
DR   EnsemblGenomes-Tr; TTEt32-1.
DR   EnsemblGenomes-Tr; TTEt33-1.
DR   EnsemblGenomes-Tr; TTEt34-1.
DR   EnsemblGenomes-Tr; TTEt35-1.
DR   EnsemblGenomes-Tr; TTEt36-1.
DR   EnsemblGenomes-Tr; TTEt37-1.
DR   EnsemblGenomes-Tr; TTEt38-1.
DR   EnsemblGenomes-Tr; TTEt39-1.
DR   EnsemblGenomes-Tr; TTEt40-1.
DR   EnsemblGenomes-Tr; TTEt41-1.
DR   EnsemblGenomes-Tr; TTEt42-1.
DR   EnsemblGenomes-Tr; TTEt43-1.
DR   EnsemblGenomes-Tr; TTEt44-1.
DR   EnsemblGenomes-Tr; TTEt45-1.
DR   EnsemblGenomes-Tr; TTEt46-1.
DR   EnsemblGenomes-Tr; TTEt47-1.
DR   EnsemblGenomes-Tr; TTEt48-1.
DR   EnsemblGenomes-Tr; TTEt49-1.
DR   EnsemblGenomes-Tr; TTEt50-1.
DR   EnsemblGenomes-Tr; TTEt51-1.
DR   EnsemblGenomes-Tr; TTEt52-1.
DR   EnsemblGenomes-Tr; TTEt53-1.
DR   EnsemblGenomes-Tr; TTEt54-1.
DR   EnsemblGenomes-Tr; TTEt55-1.
DR   EuropePMC; PMC1479100; 16723588.
DR   EuropePMC; PMC186588; 11997336.
DR   EuropePMC; PMC1952373; 16508100.
DR   EuropePMC; PMC1952406; 16508105.
DR   EuropePMC; PMC2757599; 19579003.
DR   EuropePMC; PMC3209010; 21948836.
DR   EuropePMC; PMC3518761; 23064232.
DR   EuropePMC; PMC3608648; 23555660.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC549560; 15698474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; AE008691.
DR   SILVA-SSU; AE008691.
DR   StrainInfo; 304063; 1.
XX
CC   On or before Feb 27, 2009 this sequence version replaced
CC   gi:20514979, gi:20514989, gi:20514994, gi:20515004, gi:20515009,
CC   gi:20515017, gi:20515026, gi:20515039, gi:20515054, gi:20515057,
CC   gi:20515077, gi:20515088, gi:20515100, gi:20515113, gi:20515123,
CC   gi:20515134, gi:20515143, gi:20515149, gi:20515165, gi:20515177,
CC   gi:20515191, gi:20515202, gi:20515211, gi:20515222, gi:20515237,
CC   gi:20515245, gi:20515252, gi:20515264, gi:20515275, gi:20515285,
CC   gi:20515297, gi:20515308, gi:20515317, gi:20515329, gi:20515337,
CC   gi:20515344, gi:20515352, gi:20515357, gi:20515372, gi:20515385,
CC   gi:20515397, gi:20515412, gi:20515431, gi:20515442, gi:20515453,
CC   gi:20515464, gi:20515474, gi:20515487, gi:20515497, gi:20515509,
CC   gi:20515521, gi:20515536, gi:20515549, gi:20515562, gi:20515575,
CC   gi:20515589, gi:20515597, gi:20515609, gi:20515618, gi:20515632,
CC   gi:20515643, gi:20515651, gi:20515660, gi:20515672, gi:20515682,
CC   gi:20515691, gi:20515707, gi:20515719, gi:20515733, gi:20515745,
CC   gi:20515756, gi:20515767, gi:20515778, gi:20515794, gi:20515807,
CC   gi:20515814, gi:20515828, gi:20515837, gi:20515847, gi:20515856,
CC   gi:20515867, gi:20515877, gi:20515889, gi:20515902, gi:20515923,
CC   gi:20515934, gi:20515947, gi:20515957, gi:20515972, gi:20515984,
CC   gi:20515994, gi:20516007, gi:20516020, gi:20516031, gi:20516040,
CC   gi:20516050, gi:20516062, gi:20516074, gi:20516085, gi:20516092,
CC   gi:20516104, gi:20516114, gi:20516124, gi:20516138, gi:20516144,
CC   gi:20516155, gi:20516169, gi:20516185, gi:20516190, gi:20516202,
CC   gi:20516213, gi:20516227, gi:20516234, gi:20516246, gi:20516252,
CC   gi:20516266, gi:20516283, gi:20516299, gi:20516313, gi:20516326,
CC   gi:20516342, gi:20516358, gi:20516370, gi:20516380, gi:20516390,
CC   gi:20516397, gi:20516407, gi:20516418, gi:20516444, gi:20516458,
CC   gi:20516464, gi:20516482, gi:20516495, gi:20516507, gi:20516522,
CC   gi:20516533, gi:20516545, gi:20516552, gi:20516559, gi:20516572,
CC   gi:20516589, gi:20516601, gi:20516616, gi:20516623, gi:20516638,
CC   gi:20516647, gi:20516659, gi:20516672, gi:20516686, gi:20516694,
CC   gi:20516702, gi:20516719, gi:20516728, gi:20516743, gi:20516754,
CC   gi:20516763, gi:20516775, gi:20516789, gi:20516802, gi:20516817,
CC   gi:20516827, gi:20516838, gi:20516851, gi:20516864, gi:20516877,
CC   gi:20516887, gi:20516896, gi:20516913, gi:20516925, gi:20516933,
CC   gi:20516941, gi:20516950, gi:20516958, gi:20516970, gi:20516979,
CC   gi:20516987, gi:20516999, gi:20517014, gi:20517022, gi:20517032,
CC   gi:20517055, gi:20517073, gi:20517090, gi:20517106, gi:20517119,
CC   gi:20517131, gi:20517144, gi:20517159, gi:20517163, gi:20517166,
CC   gi:20517178, gi:20517198, gi:20517210, gi:20517224, gi:20517241,
CC   gi:20517254, gi:20517257, gi:20517266, gi:20517296, gi:20517304,
CC   gi:20517319, gi:20517330, gi:20517339, gi:20517350, gi:20517357,
CC   gi:20517367, gi:20517380, gi:20517393, gi:20517405, gi:20517415,
CC   gi:20517421, gi:20517433, gi:20517445, gi:20517456, gi:20517467,
CC   gi:20517481, gi:20517494, gi:20517503, gi:20517517, gi:20517524,
CC   gi:20517532, gi:20517543, gi:20517555, gi:20517568, gi:20517578,
CC   gi:20517590, gi:20517606, gi:20517615, gi:20517625, gi:20517636,
CC   gi:20517642, gi:20517654, gi:20517666, gi:20517680, gi:20517694,
CC   gi:20517707, gi:20517720, gi:20517728, gi:20517739, gi:20517751,
CC   gi:20517763, gi:20517777, gi:20517791, gi:20517802.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2689445
FT                   /organism="Caldanaerobacter subterraneus subsp.
FT                   tengcongensis MB4"
FT                   /strain="MB4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:273068"
FT   gene            352..1696
FT                   /gene="DnaA"
FT                   /locus_tag="TTE0001"
FT   regulatory      352..356
FT                   /gene="DnaA"
FT                   /locus_tag="TTE0001"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        365..1696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaA"
FT                   /locus_tag="TTE0001"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /note="Best Blastp hit = gi|118704|sp|P05648|DNAA_BACSU
FT                   CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
FT                   gi|279705|pir||IQBSOC replication initiation protein dnaA -
FT                   Bacillus subtilis gi|40014|emb|CAA26217.1| (X02369) pot.
FT                   ORF 446 (aa 1-446) [Bacillus subtilis]
FT                   gi|467391|dbj|BAA05237.1| (D26185) initiation protein of
FT                   replicaton [Bacillus subtilis] gi|2632268|emb|CAB11777.1|
FT                   '(Z99104) alternate gene name: dnaH, dnaJ, dnaK [Bacillus
FT                   subtilis]', score 484, E-value 1.00E-135"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23318"
FT                   /db_xref="GOA:Q8RDL6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDL6"
FT                   /protein_id="AAM23318.1"
FT                   /translation="MYGDYRQIWERIVEVIKSELTPTSYNTWLVHIKPLAFAEDTLFLS
FT                   TPNTFTKNIINGRYINIIYDAASKVTNRFIEIKILSEDEEEYREIKESIERENSSESTL
FT                   LSTLNPKYTFDTFVVGNSNKLAHAACLAVAQSPAKAYNPLFIYGGVGLGKTHLMHAIGH
FT                   FINKNHAGYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIANKERT
FT                   QEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRVAI
FT                   LKKKAQSENLNIPDEVLAYVAEKIQSNIRELEGALIRIVAFATLTKSNIDLELTKHALK
FT                   DIVSNKTREITVKLIQEEVCKYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLP
FT                   KIGEEFGKDHTTVIHAYEKISNEIKQDESLARQIEELKKRIKGY"
FT   misc_feature    686..1621
FT                   /gene="DnaA"
FT                   /locus_tag="TTE0001"
FT                   /note="Pfam match to entry bac_dnaA, Bacterial dnaA
FT                   protein, score 681.2, E-value 2.50E-229"
FT   regulatory      1697..1726
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            1921..3046
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT   regulatory      1921..1925
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1934..3046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT                   /product="DNA polymerase III beta subunit"
FT                   /note="Best Blastp hit = gi|1706496|sp|P50029|DP3B_STAAU
FT                   'DNA POLYMERASE III, BETA CHAIN' gi|1084187|pir||S54708
FT                   DNA-directed DNA polymerase (EC 2.7.7.7) III beta chain -
FT                   Staphylococcus aureus gi|13699919|dbj|BAB41218.1|
FT                   '(AP003129) DNA polymerase III, beta chain [Staphylococcus
FT                   aureus]' gi|13873342|dbj|BAB44159.1| (AP003358) DNA
FT                   polymerase III [Staphylococcus aureus], score 255, E-value
FT                   7.00E-67"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23319"
FT                   /db_xref="GOA:Q8RDL5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL5"
FT                   /protein_id="AAM23319.1"
FT                   /translation="MKFVCDKNSLLEGVNIAIRGVSSRTTLPILQGIKITARGNVIKLS
FT                   GTDLEIGIECQIPAVIEEEGETVVPARIFSDLVKKLPEGEVEVKSDSQNTVNVVSGDIN
FT                   FSIAGSNPEEFPEIPEVSREKSFKLPQSILKDLIKKTVFCVSEEQTRPILTGVLFEVFP
FT                   NELKAVALDGFRMAIYSYKSEKSFFDEEAEKYSLVIPGDTIDEISRILEDEETEVIIYH
FT                   TSNQVLFQIDNTKVISRLLEGSFINYNAVLPKDFKTEITINKDVFMESLERASLIAESK
FT                   NNLVKFEIGDSFIVISSSSEKGSMSEKLEVEVKGMLLEIAFNSRYLLDALKAINEEEVN
FT                   LYFINSINPLIIKPVGEKEYLYMILPVKLN"
FT   misc_feature    1934..2290
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT                   /note="Pfam match to entry DNA_pol3_beta, DNA polymerase
FT                   III beta subunit, N-terminal domain, score 118.6, E-value
FT                   1.10E-31"
FT   misc_feature    2315..2674
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT                   /note="Pfam match to entry DNA_pol3_beta_2, DNA polymerase
FT                   III beta subunit, central domain, score 102.7, E-value
FT                   1.20E-30"
FT   misc_feature    2678..3037
FT                   /gene="DnaN"
FT                   /locus_tag="TTE0002"
FT                   /note="Pfam match to entry DNA_pol3_beta_3, DNA polymerase
FT                   III beta subunit, C-terminal domain, score 114.3, E-value
FT                   2.30E-30"
FT   gene            3048..3266
FT                   /locus_tag="TTE0003"
FT   regulatory      3048..3052
FT                   /locus_tag="TTE0003"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3060..3266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|140603|sp|P05650|YAAA_BACSU
FT                   HYPOTHETICAL 7.9 KD PROTEIN IN DNAN-RECF INTERGENIC REGION
FT                   gi|80349|pir||C22930 conserved hypothetical protein yaaA -
FT                   Bacillus subtilis gi|40016|emb|CAA26219.1| (X02369) ORF 71
FT                   (aa 1-71) [Bacillus subtilis] gi|467393|dbj|BAA05239.1|
FT                   (D26185) unknown [Bacillus subtilis]
FT                   gi|2632270|emb|CAB11779.1| (Z99104) similar to hypothetical
FT                   proteins [Bacillus subtilis], score 65.5, E-value 9.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23320"
FT                   /db_xref="GOA:Q8RDL4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL4"
FT                   /protein_id="AAM23320.1"
FT                   /translation="MIEIPIKTEYITLGQFLKYAKVCDTGGQAKRFIQEGKVKVNGVIE
FT                   LKRGRKLYKNDIIEVEGKTFVIK"
FT   gene            3266..4371
FT                   /gene="RecF"
FT                   /locus_tag="TTE0004"
FT   regulatory      3266..3270
FT                   /gene="RecF"
FT                   /locus_tag="TTE0004"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3277..4371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecF"
FT                   /locus_tag="TTE0004"
FT                   /product="Recombinational DNA repair ATPase"
FT                   /note="Best Blastp hit = gi|1710070|sp|P49999|RECF_STRPY
FT                   DNA REPLICATION AND REPAIR PROTEIN RECF
FT                   gi|1075773|pir||JC4077 recF protein - Streptococcus
FT                   pyogenes gi|533080|gb|AAA85783.1| (U07342) RecF protein
FT                   [Streptococcus pyogenes], score 168, E-value 9.00E-41"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23321"
FT                   /db_xref="GOA:Q8RDL3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="PDB:5Z67"
FT                   /db_xref="PDB:5Z68"
FT                   /db_xref="PDB:5Z69"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDL3"
FT                   /protein_id="AAM23321.1"
FT                   /translation="MYLKEIFVDNFRNLKKQKLEFCEGVNLIYGLNAQGKSNLLEAIRL
FT                   LSMGRSFRGSKMSELVKFDEEYFYVRGLVRSADFYEKKIEFGYKVNGNKVIKVNGNKLK
FT                   STGEILGHFLTVIFSPEDIEIIKEGPSRRRKYLDACISVIDKNYFFDLLQYNKTLSNRN
FT                   SLLKKIKEEGKGEDLLEIFDEKLAEYGARIIKVRNNYLEKLKNSMSKFLMEISNEKLEI
FT                   IYLNSAGVKEVHEENLIREKLKNRLTKSLTLDLKYLSTQVGPHREDFKILINGYDSRVY
FT                   SSQGQKRTAALCLKLSELEILEEETGEKPVLLLDDVMSELDDNRKKYILKKLEGFQSFI
FT                   THTSKSDVEGDCCFKIYDGIVMRE"
FT   misc_feature    3283..3510
FT                   /gene="RecF"
FT                   /locus_tag="TTE0004"
FT                   /note="Pfam match to entry RecF, RecF protein, score 50.9,
FT                   E-value 3.30E-13"
FT   gene            4370..4641
FT                   /locus_tag="TTE0005"
FT   regulatory      4370..4374
FT                   /locus_tag="TTE0005"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4384..4641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|11356527|pir||T46554
FT                   hypothetical protein X [imported] - Clostridium
FT                   acetobutylicum gi|1790874|gb|AAB41129.1| (U35453) OrfX
FT                   [Clostridium acetobutylicum], score 94, E-value 3.00E-19"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23322"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL2"
FT                   /protein_id="AAM23322.1"
FT                   /translation="MYIHLGGDVVVPDKEIIGIFDMNIVSTSSITLQFLKIAEEEGFVV
FT                   NISKEKPKSFILTERDKKSIIYLSPISAVTLIKRAHKIFE"
FT   gene            4641..6908
FT                   /locus_tag="TTE0006"
FT   regulatory      4641..4645
FT                   /locus_tag="TTE0006"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4653..6908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0006"
FT                   /product="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /note="Best Blastp hit = gi|4586418|dbj|BAA76396.1|
FT                   (AB012238) alpha-glucosidase [Bacillus
FT                   thermoamyloliquefaciens], score 660, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23323"
FT                   /db_xref="GOA:Q8RDL1"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL1"
FT                   /protein_id="AAM23323.1"
FT                   /translation="MLQRTVEGIVVRSEGKKLELRVITDKIVNIFVTDKEEKRRDTIAI
FT                   EKKKYDIPDFNVEESKDKVLVLTKDLKVEIDKKTFFITFKDKDGDVINEDYGEGVKLGD
FT                   SEVRCYKKLREDHFYGFGEKAGYLDKKGEKFEMWNTDEFMTHNQTTKLLYESYPFFIGM
FT                   NKKHTYGIFLDNSFRSFFNMGEESEEYYYFGAYGGQMNYYFIYGNDIKEVVENYTYLTG
FT                   RIELPPLWALGNQQSRYSYTPQEKVLEVAKTFREKDIPCDVIYLDIDYMEGYRVFTWNK
FT                   GTFKNYKEMLKNLKSMGFKVVTIVDPGVKRDYEYFVYREGIENDYFVKDKYGITYVGKV
FT                   WPGEACFPDFLQDKVRKWWGEKIANFVRDGIDGIWNDMNEPAVFETPTKTMPEDNIHIL
FT                   DGEKISHREAHNVYANYMALATKEGLLKERTNERPFILTRAAFAGIQRYAAMWTGDNRS
FT                   LYEHLLMMMPMLMNVGLSGQPFAGADVGGFEGDCSEELFIRWIEAAVFTPFLRVHSAIG
FT                   TKDQEPWSFGKKAEDIARKFIKIRYELLPYIYDLFYEASKKGYPVMRPLVFEYQEDENT
FT                   HKIYDEFMLGQNLLIAPVYLPSKDRREVYLPSGIWYDYFMGERYEGGNYYLVEAPIDTI
FT                   PVFVKEGAIIVKQKPLSYVEEDRIEEKVVEIYRGNRGRYVHYEDDGKTFDYKKGVYNLF
FT                   EIEFEYFDGEIDIKFDKVHFGYEDGAKKYRFVLKNFDEVKKVKINGEEVEEYEIVVK"
FT   misc_feature    4986..6602
FT                   /locus_tag="TTE0006"
FT                   /note="Pfam match to entry Glyco_hydro_31, Glycosyl
FT                   hydrolases family 31, score 636.7, E-value 1.30E-187"
FT   repeat_region   complement(6953..7179)
FT                   /note="TLR027, identity:89%, copy 1"
FT   gene            complement(7199..7940)
FT                   /locus_tag="TTE0007"
FT   CDS_pept        complement(7199..7927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0007"
FT                   /product="predicted glutamine amidotransferase"
FT                   /note="Best Blastp hit = gi|7522115|pir||T31439 probable
FT                   cobyric acid synthase CobQ - Heliobacillus mobilis
FT                   gi|3820538|gb|AAC84011.1| (AF080002) cobyric acid synthase
FT                   CobQ [Heliobacillus mobilis], score 264, E-value 8.00E-70"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23324"
FT                   /db_xref="GOA:Q8RDL0"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL0"
FT                   /protein_id="AAM23324.1"
FT                   /translation="MKLTIGHMYPDLLNLYGDRGNIIALKKRCEWRKIDVEIKEIKAGI
FT                   NENFADIDLLFFGGGSDREQKIVSEDLKSKKKNLIKAIEDGMPVLAICGGYQLLGEYYK
FT                   TLEGNKIEGLGILDAYTVASNKRLIGNIVVEAHLFNKKFYLVGFENHSGKTFLRNCSPL
FT                   GTVIIGYGNNGEDKKEGCVYKNVYGTYLHGPLLPKNPEMADILIETALSRKYGKINFEP
FT                   LEDSIEQRAKEAFIKRFMKK"
FT   gene            complement(7924..9289)
FT                   /gene="MurE"
FT                   /locus_tag="TTE0008"
FT   CDS_pept        complement(7924..9276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MurE"
FT                   /locus_tag="TTE0008"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /note="Best Blastp hit = gi|7522162|pir||T31440
FT                   UDP-N-acetylmuramyl tripeptide synthetase homolog murC -
FT                   Heliobacillus mobilis gi|3820539|gb|AAC84012.1| (AF080002)
FT                   UDP-N-acetylmuramyl tripeptide synthetase MurC
FT                   [Heliobacillus mobilis], score 298, E-value 1.00E-79"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23325"
FT                   /db_xref="GOA:Q8RDK9"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDK9"
FT                   /protein_id="AAM23325.1"
FT                   /translation="MKGLGVAIGKLVNISCKITGKGGTSLPGKIALMADDHLIKKLIEP
FT                   LKENKVIVTGTNGKTTTSGLIAHLLSYSGRKVVHNREGANMRTGIATSLIKSSSLTGNL
FT                   DRDAAVFEVDEANLSFVVNEINPNVVVITNFFRDQLDRFGELDLIVNKVKKALSDLSKD
FT                   SFVLLNADDPFTASIGEDLEAKVLYYGIEDDIKSLKSSSFEQKFCPVCGTKYEYKKIYY
FT                   GHLGNYYCPNCGKKRPSLDFRASDIFLSEDGIKFKLSYKDKIFTVKSNLVGLYNVYNIL
FT                   ASTSAGMLLNLDDSTILKAVENYWPIEGRLQKIQIRGKKAIINLIKNPVGFESTLNMLS
FT                   QFDKPLNLLILINDNYADGRDVSWLWDVNLEEFLSKAKVNHIITSGLRAEDMALRVKYA
FT                   GFDTERIKIMPLNEAVKEILDITKEELIAILPNYTALQDLNKYLKSQGALK"
FT   regulatory      complement(7936..7940)
FT                   /locus_tag="TTE0007"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(8380..9129)
FT                   /gene="MurE"
FT                   /locus_tag="TTE0008"
FT                   /note="Pfam match to entry Mur_ligase, Mur ligase family,
FT                   catalytic domain, score 74, E-value 5.90E-21"
FT   regulatory      complement(9285..9289)
FT                   /gene="MurE"
FT                   /locus_tag="TTE0008"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(9290..9630)
FT                   /gene="Arc1"
FT                   /locus_tag="TTE0009"
FT   CDS_pept        complement(9290..9619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Arc1"
FT                   /locus_tag="TTE0009"
FT                   /product="EMAP domain protein"
FT                   /note="Best Blastp hit = gi|12697606|dbj|BAB21608.1|
FT                   (AB052886) export-related chaperone [Thermus thermophilus],
FT                   score 125, E-value 1.00E-28"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23326"
FT                   /db_xref="GOA:Q8RDK8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDK8"
FT                   /protein_id="AAM23326.1"
FT                   /translation="MATYEDFLKLDIRVGRIIEVEDFPKAKKPAYKLKIDFGELGVKTS
FT                   SAQITKLYKKEDLYNRLVVCVVNFPPKKIADFVSEVLVLGVDDKEENVVLLQPEREVKV
FT                   GNKVY"
FT   misc_feature    complement(9299..9586)
FT                   /gene="Arc1"
FT                   /locus_tag="TTE0009"
FT                   /note="Pfam match to entry tRNA_bind, Putative tRNA binding
FT                   domain, score 102.8, E-value 6.80E-27"
FT   regulatory      complement(9626..9630)
FT                   /gene="Arc1"
FT                   /locus_tag="TTE0009"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            9709..11690
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT   regulatory      9709..9713
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9726..11690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /product="DNA gyrase (topoisomerase II) B subunit"
FT                   /note="Best Blastp hit = gi|4033402|sp|P94604|GYRB_CLOAB
FT                   DNA GYRASE SUBUNIT B gi|11270953|pir||T46555 DNA
FT                   topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain B
FT                   [imported] - Clostridium acetobutylicum
FT                   gi|1790875|gb|AAB41130.1| (U35453) DNA gyrase subunit B
FT                   [Clostridium acetobutylicum], score 805, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23327"
FT                   /db_xref="GOA:Q8RDK7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDK7"
FT                   /protein_id="AAM23327.1"
FT                   /translation="MSNLKKNDKIKLLDKFLEGRTMAKDETYTASQIQILEGLEAVRKR
FT                   PGMYIGSTGSRGLHHLVYEVVDNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDI
FT                   HPKVGKPAVEVALTMLHAGGKFNNDAYKVSGGLHGVGVSVVNALSERLEVIVKQRGKVF
FT                   RQVYERGVPKTPLEVIGETEETGTIITFKPDKEIFEEIVFDYDILAQRLRELAFLNKGI
FT                   NIKLIDERDGKEEVFNYEGGLIAFVKYLNRNKEVLHEEPIYMEAKNTDYEVEVCMQYND
FT                   SYNENIYSFANNIDTKEGGTHLIGFKSALTKVINDYAKKYGMIKDGEKNLQGEDVREGL
FT                   TAIVSVKLKNPQFEGQTKTRLGNPEMRSIVEGVVTEKLSAYLEENPSVARIIVEKALQA
FT                   ARAREAARKARELTRRKSALENTALPGKLADCSEKDPSKCELFIVEGDSAGGSAKAGRN
FT                   SRFQAILPLRGKILNVEKARLDKIFSNEEIRSIITALGTGIGEDFDISKLRYHKVIIMT
FT                   DADVDGSHIRTLLLTFFFRFMKPLIENGHIYIAQPPLYKITKGKKVYYAYSDRELDKIL
FT                   SEIGRENIVVQRYKGLGEMNADQLWETTMDPEKRTMLKVTLEDAIAADEIFTILMGDKV
FT                   EPRREFIEKYAKTVRNLDI"
FT   misc_feature    9882..10316
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /note="Pfam match to entry HATPase_c, Histidine kinase-,
FT                   DNA gyrase B-, phytochrome-like ATPase, score 95.6, E-value
FT                   4.50E-25"
FT   misc_feature    10329..10877
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /note="Pfam match to entry DNA_topoisoII, DNA topoisomerase
FT                   II (N-terminal region), score 348.3, E-value 8.20E-101"
FT   misc_feature    11040..11375
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /note="Pfam match to entry Toprim, Toprim domain, score
FT                   55.2, E-value 1.50E-12"
FT   misc_feature    11454..11654
FT                   /gene="GyrB"
FT                   /locus_tag="TTE0010"
FT                   /note="Pfam match to entry DNA_gyraseB_C, DNA gyrase B
FT                   subunit, carboxyl terminus, score 166.8, E-value 3.70E-46"
FT   gene            11693..14127
FT                   /gene="GyrA"
FT                   /locus_tag="TTE0011"
FT   regulatory      11693..11697
FT                   /gene="GyrA"
FT                   /locus_tag="TTE0011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11704..14127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GyrA"
FT                   /locus_tag="TTE0011"
FT                   /product="DNA gyrase (topoisomerase II) A subunit"
FT                   /note="Best Blastp hit = gi|4033403|sp|P94605|GYRA_CLOAB
FT                   DNA GYRASE SUBUNIT A gi|11271020|pir||T46556 DNA
FT                   topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain A
FT                   [imported] - Clostridium acetobutylicum
FT                   gi|1790876|gb|AAB41131.1| (U35453) DNA gyrase subunit A
FT                   [Clostridium acetobutylicum], score 969, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23328"
FT                   /db_xref="GOA:Q8RDK6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDK6"
FT                   /protein_id="AAM23328.1"
FT                   /translation="MNEEMDKVIPVDIEDEMRNSYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYAMNEMGLTPDKPYKKSVAVVGEVLGKYHPHGDAAVYDTLVRLAQDFSMREVLID
FT                   GHGNFGSIDGDPPAAMRYTEARLSRIALEMLTDINKETVDFVPNFDETLKEPVVLPSRF
FT                   PNLLVNGSQGIAVGMATNIPPHNLAEVIDGIVAYIDNPYITVDELMKYIKGPDFPTGGI
FT                   ILGRDGIKETYETGRGKIIVRAKAEIEEHKGKTRIVITEIPYMVLKAKLIEKIAELVHN
FT                   KQIEGIADLRDESDRNGMKIVIELKRDVNPKVILNKLYMHTQMQQTFGAIMLALVDGEP
FT                   KILNLKQIIEKYVDHQADVVTRRTKFDLKKAEERAHILEGLKIALDYIDEVINIIRSSK
FT                   TEAIAKENLMKRFGLSDKQAQAIVDMRLGRLTGLERQKVEDELKELIEKIKELKEILAD
FT                   ERKVLEIIKKELLEIKNKYASPRKTVIVAKEEELDFEDLVQLEDVVVTMTHYGYIKRMP
FT                   LDTYKSQKRGGKGILGISTREDDFVEDIFITTTHDRLLFFTNKGKVYSLRTIDIPESGR
FT                   QAKGTAIVNLIQISQGEKVTAVIPLKKSDDIKYVLMCTKKGIIKKTSIEEFKSIKRNGI
FT                   IAITLDENDELINVKLTNGEREVIIGTAKGYAIRFNEKDVRPMGRVARGVMAISLREDD
FT                   EVVEMDLVHPDGEVLTVTEKGFGKRTDLEEYRIQGRAGKGIIAMKLSKKTGKLVSIRCV
FT                   QPEDEFMIISANGILIRMKVKDISKMHRDTQGVTLMKLEDGDRVVSTARIESEE"
FT   misc_feature    11797..13137
FT                   /gene="GyrA"
FT                   /locus_tag="TTE0011"
FT                   /note="Pfam match to entry DNA_topoisoIV, DNA
FT                   gyrase/topoisomerase IV, subunit A, score 1043.9, E-value
FT                   0"
FT   regulatory      14130..14156
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(14153..15178)
FT                   /gene="NemA"
FT                   /locus_tag="TTE0012"
FT   CDS_pept        complement(14153..15166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NemA"
FT                   /locus_tag="TTE0012"
FT                   /product="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /note="Best Blastp hit = gi|1731075|sp|P54550|YQJM_BACSU
FT                   PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE YQJM
FT                   gi|7449900|pir||E69964 NADH-dependent flavin oxidoreductase
FT                   homolog yqjM - Bacillus subtilis gi|1303964|dbj|BAA12619.1|
FT                   (D84432) YqjM [Bacillus subtilis]
FT                   gi|2634817|emb|CAB14314.1| (Z99116) similar to
FT                   NADH-dependent flavin oxidoreductase [Bacillus subtilis],
FT                   score 330, E-value 2.00E-89"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23329"
FT                   /db_xref="GOA:Q8R5V6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V6"
FT                   /protein_id="AAM23329.1"
FT                   /translation="MSILHTPLKIKDITIKNRIMMSPMCMYTASTEGMPNDWHIVHYAT
FT                   RAIGGVGLIMQEATAVESRGRITDRDLGIWNDEQAEELKKIVDICKANGAVMGIQLAHA
FT                   GRKCNIPYEDVVGPSPIKAGDQYKLPRELTIDEIKSIVKAFGEAAKRANLAGYDVVEIH
FT                   AAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPQNKPIFVRVSADDY
FT                   IEGGINIDMMVEYINMIKDKVDVIDVSSGGLLNVDINPYPGYQVKYAETIKKRCNIKTC
FT                   AVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFKN"
FT   misc_feature    complement(14186..15160)
FT                   /gene="NemA"
FT                   /locus_tag="TTE0012"
FT                   /note="Pfam match to entry oxidored_FMN, NADH:flavin
FT                   oxidoreductase / NADH oxidase family, score 403.1, E-value
FT                   2.60E-117"
FT   repeat_region   15171..16989
FT                   /note="TLR004, identity:100%, copy 1"
FT   regulatory      complement(15174..15178)
FT                   /gene="NemA"
FT                   /locus_tag="TTE0012"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(15687..16984)
FT                   /locus_tag="TTE0013"
FT   CDS_pept        complement(15687..16970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0013"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 412, E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23330"
FT                   /db_xref="GOA:Q8R6I4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I4"
FT                   /protein_id="AAM23330.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMGIKDRLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVAGFIAEVGDIEKYEHPKQIQKLGGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    complement(15858..16187)
FT                   /locus_tag="TTE0013"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 76.1, E-value 7.20E-19"
FT   regulatory      complement(16980..16984)
FT                   /locus_tag="TTE0013"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   16988..17100
FT                   /note="TLR006, identity:100%, copy 1"
FT   gene            17639..18158
FT                   /gene="IlvH"
FT                   /locus_tag="TTE0014"
FT   regulatory      17639..17643
FT                   /gene="IlvH"
FT                   /locus_tag="TTE0014"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17655..18158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvH"
FT                   /locus_tag="TTE0014"
FT                   /product="Acetolactate synthase, small subunit"
FT                   /note="Best Blastp hit = gi|11499308|ref|NP_070547.1|
FT                   'acetolactate synthase, small subunit (ilvN) [Archaeoglobus
FT                   fulgidus]' gi|6225558|sp|O28555|ILVH_ARCFU PROBABLE
FT                   ACETOLACTATE SYNTHASE SMALL SUBUNIT (AHAS)
FT                   (ACETOHYDROXY-ACID SYNTHASE SMALL SUBUNIT) (ALS)
FT                   gi|7436729|pir||F69464 'acetolactate synthase, small
FT                   subunit (ilvN) homolog - Archaeoglobus fulgidus'
FT                   gi|2648836|gb|AAB89532.1| '(AE000985) acetolactate
FT                   synthase, small subunit (ilvN) [Archaeoglobus fulgidus]',
FT                   score 173, E-value 1.00E-42"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23331"
FT                   /db_xref="GOA:Q8RDK5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDK5"
FT                   /protein_id="AAM23331.1"
FT                   /translation="MHIISVLVNNHPGVLSRVVGLFSRRGYNIESLAVGTTEREDISRI
FT                   TLTVLGDDYTVTQIIRQLNKLVDVIKVQNIGKRDNVSRELLLVKVGYDSNTRNDIMHIV
FT                   ETFRGRVIDISLDSLIIEMTGDPEKIEAFLNLINKFDVKELVRTGLISLERGNKTLKEY
FT                   EGEL"
FT   misc_feature    17658..17879
FT                   /gene="IlvH"
FT                   /locus_tag="TTE0014"
FT                   /note="Pfam match to entry ACT, ACT domain, score 66.3,
FT                   E-value 6.60E-16"
FT   gene            18160..19155
FT                   /gene="IlvC"
FT                   /locus_tag="TTE0015"
FT   CDS_pept        18160..19155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvC"
FT                   /locus_tag="TTE0015"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /note="Best Blastp hit = gi|7431338|pir||D72362 ketol-acid
FT                   reductoisomerase - Thermotoga maritima (strain MSB8)
FT                   gi|4981065|gb|AAD35635.1|AE001730_3 (AE001730) ketol-acid
FT                   reductoisomerase [Thermotoga maritima], score 477, E-value
FT                   1.00E-133"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23332"
FT                   /db_xref="GOA:Q8RDK4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDK4"
FT                   /protein_id="AAM23332.1"
FT                   /translation="MAKMYYDQDADAEVLKGKKIAVIGFGSQGHAHALNLRDSGFDVVV
FT                   GLYEGSKSKERAEKEGLTVLTVEEAAKVADVIMMLIPDEKQAKVYKESIEKNLTEGKAL
FT                   AFAHGFNIHFKQIVPPENVDVFMVAPKGPGHLVRRMYQEGKGVPCLVAVHQNYTGKALD
FT                   IALAYAKGIGGTKAGAIETTFKEETETDLFGEQAVLCGGLTELMKAGFETLVEAGYQPE
FT                   IAYFECVNEMKLIVDLIYEGGFSYMRYSISDTAEFGDYMTGKRIITEETRKEMKKILEE
FT                   IQTGKFAKEWLLENQVGRPQYNAIKEREANHPIEKVGKSLREMMPWLSKK"
FT   misc_feature    18709..19146
FT                   /gene="IlvC"
FT                   /locus_tag="TTE0015"
FT                   /note="Pfam match to entry IlvC, Acetohydroxy acid
FT                   isomeroreductase, catalytic domain, score 314.3, E-value
FT                   1.40E-90"
FT   gene            19158..20367
FT                   /gene="LeuA"
FT                   /locus_tag="TTE0016"
FT   regulatory      19158..19162
FT                   /gene="LeuA"
FT                   /locus_tag="TTE0016"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19174..20367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuA"
FT                   /locus_tag="TTE0016"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /note="Best Blastp hit = gi|7447062|pir||A75045
FT                   2-isopropylmalate synthase (leua-1) PAB0890 - Pyrococcus
FT                   abyssi (strain Orsay) gi|5458767|emb|CAB50254.1| (AJ248287)
FT                   2-isopropylmalate synthase (leuA-1) [Pyrococcus abyssi],
FT                   score 471, E-value 1.00E-132"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23333"
FT                   /db_xref="GOA:Q8RDK3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDK3"
FT                   /protein_id="AAM23333.1"
FT                   /translation="MGVKRVIVFDTTLRDGEQTPGVNFNSRDKLEIAYQLAKLGVDVIE
FT                   AGFPAASNGDFEAVKNIADYVKGVTIAAMGRAVKEDIDRASSALKNAEKSRLHVFIATS
FT                   DIHLQYKLKMTRDEVLKKAVEMVKYARGKFDEIEFSAEDASRTDWDFLVKVFSEVIDAG
FT                   AHIINVPDTVGYAMPREYGELIRYIRNNVPNIDGVTISAHCHNDLGLAVANSLSAIENG
FT                   ATQVEVTVNGIGERAGNAAMEEVIMALNTRKDYFGLVHGINTKEIYNTSKLVSELTGIK
FT                   LQPNKAIVGANAFRHQSGIHQHGVINNRLTYEIMRPEDIGVVPDTFALGKLSGRNAFEL
FT                   KVRQLGYNLSPGEISEAFRKFKDLADRKKTIVEEDIRFVVEETIEEFRGFREGEAWA"
FT   misc_feature    19207..20043
FT                   /gene="LeuA"
FT                   /locus_tag="TTE0016"
FT                   /note="Pfam match to entry HMGL-like, HMGL-like, score
FT                   416.2, E-value 3.00E-121"
FT   gene            20345..21614
FT                   /gene="LeuC"
FT                   /locus_tag="TTE0017"
FT   regulatory      20345..20349
FT                   /gene="LeuC"
FT                   /locus_tag="TTE0017"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20358..21614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuC"
FT                   /locus_tag="TTE0017"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /note="Best Blastp hit = gi|7450358|pir||B75045 probable
FT                   3-isopropylmalate dehydratase (EC 4.2.1.33) large chain
FT                   PAB0891 - Pyrococcus abyssi (strain Orsay)
FT                   gi|5458768|emb|CAB50255.1| (AJ248287) PUTATIVE
FT                   3-ISOPROPYLMALATE DEHYDRATASE LARGE GE SUBUNIT (EC
FT                   4.2.1.33) (ISOPROPYLMALATE ISOMERASE) (ALPHA-IPM ISOMERASE)
FT                   (IPMI). [Pyrococcus abyssi], score 501, E-value 1.00E-141"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23334"
FT                   /db_xref="GOA:Q8RDK2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDK2"
FT                   /protein_id="AAM23334.1"
FT                   /translation="MGLTLTQKILSAKAGREVKPGELIEIDVDMVLGNDITAPVAIKEF
FT                   EKIGVDKVFDNTKIALVPDHFVPSKDIKSAEQVNVMRKFAKKYNIVNFFEVGRMGIEHA
FT                   LLPEQGLVLPGDVVIGADSHTCTYGALTCFATGVGSTDMAAAMATGKAWFKVPEAIKFV
FT                   LKGNLGKWVSGKDVILYIIGKIGVDGALYKSMEFTGNIKALSIDDRFTIANMAIEAGAK
FT                   NGIFDFDEITEAYVKKRAKREYKVFERDEDAEYSEVIEINLDDIRPQVAFPHLPENTRS
FT                   IDEVGKVKIDQVVIGSCTNGRLSDMEIAYRILKGKKVHPDVRLIIFPATQEIYLECVKR
FT                   GYIEEFIKAGAAVSTPTCGPCLGGHMGVLAKGERALATTNRNFVGRMGHPESEVYLASP
FT                   AVAAASAIAGYIVSPEEVE"
FT   misc_feature    20367..21584
FT                   /gene="LeuC"
FT                   /locus_tag="TTE0017"
FT                   /note="Pfam match to entry aconitase, Aconitase family
FT                   (aconitate hydratase), score 260.3, E-value 6.80E-79"
FT   gene            21601..22099
FT                   /gene="LeuD"
FT                   /locus_tag="TTE0018"
FT   regulatory      21601..21605
FT                   /gene="LeuD"
FT                   /locus_tag="TTE0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21614..22099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuD"
FT                   /locus_tag="TTE0018"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="Best Blastp hit = gi|7514144|pir||C75045
FT                   '3-isopropylmalate dehydratase, small chain (leud-1)
FT                   PAB0892 - Pyrococcus abyssi (strain Orsay)'
FT                   gi|5458769|emb|CAB50256.1| '(AJ248287) 3-isopropylmalate
FT                   dehydratase, small subunit (leuD-1) [Pyrococcus abyssi]',
FT                   score 239, E-value 1.00E-62"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23335"
FT                   /db_xref="GOA:Q8RDK1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDK1"
FT                   /protein_id="AAM23335.1"
FT                   /translation="MQGKAIKYGDNIDTDVIIPARFLNTSDPKELAEHCMEDLDREFKN
FT                   KVKEGDILVVGENFGCGSSREHAPLAIKASGISCIIAKSFARIFYRNAINIGLPILESR
FT                   EAVDGIEEGDIVSVDVDNGIIRNVTKGTEFKAQPFPEFIKEIIKYGGLINYVREKVR"
FT   misc_feature    21614..22051
FT                   /gene="LeuD"
FT                   /locus_tag="TTE0018"
FT                   /note="Pfam match to entry Aconitase_C, Aconitase
FT                   C-terminal domain, score 59.8, E-value 5.90E-14"
FT   gene            22089..23166
FT                   /gene="LeuB"
FT                   /locus_tag="TTE0019"
FT   regulatory      22089..22093
FT                   /gene="LeuB"
FT                   /locus_tag="TTE0019"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22099..23166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuB"
FT                   /locus_tag="TTE0019"
FT                   /product="Isocitrate/isopropylmalate dehydrogenase"
FT                   /note="Best Blastp hit = gi|400184|sp|P31958|LEU3_CLOPA
FT                   3-ISOPROPYLMALATE DEHYDROGENASE (BETA-IPM DEHYDROGENASE)
FT                   (IMDH) (3-IPM-DH) gi|144842|gb|AAC41394.1| (L06666)
FT                   isopropylmalate dehydrogenase [Clostridium pasteurianum],
FT                   score 441, E-value 1.00E-123"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23336"
FT                   /db_xref="GOA:Q8RDK0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDK0"
FT                   /protein_id="AAM23336.1"
FT                   /translation="MYRIAVLPGDGIGPEVIEEGLKVLKAVEEKYGLRFDIKKYPFGGE
FT                   AIDKYGEPYPEETRNGCLSSDAVLLGAVGGPKWDGLEGDKRPEAGLLALRKSLGVYANL
FT                   RPAVLYPSLKDASPLKNELLEKGLDILVVRELTGGIYFGPRGKEAIGYGFRAYDTEVYE
FT                   TQEIERIAVIAFEAALRRRKKITSVDKANVLESSRLWRKTVEEVAKRYPEVELNHMYVD
FT                   NCAMQLVKNPFQFDVILTNNMFGDILSDEAAQIVGSIGILPSASLRGDRVGLYEPIHGS
FT                   APDIAGKKIANPLATILSVAMMLQYSFGEEEAAQDIRKAVERALEEGFRTADLGKGIVL
FT                   STEEMGDKVVEYIKG"
FT   misc_feature    22105..23145
FT                   /gene="LeuB"
FT                   /locus_tag="TTE0019"
FT                   /note="Pfam match to entry isodh, Isocitrate and
FT                   isopropylmalate dehydrogenases, score 712.4, E-value
FT                   2.20E-212"
FT   gene            23159..24841
FT                   /gene="IlvD"
FT                   /locus_tag="TTE0020"
FT   regulatory      23159..23163
FT                   /gene="IlvD"
FT                   /locus_tag="TTE0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23171..24841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvD"
FT                   /locus_tag="TTE0020"
FT                   /product="Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /note="Best Blastp hit = gi|7436859|pir||F75045
FT                   dihydroxy-acid dehydratase (EC 4.2.1.9) (ilvd) PAB0895 -
FT                   Pyrococcus abyssi (strain Orsay) gi|5458772|emb|CAB50259.1|
FT                   (AJ248287) dihydroxy-acid dehydratase (EC 4.2.1.9) (ilvD)
FT                   [Pyrococcus abyssi], score 690, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23337"
FT                   /db_xref="GOA:Q8RDJ9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDJ9"
FT                   /protein_id="AAM23337.1"
FT                   /translation="MRSDAVKKGVERAPHRSLLYALGLTDEELKRPIIGVANSKNEIIP
FT                   GHIHLDKIAEAVKAGIRMAGGTPVEFSTIGVCDGIAMGHGGMKYSLGSREVIADSIEIM
FT                   AMAHGFDGIVLIPNCDKIVPGMLMAAARLDIPAIVVSGGPMLAGICDGTTCDLSTVFEA
FT                   VGALKAGKITEEEFYSIERNACPTCGSCSGMFTANTMNCLTEALGLGLPGNGTIPAVYS
FT                   ERIRLAKEAGMKIVELVERNITPSQILTKEAFVNAFSLDMALGGSTNTVLHLKAIAHEA
FT                   GVDIPLEEINDISDRVPNLCKLSPAGKYHIEDLHFAGGVSAVLKELSKAGLLHLDALTV
FT                   TGRTLGENIKDAKVRNRDVIRTIEDPYSKTGGIAILFGNIAREGAVVKASAVSPEMLRH
FT                   EGPARVFDSEEEAIEAIYGGKIQKGDVVVIRYEGPKGGPGMREMLSPTSALAGMGLDKD
FT                   VALITDGRFSGATRGASIGHVSPEAMEGGEIAIIEDGDIIEIDIPARKINVKLSDEEIK
FT                   KRMANWKRPEPKIKKGYMARYTREVTSGSKGAVFREGGV"
FT   misc_feature    23351..24703
FT                   /gene="IlvD"
FT                   /locus_tag="TTE0020"
FT                   /note="Pfam match to entry ILVD_EDD, Dehydratase family,
FT                   score 967.4, E-value 3.70E-287"
FT   gene            24825..26496
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT   regulatory      24825..24829
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24838..26496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT                   /product="Thiamine pyrophosphate-requiring enzymes
FT                   (acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase)"
FT                   /note="Best Blastp hit = gi|11499309|ref|NP_070548.1|
FT                   'acetolactate synthase, large subunit (ilvB-1)
FT                   [Archaeoglobus fulgidus]' gi|7436703|pir||G69464
FT                   acetolactate synthase (EC 4.1.3.18) large chain -
FT                   Archaeoglobus fulgidus gi|2648835|gb|AAB89531.1|
FT                   '(AE000985) acetolactate synthase, large subunit (ilvB-1)
FT                   [Archaeoglobus fulgidus]', score 513, E-value 1.00E-144"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23338"
FT                   /db_xref="GOA:Q8RDJ8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ8"
FT                   /protein_id="AAM23338.1"
FT                   /translation="MKLKGAQVVIEVLKEMGVDNVFGIPGGAVIPIYDALYDSDIRHIL
FT                   ATHEQMAAHMADGYARATGKVGVCIATSGPGATNLVTGIANAYMDSVPVVAITGQVPTY
FT                   LIGKDAFQEVDITGITMPITKHNFVVKSPEKLADTLREAFAIAKSGRPGPVLVDIPKDI
FT                   QNAEIEYERKGEIEYKNGIKEIISEESLSKAVELILESKKPVIFAGGGVIWGEACGELL
FT                   EFAEKTNIPVATSLMGLGCFPGDHPLSLGLIGMHGSRFANLAVYHSDLVIAVGTRFSDR
FT                   VAGKAGGLAPKAKFIHIDIDAAEIGKNVEVDVGIVGKIKKVLKLLADRVPSMERREWLE
FT                   EVEELRVKHGLRYKKDDMLRPQWIVEKIQELSNDDLIIATEVGQNQMWAAQFYKFKKPR
FT                   TFVTSGGLGAMGFGLPASIGAQVGRPDKRVVNIAGDGSLRMNIHALETAAFYNIPVIIV
FT                   LLNNQALGMVRQWQYLFNEKRFSQTDLNPHLNFAKIASDFGVEGIRVTTKEDFEKAFKK
FT                   AYSEKKPFMIECIIDKDEMVLPFIPAGGTVEDTIA"
FT   misc_feature    24838..25353
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT                   /note="Pfam match to entry TPP_enzymes_N, Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain, score
FT                   332.7, E-value 4.20E-96"
FT   misc_feature    25396..25863
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT                   /note="Pfam match to entry TPP_enzymes, Thiamine
FT                   pyrophosphate enzyme, central domain, score 200.4, E-value
FT                   2.80E-56"
FT   misc_feature    25900..26424
FT                   /gene="IlvB"
FT                   /locus_tag="TTE0021"
FT                   /note="Pfam match to entry TPP_enzymes_C, Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain, score
FT                   269.7, E-value 3.90E-77"
FT   regulatory      26500..26520
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(26524..27602)
FT                   /gene="PerM"
FT                   /locus_tag="TTE0022"
FT   CDS_pept        complement(26524..27588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PerM"
FT                   /locus_tag="TTE0022"
FT                   /product="predicted permease"
FT                   /note="Best Blastp hit = gi|10173076|dbj|BAB04182.1|
FT                   (AP001508) BH0463; unknown conserved protein [Bacillus
FT                   halodurans], score 154, E-value 2.00E-36"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23339"
FT                   /db_xref="GOA:Q8RDJ7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ7"
FT                   /protein_id="AAM23339.1"
FT                   /translation="MNNFLLRYGDIIKKTLLIVAVFIIFYLIIFKIIPFLMPFVVALLL
FT                   AVIIDPGVNFLEKKLKVPRGLASFILLLILIGVIGSLIAISITQLIYELSSLAEISTNY
FT                   ANTINDIILNLVDRIRMYYISLPPNITSLIESNMQSILNYVSLFAKNLATWLLNFATKL
FT                   PNFFFMTLITLVATFFISKDKQLILDFIKRQIPSHWAQHAKNIQVDLLKTFFGYLRAVA
FT                   TIMLITFLEVSIGLAIIGFDYPFLLGLLVTIVDALPVLGSGAVMVPWALYNIIMKNYMV
FT                   GIYLLILYGLVVVVRQMIEPKIVGQSIGLHPLVTLLSMFIGVKLFGAIGLVIGPVFVVV
FT                   FKALQKAEIIPPWK"
FT   misc_feature    complement(26542..27543)
FT                   /gene="PerM"
FT                   /locus_tag="TTE0022"
FT                   /note="Pfam match to entry UPF0118, Domain of unknown
FT                   function DUF20, score 181.1, E-value 1.80E-50"
FT   regulatory      complement(27598..27602)
FT                   /gene="PerM"
FT                   /locus_tag="TTE0022"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            27979..28521
FT                   /gene="LepB"
FT                   /locus_tag="TTE0024"
FT   regulatory      27979..27983
FT                   /gene="LepB"
FT                   /locus_tag="TTE0024"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27991..28521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LepB"
FT                   /locus_tag="TTE0024"
FT                   /product="Signal peptidase I"
FT                   /note="Best Blastp hit = gi|2497627|sp|Q51876|LEP_PHOLA
FT                   SIGNAL PEPTIDASE I (SPASE I) (LEADER PEPTIDASE I)
FT                   gi|1086234|pir||S51921 signal peptidase I (EC 3.4.21.89) -
FT                   oscillatoriacean cyanobacterium gi|732897|emb|CAA57518.1|
FT                   (X81990) leader peptidase I [Phormidium laminosum], score
FT                   141, E-value 7.00E-33"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23340"
FT                   /db_xref="GOA:Q8RDJ6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ6"
FT                   /protein_id="AAM23340.1"
FT                   /translation="MSKNIGKEILSWIFTILLAFAIALFIRTYVFELVDVPTGSMMDTI
FT                   HINDKFIVNKFIYRFEPVKRGDIVVFRFPDNPKVNFVKRVIGIGGDVIEIKDGKLIRNG
FT                   KVVNEPYVKEPMKGNFGPYVVPPGHYFMLGDNRNESMDSRFWQHKYVSKDQILGKVVFR
FT                   IWPPNRIGSMEGK"
FT   misc_feature    27991..28464
FT                   /gene="LepB"
FT                   /locus_tag="TTE0024"
FT                   /note="Pfam match to entry Peptidase_S26, Signal peptidase
FT                   I, score 118.9, E-value 1.70E-35"
FT   gene            28792..30082
FT                   /gene="SerS"
FT                   /locus_tag="TTE0025"
FT   regulatory      28792..28796
FT                   /gene="SerS"
FT                   /locus_tag="TTE0025"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28805..30082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SerS"
FT                   /locus_tag="TTE0025"
FT                   /product="Seryl-tRNA synthetase"
FT                   /note="Best Blastp hit = gi|586064|sp|P37464|SYS_BACSU
FT                   SERYL-TRNA SYNTHETASE (SERINE--TRNA LIGASE) (SERRS)
FT                   gi|2127203|pir||S66043 serine--tRNA ligase (EC 6.1.1.11) -
FT                   Bacillus subtilis gi|467403|dbj|BAA05249.1| (D26185)
FT                   seryl-tRNA synthetase [Bacillus subtilis]
FT                   gi|2632280|emb|CAB11789.1| (Z99104) seryl-tRNA synthetase
FT                   [Bacillus subtilis], score 530, E-value 1.00E-149"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23341"
FT                   /db_xref="GOA:Q8RDJ5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDJ5"
FT                   /protein_id="AAM23341.1"
FT                   /translation="MLDIKFIRSNPDVVRRAIELKGEKADLDRLLLLDEKRREMLVELE
FT                   ALKNKRNTESDNIARLKREGKDASELIAKMKELSDKIKDMEQELREIEEEMEKILWTIP
FT                   NIPHESVPIGESDEDNVEVRRWGEPRKFDFEPKPHWEIGEALGILDFEAASRVTGSRFV
FT                   FYKGLGARLERALINFMLDLHIEKHGYKEVFPPFLVHRRSMFGTGQLPKFEEDAFKVEG
FT                   TDYFLIPTAEVPVTNLYRETIIDGEQLPIYHCAYSACFRQEAGAAGRDTRGLIRQHQFD
FT                   KVELVKFTEPDKSYEELEKMTRDAEEVLQALGLPYRVVAICTGDLGFTASKKYDIEVWM
FT                   PSYGRYVEISSCSNCEDFQARRANIRYRPKGGGKLQYVHTLNGSGVAVGRTFAAILENY
FT                   QQEDGSVVVPEVLRPYMKVDVIRKEE"
FT   misc_feature    28805..28945
FT                   /gene="SerS"
FT                   /locus_tag="TTE0025"
FT                   /note="Pfam match to entry Seryl_tRNA_N, Seryl-tRNA
FT                   synthetase N-terminal domain, score 54.2, E-value 2.80E-12"
FT   misc_feature    29006..30055
FT                   /gene="SerS"
FT                   /locus_tag="TTE0025"
FT                   /note="Pfam match to entry tRNA-synt_2b, tRNA synthetase
FT                   class II (G, H, P, S and T), score 375.8, E-value
FT                   4.30E-109"
FT   gene            30157..30245
FT                   /locus_tag="TTEt01"
FT   tRNA            30157..30245
FT                   /locus_tag="TTEt01"
FT                   /product="tRNA-Ser"
FT   gene            30258..30352
FT                   /locus_tag="TTEt02"
FT   tRNA            30258..30352
FT                   /locus_tag="TTEt02"
FT                   /product="tRNA-Ser"
FT   regulatory      30371..30396
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(30406..31633)
FT                   /gene="LytR"
FT                   /locus_tag="TTE0026"
FT   CDS_pept        complement(30406..31620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LytR"
FT                   /locus_tag="TTE0026"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|7430406|pir||S75661
FT                   membrane-bound protein lytR - Synechocystis sp. (strain PCC
FT                   6803) gi|1653307|dbj|BAA18222.1| (D90912) membrane bound
FT                   protein LytR [Synechocystis sp.], score 163, E-value
FT                   3.00E-39"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23342"
FT                   /db_xref="GOA:Q8RDJ4"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ4"
FT                   /protein_id="AAM23342.1"
FT                   /translation="MKKVVKILAVIFLGIILSVGIGAYIFYKNIHVPAVQEENPIASLN
FT                   NPEKKEEDLSSKNVLVVGSDENNLSDTLFIANYNPKNKTISILSIPRDTYYPRPGYNSP
FT                   GDKKINAAFTEDGIEGTKKAVENLLGINIDHYIIIDYEGFKKVIDTIGGVEVDIPFDMK
FT                   YDDNSANPPLHINLKKGRQVLDGEKAIQFVRYRHGYIDGDLGRIKAQHQFLEALFKKLT
FT                   QPSTLPKLPSLAIAVSKHIKTDLTATEIAKYAYQFVKDKPSSIKSFTLPGEPDYKDGVS
FT                   YFFADNTKIPEVVAEFLGDKTTFSFDPSEIEKNKAIKVEVLNGTNIPGLASKCAETLRK
FT                   QGFDVVRIGNVVGTTFSTSHVYARTDEEKAKKVANALSIICVEKDITPDSSVDVTVILG
FT                   KDKSK"
FT   regulatory      complement(31629..31633)
FT                   /gene="LytR"
FT                   /locus_tag="TTE0026"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   31638..33408
FT                   /note="TLR005, identity:99%, copy 1"
FT   gene            31788..33173
FT                   /locus_tag="TTE0027"
FT   regulatory      31788..31792
FT                   /locus_tag="TTE0027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31806..33173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0027"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|624698|gb|AAB42162.1| (L38972)
FT                   transposase [Plasmid pHKK701], score 72.4, E-value
FT                   1.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23343"
FT                   /db_xref="GOA:Q8R6I5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I5"
FT                   /protein_id="AAM23343.1"
FT                   /translation="MFRQLLPVFLLTHLLNFLLKISLFALKHFKVDIQPPVDLQPSGYK
FT                   VLSPLEDPLPLVEKVVEKKDYKKILAEAEAQGKPISHVRRIKPLCVDVDKCPVCGAPPD
FT                   YLYSFGKDPDGFQKLQCKVCKHQWAPGKPAPKKSRPTYRCPFCGSALIQDKTRKNFTVF
FT                   KCRNDNCPKWLNHRKRYRFRAFDVDFDELSSSSPNAAPVNLAKSHFSPFLIAQTVNLYV
FT                   GLGLSLRQTVSALQHIWQVQLSHQTIQNWVVSLASKLAPLVKSINLPLSGLVVIDETYI
FT                   KVKGKWHYLFTACDGLRGFIISQHLSPHRDALAALTILKEVIDRYNNREFILVTDKAPI
FT                   YDVAVHFASVFFGANIRHRPVLGISPPPGGDSHTYRPYKNRLERLFGSYKAHYKRHKSF
FT                   SSFEGAIAHALLYQLYYNHLKPHEASDGKVLAPLKDKHGHQVDNWAKLIQWFVELN"
FT   misc_feature    32601..32828
FT                   /locus_tag="TTE0027"
FT                   /note="Pfam match to entry rve, Integrase core domain,
FT                   score 23.9, E-value 9.70E-06"
FT   gene            33576..36322
FT                   /locus_tag="TTE0028"
FT                   /note="authentic frameshift, conserved hypothetical; Best
FT                   Blastx hit = ref|NP_070250.1| conserved hypothetical
FT                   protein [Archaeoglobus fulgidus] pir||D69427 conserved
FT                   hypothetical protein AF1421 - Archaeoglobus fulgidus
FT                   gb|AAB89825.1| (AE001005) conserved hypothetical protein
FT                   [Archaeoglobus fulgidus], score 408, E-value 1.00E-169"
FT   gene            36376..36452
FT                   /locus_tag="TTEt03"
FT   tRNA            36376..36452
FT                   /locus_tag="TTEt03"
FT                   /product="tRNA-Arg"
FT   gene            36681..39306
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT   regulatory      36681..36685
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36694..39306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /product="Cation transport ATPases"
FT                   /note="Best Blastp hit = gi|13621819|gb|AAK33594.1|
FT                   (AE006517) putative calcium-transporting ATPase
FT                   [Streptococcus pyogenes], score 722, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23344"
FT                   /db_xref="GOA:Q8RDJ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ3"
FT                   /protein_id="AAM23344.1"
FT                   /translation="MKKYWNMPIEEIKKELETDDVYGLTQEQVNERLLKHGKNILREKE
FT                   RKSIFSLFMEQFKDYMVLILIVASIISFFLGETTDASIILAIVILNALLGTVQENKAEK
FT                   SLEALKKLSQPLAKVIRDGKVMEVEASSLVVGDVVLIEAGNIIPADGRLVEAKNLKVDE
FT                   SVLTGESVPVEKVDTVIEKEDIPLGDRFNLVYMGTTVTYGRGKFIVTATGMDTEMGKVA
FT                   SLIENERDVKTPLQLKLEELGKYLGTAAILISGIMFGVGVLQKRPIFDMFMTAVSLAVA
FT                   AIPEGLPAIITITLALGVQKMSKKNAIIRKLPAVETLGSTSVICSDKTGTLTQNKMTVV
FT                   KFYVNDRKVNAQKDEVKQEDYFLLKNAALCTDAFIDEEGKGIGDPTEVAIVAAINDLVG
FT                   LKKADIEKEFPRVAEIPFDSDRKMMSTIHMVDKEGFRLITKGAPDNIIKRCKYILKENK
FT                   ILPFDEIEKNKLSSINEEMGGEALRVIAVAYKDIKEIPENLSSDEMEKDLIFIGLIGMI
FT                   DPPRREAKHSVEICKKAGIKPVMITGDHKITASAIARELGILEDNDEAVTGEDLDRISD
FT                   DELAERIKRISVFARVSPEHKMRIVKAWQKRGAVVAMTGDGVNDAPALKQADIGVAMGI
FT                   TGTDVAKEAADMVLTDDNFATIVAAVEEGRTIFANIKKAIHYLLSCNFGEIVTLFIATI
FT                   LGMPMPLKPVHILWVNLITDSLPALALGFEPPERDIMEKKPRPKGESIFAGGLAYRILF
FT                   EGMLIGLVTLIAFVIGLKQNIETARTMAFAVLTLSQLAQALNVRSDKSIFKIGLFTNKY
FT                   MIFALIVAILLQVILIVTPLNAVFGLKNINVYDWDIIIAMAILPLLVMEVVKFFKKAN"
FT   misc_feature    36694..36924
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /note="Pfam match to entry Cation_ATPase_N, Cation
FT                   transporter/ATPase, N-terminus, score 64.4, E-value
FT                   2.40E-15"
FT   misc_feature    36940..37644
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /note="Pfam match to entry E1-E2_ATPase, E1-E2 ATPase,
FT                   score 383.9, E-value 1.70E-115"
FT   misc_feature    37654..38604
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /note="Pfam match to entry Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 83, E-value 6.30E-21"
FT   misc_feature    38887..39297
FT                   /gene="MgtA4"
FT                   /locus_tag="TTE0030"
FT                   /note="Pfam match to entry Cation_ATPase_C, Cation
FT                   transporting ATPase, C-terminus, score 90.5, E-value
FT                   3.40E-23"
FT   gene            39346..40038
FT                   /locus_tag="TTE0032"
FT   regulatory      39346..39350
FT                   /locus_tag="TTE0032"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39394..40038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7459259|pir||B70453
FT                   hypothetical protein aq_1776 - Aquifex aeolicus
FT                   gi|2984084|gb|AAC07623.1| (AE000756) putative protein
FT                   [Aquifex aeolicus], score 150, E-value 2.00E-35"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23345"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ2"
FT                   /protein_id="AAM23345.1"
FT                   /translation="MKVAWSATHSEFLLSDGYYFSGLHRELLKRGIVVEEVGDFEKLFQ
FT                   YDVVIFNYPEDPFDEKEKMIIKKALESGKKKIIFASHFRNKDEVSEICNGVTKDYGIYI
FT                   LPEGVKEKEFYLEEDPFIITTDQIFLYSEGVKEIVFPYAAPIEIRDRVEVVLKGRSTSF
FT                   TDSNGTSPVLIAQKSFDSGSKLIVCGSCIFWDNFSLFKLDNLQFVVNLISL"
FT   gene            complement(40025..41736)
FT                   /locus_tag="TTE0034"
FT   CDS_pept        complement(40025..41722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|11292727|pir||F82415 conserved
FT                   hypothetical protein VCA0786 [imported] - Vibrio cholerae
FT                   (group O1 strain N16961) gi|9658211|gb|AAF96684.1|
FT                   (AE004407) conserved hypothetical protein [Vibrio
FT                   cholerae], score 425, E-value 1.00E-118"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23346"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ1"
FT                   /protein_id="AAM23346.1"
FT                   /translation="MTKEQLKKIIDKIDGKGYKAYKEIEGEYEFEKFTLYIDYVQPDPF
FT                   APPSRIRVRVPLSISGFEKELFSNSSRQVALEDFLTRSVAQVIEKLPSIKGTGHSGNIY
FT                   IDKGGQEILKRSAMVVTENYIEARMNVGLPAFGRKINGRGALTQLLDFIPQIVEKGLLK
FT                   KNLNVDKIWLWVTTVEDQDYLRNLLKELGLVAFVADGSILPRESGVSDKPLKGKNVVPF
FT                   KSPESLRVKVTLPNRGEITGMGIPQGVTLIVGGGYHGKSTLLKALERGVYNHIPGDGRE
FT                   FVITVEDAVKIRAEDGRRVEKVDISAFIKNLPNGEDTTSFSTENASGSTSQAANIIEAI
FT                   EIGTSLLLLDEDTSATNFMIRDARMQKLIAKDEEPITPFIDRVRQLYEQNGISTILVMG
FT                   GSGDYFDVADCVIKMHNYRPFDVTEEAKKIAQEIKTERKIESEDIPIAVKDRIPLKEGL
FT                   RAKGKKVKSKDKETIRLGYEEIELDYVEQIVDKSQTNAIAEIIRYMEKYIDERKSLKEI
FT                   LKAVFKDINEKGLEIVSPFYGKHPGNLALPRIQEVAAAINRLRSFKVK"
FT   regulatory      complement(41732..41736)
FT                   /locus_tag="TTE0034"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   41782..43377
FT                   /note="TLR008, identity:100%, copy 1"
FT   gene            41876..43292
FT                   /locus_tag="TTE0033"
FT   regulatory      41876..41880
FT                   /locus_tag="TTE0033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41889..43292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23347"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6I7"
FT                   /protein_id="AAM23347.1"
FT                   /translation="MKKHIFEDIILQNALNFTREMMNVFEDLLKNGMNITELVARIKEL
FT                   TDKLGREAIEAIIEELDRIIKEDKRRKEKWVVERKDKKRLTTVLGDIEYERTYYKSRED
FT                   GRYTYLVDDALEIGRHERIEKGVKIKLVENAIEESYEKSSEKACPEKISKQTVLNAIRE
FT                   IGEVEVKREIKEKKEVRVLYIEADEDHVPLQDGSSETPRLIYIHEGREEKNGRNVLKNV
FT                   YYKAYVGEKAEDIWIDVANYIEENYKEEKIEKIYIAGDGAPWIKEGLEWIVKSRFVLDR
FT                   YHLNKYVLKATSKEPKYRDKIWRAINEGDKEGVKKIFGELIKIAKEEKEKEKIKEAKRY
FT                   ILNNWEGIKIYSEDEDVIGCSAEGHISHVFSARLSRNPLGWSREGLKLMAKLRVFSKNG
FT                   GDLREVEWGKKKNINAGSYKLTEKQIKEAVRRVKTSTNEKINNITVLNIGKVTPIYRVL
FT                   RALKYAQVI"
FT   gene            43441..44167
FT                   /locus_tag="TTE0035"
FT   regulatory      43441..43445
FT                   /locus_tag="TTE0035"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43454..44167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit =
FT                   gi|6016678|gb|AAF01505.1|AC009991_1 (AC009991) unknown
FT                   protein [Arabidopsis thaliana]
FT                   gi|12321863|gb|AAG50959.1|AC073395_1 (AC073395) unknown
FT                   protein; 50065-48267 [Arabidopsis thaliana], score 51.6,
FT                   E-value 1.00E-05"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23348"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDJ0"
FT                   /protein_id="AAM23348.1"
FT                   /translation="MPKESYSILLAGDSISRGVVLDREKNKYVITERNYVNLVKGRIKG
FT                   TIKNISRFGATILKGIEMIKKEFVREKPDVVVLEFGGNDCDFDWEQVAKNPEMEHFPKT
FT                   DYHLFIQKLKEIIEFLKEFEVVPVLMTLPPLDADRYLKWISKASKEVEENILRWLGSVT
FT                   KIYWWQERYNSAIRVIAEETKTLVIDVRSAFLYYPDFRNFLCEDGIHPNEEGHKIMAHK
FT                   IGEYLKKHYPFLLKI"
FT   gene            44169..45506
FT                   /locus_tag="TTE0036"
FT   regulatory      44169..44173
FT                   /locus_tag="TTE0036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44184..45506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0036"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /note="Best Blastp hit = gi|7462451|pir||A72430
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4980490|gb|AAD35101.1|AE001689_7 (AE001689) hypothetical
FT                   protein [Thermotoga maritima], score 553, E-value
FT                   1.00E-156"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23349"
FT                   /db_xref="GOA:Q8RDI9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI9"
FT                   /protein_id="AAM23349.1"
FT                   /translation="MEFMNVSLPEEIAREENLGNYDKALKLIDRWLKKDIPSWLKKRLI
FT                   FEKDRIKVLLSSYPYTEEEAIKKGKEVIKSFTEEEFYKLLEEGIVDYIVVNGERKYERR
FT                   YAYNIGYALPEYKERIARSESVEKDRKLLNERLNSLIKGDKAKEYRVKARISLKIEEDV
FT                   KDKVRVWLPFPKEELQQKDVKLISKSHEKYTLAPSEAPQRTIYFEGKSSEEYFVEFEYT
FT                   ITEWVNRVEPEKITEAKGSVFLEEQPPHIVFTPYLKKLAYEIVGDEKNPYYKAKKIYDW
FT                   ITLNVNYSYVKPYAVYDNISQFVASNLKGDCGFQALSFITLCRIVGVPARWQSGWYISP
FT                   FFTSPHDWALFFVPPYGWLPADLSFGGRYRENEELRNFYFGNLDGFRMVANSDFMKDFI
FT                   PSKTHWRSDPCDNQVGEVETMDRNIYNFSYEMNILEFNSIN"
FT   gene            45560..46020
FT                   /locus_tag="TTE0037"
FT   regulatory      45560..45564
FT                   /locus_tag="TTE0037"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45574..46020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0037"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /note="Best Blastp hit = gi|10172645|dbj|BAB03752.1|
FT                   (AP001507) Cu binding protein (Mn oxidation) [Bacillus
FT                   halodurans], score 150, E-value 1.00E-35"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23350"
FT                   /db_xref="GOA:Q8RDI8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI8"
FT                   /protein_id="AAM23350.1"
FT                   /translation="MANKFMEEALKEAKKSYELGEVPVGAVIVKDGEIIARGHNQKESS
FT                   KDATAHAEIIAIREACRRLGSWRLEDCSLYVTLEPCPMCAGAIVEARIKRVYIGTESPK
FT                   EGAAGSVINILNNKELGTSTEVYFGIMEEEAKELLKKFFENLRE"
FT   misc_feature    45574..45873
FT                   /locus_tag="TTE0037"
FT                   /note="Pfam match to entry dCMP_cyt_deam, Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region, score 171.1,
FT                   E-value 1.80E-47"
FT   gene            46025..46115
FT                   /locus_tag="TTEt04"
FT   tRNA            46025..46115
FT                   /locus_tag="TTEt04"
FT                   /product="tRNA-Ser"
FT   gene            46129..46222
FT                   /locus_tag="TTEt05"
FT   tRNA            46129..46222
FT                   /locus_tag="TTEt05"
FT                   /product="tRNA-Ser"
FT   gene            46662..48568
FT                   /locus_tag="TTE0038"
FT   regulatory      46662..46666
FT                   /locus_tag="TTE0038"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46670..48568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0038"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and an HD-GYP domain"
FT                   /note="Best Blastp hit = gi|7462228|pir||E72220 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982276|gb|AAD36766.1|AE001810_5 (AE001810) conserved
FT                   hypothetical protein [Thermotoga maritima], score 211,
FT                   E-value 2.00E-53"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23351"
FT                   /db_xref="GOA:Q8RDI7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI7"
FT                   /protein_id="AAM23351.1"
FT                   /translation="MFRREYRKKLFVVLFGVSFFVYFLSLVHFLSGFEKRIFIGSLILL
FT                   ISMGLSSFLSKKLSEPIEKLEEGVKRISQGDFGYRLDVKSSQEFEELSKSFNFMAQQLS
FT                   YAYERLKEQTDNLIRQNEELQEFNAELEASYEQLEALTRELELSERKYRLLVENIRDIL
FT                   WVTDKNFIIEFVNSRVVRYLNYTPQELVGKSLLEIVDEEAKETLKNMMEGKVRFAEVSF
FT                   RTKDGLLLLTETHVKRLKVDEEVIGLQGISRDITETYYIKKQIEEKNNEILAISDVGRL
FT                   ITSGSDMKEVLKAIVEKVAGLLNSPLCAVREYHPSSGKFLLLAKGGELKDYPVSEEIRL
FT                   SEKDIEELVTSKEIKIKDVDEFPHSEKVMPIFRAKDVYSVVVVPLVFGGETKGILTVWA
FT                   STNTVKNMSLLRSVASAISLAMENSKLYEEIKKVYIKTIEALAYAIEAKDIHTKGHSMR
FT                   VSQYAALIGEYMGFSREKVEQLRIAGILHDIGKIGIRDSILLKEGKLTQQEYEAMKLHP
FT                   EIARKILAPIDLPKEILEAIAKHHERYDGKGYPYGLKGEEIPIEAAILGVADAFDAMTS
FT                   DRSYRKGMSIEEAVNEVLRNKGTQFHPEVVDVFISIYMNERHRLEEIKNQVLESAS"
FT   misc_feature    46775..46984
FT                   /locus_tag="TTE0038"
FT                   /note="Pfam match to entry HAMP, HAMP domain, score 42.7,
FT                   E-value 8.40E-09"
FT   misc_feature    47117..47305
FT                   /locus_tag="TTE0038"
FT                   /note="Pfam match to entry PAS, PAS domain, score 37.6,
FT                   E-value 8.10E-09"
FT   misc_feature    47528..47947
FT                   /locus_tag="TTE0038"
FT                   /note="Pfam match to entry GAF, GAF domain, score 38.3,
FT                   E-value 1.70E-07"
FT   misc_feature    48023..48391
FT                   /locus_tag="TTE0038"
FT                   /note="Pfam match to entry HD, HD domain, score 70, E-value
FT                   5.00E-17"
FT   regulatory      48572..48595
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            48654..50222
FT                   /gene="DnaX"
FT                   /locus_tag="TTE0039"
FT   regulatory      48654..48658
FT                   /gene="DnaX"
FT                   /locus_tag="TTE0039"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48666..50222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaX"
FT                   /locus_tag="TTE0039"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /note="Best Blastp hit = gi|13700368|dbj|BAB41666.1|
FT                   (AP003130) DNA polymerase III gamma and tau subunits
FT                   [Staphylococcus aureus] gi|13874790|dbj|BAB46036.1|
FT                   (AP003359) DNA-directed DNA polymerase III chain
FT                   [Staphylococcus aureus], score 332, E-value 5.00E-90"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23352"
FT                   /db_xref="GOA:Q8RDI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI6"
FT                   /protein_id="AAM23352.1"
FT                   /translation="MYQSLYRKYRPKSFSEVVGQDHIVRTLRNQIKMGRIGHAYLFTGT
FT                   RGTGKTSVAKIFAKAVNCLNPKDGEPCNSCEVCQAINTGTTMDVLEIDAASNNSVNDVR
FT                   ELRESVIYSPSLTKYKVYIIDEVHMLSTGAFNALLKTLEEPPRHVIFILATTEPEKLPD
FT                   TILSRCQRFDFKKIPTKQIAQNLERICQDSGIQIEQNGIRAIALYGNGSMRDAISLLEQ
FT                   CASYKEGLITYEDVCEILGVANEEMLFSLLDHIYEKDAVASLQQLDKILSYGIDLGNFL
FT                   RSFTYMLRDMVIYKTGGDELIEILYGDQETIKAKSQKYSIGFLTNALEKFTALQREIRY
FT                   AVSPVTLLELTILRLIRPEISYDMGSLIARIEELEEKINKGYVVTKEESAKTHEKDELE
FT                   KKVDATKEAKKEREEIDLGRVWLEVKGILKKERMMLYTFLEKGVPHLKDGKIVVEYSEE
FT                   DALLVEQLGRPENKDFIEGVVEKVVKKRIPIEFALKKSEEDLLIKQVKEFFGDGIDIEI
FT                   I"
FT   misc_feature    48780..49352
FT                   /gene="DnaX"
FT                   /locus_tag="TTE0039"
FT                   /note="Pfam match to entry AAA, ATPase family associated
FT                   with various cellular activities (AAA), score 43.7, E-value
FT                   4.10E-09"
FT   gene            50270..50618
FT                   /locus_tag="TTE0040"
FT   regulatory      50270..50274
FT                   /locus_tag="TTE0040"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50283..50618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|12585382|sp|Q9JWQ5|Y035_BACHD
FT                   HYPOTHETICAL PROTEIN BH0035 gi|7007420|dbj|BAA90837.1|
FT                   (AB031210) YaaK [Bacillus halodurans]
FT                   gi|10172647|dbj|BAB03754.1| (AP001507) BH0035; unknown
FT                   conserved protein [Bacillus halodurans], score 88.6,
FT                   E-value 2.00E-17"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23353"
FT                   /db_xref="GOA:Q8RDI5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDI5"
FT                   /protein_id="AAM23353.1"
FT                   /translation="MAKGGFPGGFNINNMIKQAQQMQEEIKKMQEELMQKTVEGTSGGG
FT                   MVKAVANGRKELVSININPEVVDKDDVETLEDLVLAAVNQALRNAEEMIASEMAKITGG
FT                   FNIPGLF"
FT   misc_feature    50310..50591
FT                   /locus_tag="TTE0040"
FT                   /note="Pfam match to entry DUF149, Uncharacterized BCR,
FT                   YbaB family COG0718, score 118.8, E-value 1.10E-31"
FT   gene            50588..51227
FT                   /gene="RecR"
FT                   /locus_tag="TTE0041"
FT   regulatory      50588..50592
FT                   /gene="RecR"
FT                   /locus_tag="TTE0041"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50628..51227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecR"
FT                   /locus_tag="TTE0041"
FT                   /product="Recombinational DNA repair protein"
FT                   /note="Best Blastp hit = gi|10172648|dbj|BAB03755.1|
FT                   (AP001507) DNA repair and genetic recombination [Bacillus
FT                   halodurans], score 268, E-value 5.00E-71"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23354"
FT                   /db_xref="GOA:Q8RDI4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="PDB:3VDP"
FT                   /db_xref="PDB:3VDU"
FT                   /db_xref="PDB:3VE5"
FT                   /db_xref="PDB:4O6O"
FT                   /db_xref="PDB:4O6P"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDI4"
FT                   /protein_id="AAM23354.1"
FT                   /translation="MSYYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLS
FT                   QAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGV
FT                   YHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKP
FT                   FGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV"
FT   misc_feature    50742..50867
FT                   /gene="RecR"
FT                   /locus_tag="TTE0041"
FT                   /note="Pfam match to entry RecR, RecR protein, score 63.8,
FT                   E-value 3.60E-15"
FT   misc_feature    50868..51149
FT                   /gene="RecR"
FT                   /locus_tag="TTE0041"
FT                   /note="Pfam match to entry Toprim, Toprim domain, score
FT                   78.6, E-value 1.30E-19"
FT   regulatory      51235..51263
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            51357..52543
FT                   /locus_tag="TTE0042"
FT   regulatory      51357..51361
FT                   /locus_tag="TTE0042"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51371..52543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0042"
FT                   /product="HD-GYP domain protein"
FT                   /note="Best Blastp hit = gi|11354806|pir||G82430 conserved
FT                   hypothetical protein VCA0681 [imported] - Vibrio cholerae
FT                   (group O1 strain N16961) gi|9658098|gb|AAF96581.1|
FT                   (AE004397) conserved hypothetical protein [Vibrio
FT                   cholerae], score 216, E-value 3.00E-55"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23355"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI3"
FT                   /protein_id="AAM23355.1"
FT                   /translation="MNLSYNNLLSAFSLALDVQEYKNMGHARRVAYVSLRISEMLGFDE
FT                   EKKKKVYYSALLHDIGKGDIYEDFYTEEWWKHADRGSKIVLKLPFGENFSEIIRYHHEN
FT                   YDGSGHFKLKGDEIPLGAQIVFISDQFDIRYTSLSHKEREYNIRENLKECVETNIGKMF
FT                   NPLVSKALLELMKQEKFWLDYKFFDIKSILNKIEPKDTIPIGIDELENIAEAFADIIDT
FT                   RSRFTYEHSRGISNLAYQMAKVLGYDEETSRKIRVAGLLHDLGKLAVPNSILDKPGKLT
FT                   EEEFMVMKSHVYYTKIILKEIGGIDEIAEWAANHHEKLDGSGYPEGLRGYEMGDIDKHI
FT                   AVCDIFQALTEDRPYRKGMSTKEAIRIIEKEVKNGKLNEESLEILKKVVF"
FT   misc_feature    51437..51772
FT                   /locus_tag="TTE0042"
FT                   /note="Pfam match to entry HD, HD domain, score 56.8,
FT                   E-value 4.80E-13"
FT   misc_feature    52049..52417
FT                   /locus_tag="TTE0042"
FT                   /note="Pfam match to entry HD, HD domain, score 63.7,
FT                   E-value 3.80E-15"
FT   gene            52582..52866
FT                   /locus_tag="TTE0043"
FT   regulatory      52582..52586
FT                   /locus_tag="TTE0043"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52594..52866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23356"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI2"
FT                   /protein_id="AAM23356.1"
FT                   /translation="MGILFDYLKEMAATKNIYEYNSDGMQLVDEVRRTIKELRDAEIYF
FT                   HNVTDPDLVDYAIYRLESLKRKYIYLLKKAKEEGVSFDNFSSLLS"
FT   gene            complement(52979..53335)
FT                   /locus_tag="TTE0045"
FT   CDS_pept        complement(52979..53326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23357"
FT                   /db_xref="GOA:Q8RDI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI1"
FT                   /protein_id="AAM23357.1"
FT                   /translation="MLLALKQLLFLYRFLQSYAILLLSFFKTYYFKNKEDLNCLFLCQL
FT                   QTIYCRIIKSIMPGIPKKPAISAVTGFIAINMPNDFPAMFMKKSIIPPIIPFNIILIKI
FT                   LRGTTKSHPKR"
FT   regulatory      complement(53331..53335)
FT                   /locus_tag="TTE0045"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            53380..53541
FT                   /locus_tag="TTE0046"
FT   CDS_pept        53380..53541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDI0"
FT                   /protein_id="AAM23358.1"
FT                   /translation="MFQQMQQDMQRHVTMLTNRLNYLNSNNKLNQQSQPTQQATQQNQQ
FT                   NVLTNKKQ"
FT   regulatory      53547..53563
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            53858..55384
FT                   /locus_tag="TTEr01"
FT   rRNA            53858..55384
FT                   /locus_tag="TTEr01"
FT                   /product="16S ribosomal RNA"
FT   gene            55537..58465
FT                   /locus_tag="TTEr02"
FT   rRNA            55537..58465
FT                   /locus_tag="TTEr02"
FT                   /product="23S ribosomal RNA"
FT   gene            58469..58541
FT                   /locus_tag="TTEr03"
FT   rRNA            58469..58541
FT                   /locus_tag="TTEr03"
FT                   /product="5S ribosomal RNA"
FT   gene            58582..58656
FT                   /locus_tag="TTEt06"
FT   tRNA            58582..58656
FT                   /locus_tag="TTEt06"
FT                   /product="tRNA-Asn"
FT   gene            58782..58856
FT                   /locus_tag="TTEt07"
FT   tRNA            58782..58856
FT                   /locus_tag="TTEt07"
FT                   /product="tRNA-Gly"
FT   gene            58989..59736
FT                   /gene="FabG"
FT                   /locus_tag="TTE0051"
FT   regulatory      58989..58993
FT                   /gene="FabG"
FT                   /locus_tag="TTE0051"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58999..59736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FabG"
FT                   /locus_tag="TTE0051"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="Best Blastp hit = gi|10175111|dbj|BAB06210.1|
FT                   (AP001515) 3-oxoacyl-(acyl-carrier protein) reductase
FT                   [Bacillus halodurans], score 189, E-value 3.00E-47"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23359"
FT                   /db_xref="GOA:Q8RDH9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH9"
FT                   /protein_id="AAM23359.1"
FT                   /translation="MLTGKVAIVTGGAGDIGRRICIELAKEGASVAIHYNSSYEKAVEL
FT                   RDYIRENFSYAEIFQADISNRKQVDEMIDEIYRKFGRIDYLINNAGIAQIKPFVEITEE
FT                   DWDRMMNVNLKGLFNCTQSVLRYMLPKKQGSIINISSIWGISGASCEVHYSASKGGVIA
FT                   FTKALAKELGPSKIRVNCIAPGVIDTRMNNILNGEDKKHLIEEIPLMSIGKPEDVANAV
FT                   LFLLSDKANFITGQVITVDGGFI"
FT   misc_feature    59011..59568
FT                   /gene="FabG"
FT                   /locus_tag="TTE0051"
FT                   /note="Pfam match to entry adh_short, short chain
FT                   dehydrogenase, score 231.9, E-value 9.10E-66"
FT   misc_feature    59635..59718
FT                   /gene="FabG"
FT                   /locus_tag="TTE0051"
FT                   /note="Pfam match to entry adh_short_C2, Short chain
FT                   dehydrogenase/reductase C-terminus, score 45.2, E-value
FT                   3.60E-11"
FT   gene            complement(59729..60464)
FT                   /gene="RsuA"
FT                   /locus_tag="TTE0052"
FT   CDS_pept        complement(59729..60451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RsuA"
FT                   /locus_tag="TTE0052"
FT                   /product="16S rRNA uridine-516 pseudouridylate synthase and
FT                   related Pseudouridylate synthase"
FT                   /note="Best Blastp hit = gi|10175896|dbj|BAB06992.1|
FT                   (AP001518) 16S pseudouridylate synthase [Bacillus
FT                   halodurans], score 244, E-value 6.00E-64"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23360"
FT                   /db_xref="GOA:Q8R5V5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V5"
FT                   /protein_id="AAM23360.1"
FT                   /translation="MAKMRLDKLLSNMGIGTRKEVKKYIKDGLVEVNGEIVLDPSKTVD
FT                   TEKDEVLFDGEKVEYKEFIYVMMNKPQGVISATHDKSEETVIDLLPEEIALRKVFPVGR
FT                   LDKDTEGLLIITNDGELAHKLLSPKKKVVKKYYAEVLGKITEKDAEKFKEGVILEDGYR
FT                   TMPSQLEIIESSDISKVYVYLTEGKYHQVKRMFEAIGKKVLYLKRLCMGKLQLDENLEP
FT                   GEWRELTEEEVNLLKETI"
FT   misc_feature    complement(59858..60262)
FT                   /gene="RsuA"
FT                   /locus_tag="TTE0052"
FT                   /note="Pfam match to entry PseudoU_synth_2, RNA
FT                   pseudouridylate synthase, score 65.6, E-value 1.10E-15"
FT   misc_feature    complement(60305..60442)
FT                   /gene="RsuA"
FT                   /locus_tag="TTE0052"
FT                   /note="Pfam match to entry S4, S4 domain, score 42, E-value
FT                   1.40E-08"
FT   regulatory      complement(60460..60464)
FT                   /gene="RsuA"
FT                   /locus_tag="TTE0052"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            60645..61719
FT                   /gene="PurR"
FT                   /locus_tag="TTE0053"
FT   regulatory      60645..60649
FT                   /gene="PurR"
FT                   /locus_tag="TTE0053"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60661..61719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PurR"
FT                   /locus_tag="TTE0053"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|7442867|pir||F72282
FT                   'transcription regulator, LacI family - Thermotoga maritima
FT                   (strain MSB8)' gi|4981752|gb|AAD36275.1|AE001777_1
FT                   '(AE001777) transcriptional regulator, LacI family
FT                   [Thermotoga maritima]', score 163, E-value 3.00E-39"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23361"
FT                   /db_xref="GOA:Q8RDH8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH8"
FT                   /protein_id="AAM23361.1"
FT                   /translation="MRKRLSEVLSLTTTRRKRVTMKDIAEKLNLSINAVSLALNDKVGV
FT                   SEETRKLVIKTAEEMGYFEENPSFLSKSHLKNICLIIEERNFKDTNFYTKVIWGIENEA
FT                   KANGYDVLVNFMKKDLFEIPSCIENRKVSGILVVGTIKDEFLAEILSYNIPTVLVDHAS
FT                   FMFSTDAVLTQNIPGSYRGTKYLIEKGHKKIGFFGEKDFSLSFRERWLGFKEAMRDAGL
FT                   PVNEDYCVTEDVERHVLSKNYEEVANRLKKLKEFPTAWVCSNDSNAITLYNALNIMGIK
FT                   VPKDVSIVGFDDIDMCNIVTPPLTTIHINKELMGIKAVKRLLWRMDNPKEFHDHIRMEV
FT                   GFVERQSVRELL"
FT   misc_feature    60883..61698
FT                   /gene="PurR"
FT                   /locus_tag="TTE0053"
FT                   /note="Pfam match to entry Peripla_BP_like, Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family., score 32.7, E-value 2.00E-06"
FT   gene            61743..63606
FT                   /gene="OppA"
FT                   /locus_tag="TTE0054"
FT   regulatory      61743..61747
FT                   /gene="OppA"
FT                   /locus_tag="TTE0054"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61756..63606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppA"
FT                   /locus_tag="TTE0054"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, periplasmic components"
FT                   /note="Best Blastp hit = gi|11355777|pir||H82301 'peptide
FT                   ABC transporter, periplasmic peptide-binding protein VC0620
FT                   [imported] - Vibrio cholerae (group O1 strain N16961)'
FT                   gi|9655053|gb|AAF93786.1| '(AE004147) peptide ABC
FT                   transporter, periplasmic peptide-binding protein [Vibrio
FT                   cholerae]', score 116, E-value 7.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23362"
FT                   /db_xref="GOA:Q8RDH7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH7"
FT                   /protein_id="AAM23362.1"
FT                   /translation="MNSVLKKFIAIFVIVFFTAGIFAGCGQQTKPSQEATQETKPQETV
FT                   KTGEIRLATDWPFPFHGNPFGPGGVGGAWWFVYEPFAYYIPQTGEYIPRLAESWKVEGN
FT                   KVTVNLRKDAKFSDGEPFTSKDVVNTVNFIQAMWQWPYDIESVEAPDDHTVVFNLSKTS
FT                   SSSFVHTLLTDGAMASLAPVHVYKDFVDQAKEVADLGKKIFYLQTEGKPVPEDMKTEYE
FT                   KKSDEFRKKVNDFAPFKTLGKLPVVGSFEPVKVTQSEMEMKANKYHWASSQMKINRVIF
FT                   KKWSSNEFVWASLISNEIDAAHPSMPKDVVEQLSTLNPKLHVLTVSDLSDISLVFNFKK
FT                   PLFKDLNLRKAIAHILDRNKIRDVSVWQANSYENYADGILKSMESKWITQDTLQKLTKY
FT                   NTDTAAAEEILKNAGYKKVGDTWQQPNGQPVAFTLSVYGPHNDWVLAAREVVQELNSFG
FT                   FKVEMKLIPEGMRDQVMRSGDYDAAIEFGSAWWGYPHPLTGYQRLYDGDVSAITSFPAK
FT                   DKYNTPWGELSPYDLVLELQKNLQDENKAMEIIQQLAYITNEYLPVIPLYEKVLPIYYN
FT                   DGYRVTGWPSKEDPIWSLAPGGIERVYDLLITTGKLVPVK"
FT   misc_feature    62020..62145
FT                   /gene="OppA"
FT                   /locus_tag="TTE0054"
FT                   /note="Pfam match to entry SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   38.6, E-value 5.70E-10"
FT   gene            63615..64616
FT                   /gene="DppB"
FT                   /locus_tag="TTE0055"
FT   regulatory      63615..63619
FT                   /gene="DppB"
FT                   /locus_tag="TTE0055"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        63630..64616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppB"
FT                   /locus_tag="TTE0055"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|13815983|gb|AAK42786.1|
FT                   '(AE006861) ABC transporter, permease protein [Sulfolobus
FT                   solfataricus]', score 224, E-value 1.00E-57"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23363"
FT                   /db_xref="GOA:Q8RDH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH6"
FT                   /protein_id="AAM23363.1"
FT                   /translation="MNYFVNRLLYLLVVFVIAISGVFVLVNNMPGDPAYGLAVYIAQQR
FT                   NMQFEQALEIAHKMMGIDPHESVVTRYVKFMNNLLRGNFGYSTFYNTSVNEIIARALPW
FT                   TLFVISLATFISFSIGIYLGAFAAQKRGKTIDTLISTLASIIQAIPPFILAVLILFVFS
FT                   VRFRLLPLGGAYPVDMEPSLSISFIGKVLLHAVGPILAVAIPQMASWTLSMRGNTAQVM
FT                   EEDFIRFAEMRGLADSVIASKYIRNNAMLPLVASLAIGIGYMLGGQTLVESIFNYPGIG
FT                   FYFGKAIAVRDFGLLTGLFSLIVIGVIVATFVADFVYALIDPRVKLK"
FT   gene            64600..65494
FT                   /gene="DppC"
FT                   /locus_tag="TTE0056"
FT   regulatory      64600..64604
FT                   /gene="DppC"
FT                   /locus_tag="TTE0056"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64613..65494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppC"
FT                   /locus_tag="TTE0056"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|13815988|gb|AAK42788.1|
FT                   '(AE006862) ABC transporter, permease protein [Sulfolobus
FT                   solfataricus]', score 139, E-value 5.00E-32"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23364"
FT                   /db_xref="GOA:Q8RDH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH5"
FT                   /protein_id="AAM23364.1"
FT                   /translation="MRKESLKNFYYDYIQPLLVNKKSLIGLIILTFFILMATVGPLIVP
FT                   LDMTSNFAERYQKPSLKHPFGTDYFGVDIFQQIVHGSRSVISLTMLASFFAVLIGTVIG
FT                   VARGYLEGIVGRAIDAIIMVFLVIPSFPALLILAAVFMNYNLNVVEIALLVAVWLWAPL
FT                   AKQISAQVLSLKSKEFVEASKMLNMPLRYILFSDIAKLLIPYIFINFVMQIKGAMEFSV
FT                   GLMFLGLAKFDPTHWGIMLNYALYQAGALYTAKGFHYIFFIILNIVLLIYGGILLSQGV
FT                   EEVFNPRLRGNE"
FT   gene            65480..66475
FT                   /gene="DppD"
FT                   /locus_tag="TTE0057"
FT   regulatory      65480..65484
FT                   /gene="DppD"
FT                   /locus_tag="TTE0057"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        65495..66475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppD"
FT                   /locus_tag="TTE0057"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|7442566|pir||F75202 'dipeptide
FT                   abc transporter, dipeptide-binding protein PAB0094 -
FT                   Pyrococcus abyssi (strain Orsay)'
FT                   gi|5457578|emb|CAB49069.1| '(AJ248283) dipeptide ABC
FT                   transporter, dipeptide-binding protein [Pyrococcus
FT                   abyssi]', score 261, E-value 9.00E-69"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23365"
FT                   /db_xref="GOA:Q8RDH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4FWI"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH4"
FT                   /protein_id="AAM23365.1"
FT                   /translation="MSIIIRVEDLRAVYLVREGTIKAADGISLDILENSVTAIVGESAS
FT                   GKSTIIEAMTKTLPPNGRILSGRVLYKGKDLLTMREEELRKIRWKEIALVPQAAQQSLN
FT                   PTMKVIEHFKDTVEAHGVRWSHSELIEKASEKLRMVRLNPEAVLNSYPLQLSGGMKQRV
FT                   LIALALLLDPVVLILDEPTSALDVLTQAHIIQLLKELKKMLKITLIFVTHDIAVAAELA
FT                   DKVAVIYGGNLVEYNSTFQIFKNPLHPYTRGLINSIMAVNADMSKVKPIPGDPPSLLNP
FT                   PSGCRFHPRCEYAMEICKKEKPKWIRLDGEAHVACHLYEEGRPLK"
FT   misc_feature    65594..66187
FT                   /gene="DppD"
FT                   /locus_tag="TTE0057"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   178.6, E-value 1.00E-49"
FT   gene            66458..67452
FT                   /gene="OppF"
FT                   /locus_tag="TTE0058"
FT   regulatory      66458..66462
FT                   /gene="OppF"
FT                   /locus_tag="TTE0058"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66472..67452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppF"
FT                   /locus_tag="TTE0058"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|13815990|gb|AAK42790.1|
FT                   '(AE006862) ABC transporter, ATP binding protein
FT                   [Sulfolobus solfataricus]', score 245, E-value 5.00E-64"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23366"
FT                   /db_xref="GOA:Q8RDH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH3"
FT                   /protein_id="AAM23366.1"
FT                   /translation="MSKIIEIKDVSKVFSRGFFKKKHRVVLEDINLEISKGDRLVIVGE
FT                   SGMGKTTLARIMADLEKPSSGEVLWFGEDIHKIDKRRRKELRGKVQYVHQDPYASLHPA
FT                   KTIYKVIADPLANAQRVNGKTLYQRTKDLLEKIGLVPAEYFFNKYPHHLSGGGRQRLAI
FT                   ARALTTDPEVIIADEPISMIDMSLRAAIIKLFKDLNDLYGIAVVLVLHDIGAAKYFTFE
FT                   KGEIVVLYGGKIVEKGRGIRILENPAHPYTRVLINSSPIADPELARNRVLEQLRSYDVP
FT                   IRTKESKGCPFAHACNYYTEKCKEEVPPLVTIEEGHQVACHVFGK"
FT   misc_feature    66580..67167
FT                   /gene="OppF"
FT                   /locus_tag="TTE0058"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   162.5, E-value 7.00E-45"
FT   gene            67453..67638
FT                   /locus_tag="TTE0059"
FT   regulatory      67453..67457
FT                   /locus_tag="TTE0059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67465..67638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23367"
FT                   /db_xref="GOA:Q8RDH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH2"
FT                   /protein_id="AAM23367.1"
FT                   /translation="MNEKLAFSISILVVFLSVLWMVAFRKSGGEFLLVLASVFFSLLTV
FT                   LMIMANKYKKKR"
FT   gene            67638..69565
FT                   /locus_tag="TTE0061"
FT   regulatory      67638..67642
FT                   /locus_tag="TTE0061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67652..69565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|6002242|emb|CAB56687.1|
FT                   (AL121596) hypothetical protein SCF51A.35 [Streptomyces
FT                   coelicolor A3(2)], score 232, E-value 1.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23368"
FT                   /db_xref="GOA:Q8RDH1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH1"
FT                   /protein_id="AAM23368.1"
FT                   /translation="MNRKSNGGDEMDIFKRTFILGANYWPRNHGIEMWKEWNYEEIKKE
FT                   FIEAKNLGLNVMRINLFWEDFQPQPDVISEEAIQKFDELIKICNEVDMRIAPTFFVGHM
FT                   SGENWDVPWREGKNIYSDSYMLRYQLKLVRFFAERYKDQDAILFWDLSNEPDNYVKANS
FT                   RHDAWLWNYVLSNEIKKYDKKHPVTLGIHQASLLTNNNFYPEDMAEGNDFLCMHFYPIY
FT                   TDVCLDPVNSTRSTYMAPFSVKLTKGMGKKDVLMEEFGATTLMMGEEVEGDYYRVVLYS
FT                   LLANGSIGAIAWCFGDFSVGKRLPYNSTPFETQFGITTVEGRPKKAALEMKAFSEFLRE
FT                   VEYEKLRPKESDAAIIIPDKYYEALFVGKDYTPERNFRILLNSFILAKQAGLDVDLIRP
FT                   EDDFKKYKLLIVPSAYRKGHLTYSQWLKVMEFVKEGGTLYLSYDGIAIEGFEEVFGVKI
FT                   EYFMVPREENVEIESEILPARLEFKALPSNKRLILKPIKGETIAKDKEGNPSIIVNQYG
FT                   KGRAILVTYPIELYLSYMPDVYKSNESFKIYQLAKRLAGIVYEVEVDSPYVEVKEFNFE
FT                   NRKLILLINHENEEVRIGVKLKDKGRFNEKIEDLVNKREINPENFAIAPNGVVAFWLKK
FT                   GV"
FT   gene            69555..70477
FT                   /locus_tag="TTE0062"
FT   regulatory      69555..69559
FT                   /locus_tag="TTE0062"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69569..70477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0062"
FT                   /product="predicted glycosylase"
FT                   /note="Best Blastp hit = gi|7462224|pir||E72203 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982436|gb|AAD36914.1|AE001822_7 (AE001822) conserved
FT                   hypothetical protein [Thermotoga maritima], score 265,
FT                   E-value 6.00E-70"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23369"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDH0"
FT                   /protein_id="AAM23369.1"
FT                   /translation="MFRLERLRDKPILSPIEEHEWERAAVFNAAAIYEDGKVHLFYRAS
FT                   NNKFVLNIEKPQEENKFVSSIGYAVSEDGINFQRFDKPILVGETPQEAWGVEDPRITKL
FT                   EGKYYMLYTGFGGRDWLDFRICMVWSEDLKSWEGHRIVLDEPNKDAALLSEKINGKYVL
FT                   FHRRMPDIWIAYSEDLVNWHDHKIIMSPRKGWWDSKKIGIAGPPLKMEDGWLLIYHGVD
FT                   ENNVYRLGAALLDLKDPSKVIARQEEPILEPELPWEKEGLVPNVVFSCGAVEIDGVFYV
FT                   YYGAADTCIGVAAVEKQKVKF"
FT   gene            70480..71413
FT                   /locus_tag="TTE0063"
FT   regulatory      70480..70484
FT                   /locus_tag="TTE0063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70493..71413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0063"
FT                   /product="predicted glycosylase"
FT                   /note="Best Blastp hit = gi|7462224|pir||E72203 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982436|gb|AAD36914.1|AE001822_7 (AE001822) conserved
FT                   hypothetical protein [Thermotoga maritima], score 298,
FT                   E-value 8.00E-80"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23370"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG9"
FT                   /protein_id="AAM23370.1"
FT                   /translation="MIKLRRLSDKPVLVPKPENEWERAAVFNTAAIYDNGLFHLIYRAT
FT                   DLGPHIKYGRYISRLGYAVSKDGINFMRLDKPIMTNETEQELRGLEDPRIVKIDGIYYM
FT                   MYTAFGDRFKDDYRICLATSKNLIDWERKGVVLDEPNKDASLFPEKINGKYVMLHRRYP
FT                   DIWIAFSEDLKNWYGHKPIIKPIPGTWESARVGIGGPPIKTEKGWFLIYHAADDNNVYR
FT                   LGAALLDLEDPTKVIARQKEPILEPELPWEKEGYIPNVVFSCGNAVKDDTIYVYYGGAD
FT                   TVIGVAVLNMEDIKFDTRQITLLTL"
FT   gene            71500..72374
FT                   /gene="FocA"
FT                   /locus_tag="TTE0064"
FT   regulatory      71500..71504
FT                   /gene="FocA"
FT                   /locus_tag="TTE0064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71511..72374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FocA"
FT                   /locus_tag="TTE0064"
FT                   /product="Formate/nitrite family of transporters"
FT                   /note="Best Blastp hit = gi|3023753|sp|Q50568|FDHC_METTF
FT                   POTENTIAL FORMATE TRANSPORTER gi|1279769|gb|AAC44819.1|
FT                   (U52681) FdhC [Methanothermobacter thermautotrophicus],
FT                   score 231, E-value 1.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23371"
FT                   /db_xref="GOA:Q8RDG8"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG8"
FT                   /protein_id="AAM23371.1"
FT                   /translation="MGFKMPKDITEGMSSLGKAKSELSISKLLVLGFLGGAYIALGGLL
FT                   AIRAAGALPDSFGSLQKFIFGAVFPLGLILVVIAGAELVTGNMMTQPMAYFDRKIDLKG
FT                   LLKNWTFVYIGNFIGSVFVAYFLAYKTGLIMEVAKMGEIPKALPWALYAVKIANAKVSL
FT                   SWWQAFLRGIGCNWLVALAVWMAYSAEDIIGKIFAIWWPIMGFVAIGFEHSVANMFFIP
FT                   LGIYAGQDPLYVNFAKSAEGILLNVPILKATWENFIVNNLIPVTLGNIVGAGFFVATIY
FT                   WYVYRK"
FT   misc_feature    71514..72368
FT                   /gene="FocA"
FT                   /locus_tag="TTE0064"
FT                   /note="Pfam match to entry Form_Nir_trans, Formate/nitrite
FT                   transporter, score 264, E-value 2.00E-75"
FT   gene            72576..73638
FT                   /gene="Gcd1"
FT                   /locus_tag="TTE0065"
FT   regulatory      72576..72580
FT                   /gene="Gcd1"
FT                   /locus_tag="TTE0065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72589..73638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Gcd1"
FT                   /locus_tag="TTE0065"
FT                   /product="nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /note="involved in lipopolysaccharide biosynthesis;
FT                   translation initiation factor eIF2B subunit; Best Blastp
FT                   hit = gi|7451544|pir||A70363 mannose-1-phosphate
FT                   guanyltransferase - Aquifex aeolicus
FT                   gi|2983302|gb|AAC06893.1| (AE000704) mannose-1-phosphate
FT                   guanyltransferase [Aquifex aeolicus], score 214, E-value
FT                   2.00E-54"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23372"
FT                   /db_xref="GOA:Q8RDG7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG7"
FT                   /protein_id="AAM23372.1"
FT                   /translation="MKALLLAGGLGTRLRPLTDDLPKPMVPIMGKPLLERIILNLKKSG
FT                   VDEVVISTHYKSDYIENYFKGKSKELGVKIHYVTEETPLGTGGAIKNAEKFFDDTFLIL
FT                   NSDIVSDIDYADLVKYHKRRRAQVTIASIEVRDTSQYGVIEFDSKGFITAFKEKPKPGE
FT                   SNSKYINAGVYVFEPEVLKEIPANTQVSVERETYPLLLSKGYKMAIYKFTGYWMDIGTV
FT                   DKYKKVHEDILKGKSRFVAGLSTRGIILGENVKIHPTASVIGPAYIGDNTEVDAYATVG
FT                   PYTVIGSNCRIGQESKVSNSVLWDNIKVRRFARLENSVVTSECVVEVNMEIKNTVFTAN
FT                   KLADITLTP"
FT   misc_feature    72592..73293
FT                   /gene="Gcd1"
FT                   /locus_tag="TTE0065"
FT                   /note="Pfam match to entry NTP_transferase, Nucleotidyl
FT                   transferase, score 204.6, E-value 1.50E-57"
FT   gene            73650..74835
FT                   /gene="RfaG"
FT                   /locus_tag="TTE0066"
FT   regulatory      73650..73654
FT                   /gene="RfaG"
FT                   /locus_tag="TTE0066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        73663..74835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG"
FT                   /locus_tag="TTE0066"
FT                   /product="predicted glycosyltransferases"
FT                   /note="Best Blastp hit = gi|7517371|pir||B70393
FT                   hypothetical protein aq_1080 - Aquifex aeolicus
FT                   gi|2983565|gb|AAC07138.1| (AE000722) putative protein
FT                   [Aquifex aeolicus], score 98.6, E-value 1.00E-19"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23373"
FT                   /db_xref="GOA:Q8RDG6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG6"
FT                   /protein_id="AAM23373.1"
FT                   /translation="MSILGRNIAFLSTYPPRECGIATFTQDLVNEIKKIKLINFAGVIA
FT                   INDHKRYDYDEDVIYEINQFEREDYLKLAEKLNESNVDLLIIEHEYGIFGGESGEYLLD
FT                   LVDNLSIPFAVTVHTVLLNPNEKQLKILKELGQKSARVITMAKNTIPLLEKIYEIPSHK
FT                   ITFIPHGVPTLPVLPKETLKERYGFKGRRIISTFGLINPGKGIEYGIEAISMVAKKYKD
FT                   VLYLILGQTHPNIKRLYGEEYREKLQKMVKDLGVEDNVRFVDKYLTKREILEYLKMSDI
FT                   YMTPYLNKEQAVSGTLAYAAGLGKIIISTPYMYAEEILGNGRGLLADFRSAKSLAEKIE
FT                   YVFEHPEARARMESEMKKLGSTMTWNNVAYRYVIMILSVLDVKSREEVVI"
FT   misc_feature    74194..74739
FT                   /gene="RfaG"
FT                   /locus_tag="TTE0066"
FT                   /note="Pfam match to entry Glycos_transf_1, Glycosyl
FT                   transferases group 1, score 61.9, E-value 5.50E-16"
FT   gene            74836..75899
FT                   /locus_tag="TTE0067"
FT   regulatory      74836..74840
FT                   /locus_tag="TTE0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74850..75899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23374"
FT                   /db_xref="GOA:Q8RDG5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG5"
FT                   /protein_id="AAM23374.1"
FT                   /translation="MRVATKYAHLFTLTDDTGIFQHSLYSIPDPSKGYTTDDNARAAIA
FT                   ATMLYQVYREEVYLSLLRRYLSFLIYAQNEEGFFRNFMNYNREFTEKKGSEDCFGRSLW
FT                   ALGYLLNVPFSDESYHNVAIRLLEKALFNVKKLYSLRGKAYSLIGLSLIYNSEAFEFDR
FT                   GEIRDLVKSLSQDLLKSYYKNREENWKWFEDQMTYSNAILPWSLLKAYTVTKDEEVLRV
FT                   AKESMDFLGSVTFKDGYFKPIGCKGWYKKGGKRAEFDEQPIEACESALMYIEAYRVFGE
FT                   EEYLNKAKKCYRWFLGENSQNISLVDEETGGCYDGITEDGVNLNEGAESLISLIMTDMV
FT                   VNHSSKVFK"
FT   gene            75943..76955
FT                   /gene="DdlA"
FT                   /locus_tag="TTE0068"
FT   regulatory      75943..75947
FT                   /gene="DdlA"
FT                   /locus_tag="TTE0068"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75957..76955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DdlA"
FT                   /locus_tag="TTE0068"
FT                   /product="D-alanine-D-alanine ligase and related ATP-grasp
FT                   enzymes"
FT                   /note="Best Blastp hit = gi|2494029|sp|P55650|Y4SG_RHISN
FT                   HYPOTHETICAL 37.0 KD PROTEIN Y4SG gi|2182621|gb|AAB91846.1|
FT                   (AE000096) Y4sG [Rhizobium sp. NGR234], score 117, E-value
FT                   2.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23375"
FT                   /db_xref="GOA:Q8RDG4"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG4"
FT                   /protein_id="AAM23375.1"
FT                   /translation="MKVGVFWRRFRNVELQRRLTPDKVYDDAYDEAYHHYEALKEAGFD
FT                   AVLIEWKDDPIKTYEVIQKEEVDIIFNASSLKEIEFLELFNIPYVGSGIDLAATDKRMR
FT                   KDIVAAHGLPTPKYVVAYSANEIPSVDHLRFPLFVKPIMGRGSAGIDEENIVYDKSRLP
FT                   KVVSKITEKIGQPALIEEFIEGREVTVGIIGYRNPIVLPLLEIGYNNVKTNTYEHKMFD
FT                   NEIIKCPMEVPEEIEKRIKDTALRIFKVLNARDYARIDMILGKDNVPYFLELNTYAGLT
FT                   TAVERGEKHVHHGYMGYMAKAAGMTRKEFIGKILESALERYGFEDKELLLA"
FT   misc_feature    76488..76784
FT                   /gene="DdlA"
FT                   /locus_tag="TTE0068"
FT                   /note="Pfam match to entry Dala_Dala_ligas, D-ala D-ala
FT                   ligase, score 72.5, E-value 6.10E-19"
FT   gene            77031..77811
FT                   /gene="FabG2"
FT                   /locus_tag="TTE0069"
FT   regulatory      77031..77035
FT                   /gene="FabG2"
FT                   /locus_tag="TTE0069"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77044..77811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FabG2"
FT                   /locus_tag="TTE0069"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /note="Best Blastp hit = gi|6226611|sp|Q56318|Y019_THEMA
FT                   PUTATIVE OXIDOREDUCTASE TM0019 gi|7431046|pir||E72427
FT                   'oxidoreductase, short chain dehydrogenase/reductase family
FT                   - Thermotoga maritima (strain MSB8)'
FT                   gi|4980503|gb|AAD35113.1|AE001690_7 '(AE001690)
FT                   oxidoreductase, short chain dehydrogenase/reductase family
FT                   [Thermotoga maritima]', score 305, E-value 3.00E-82"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23376"
FT                   /db_xref="GOA:Q8RDG3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG3"
FT                   /protein_id="AAM23376.1"
FT                   /translation="MNFKDKVVIVTGGGQGIGRCIAQTFASKGAKVVIAEIDDEAGLEN
FT                   EEYIRKNGGEALFVHTDVALEEDVKNMVNKTIETYGKIDILINNAGIGSGGTIYTRPME
FT                   EWDRVINVNLKGAYMCAKYVAPHMRDNGGGVIINIASTRAFMSEPHTEPYSASKGGLIA
FT                   LTHSLAISLAYDKIRVNSISPGWIEVSEWKKSREAKKPELTEQDHLQHPAGRVGKPEDV
FT                   ANACLFLCSEEASFITGANLIVDGGMTVKMIYL"
FT   misc_feature    77059..77613
FT                   /gene="FabG2"
FT                   /locus_tag="TTE0069"
FT                   /note="Pfam match to entry adh_short, short chain
FT                   dehydrogenase, score 252, E-value 8.20E-72"
FT   gene            77812..78402
FT                   /gene="AcrR"
FT                   /locus_tag="TTE0070"
FT   regulatory      77812..77816
FT                   /gene="AcrR"
FT                   /locus_tag="TTE0070"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77827..78402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcrR"
FT                   /locus_tag="TTE0070"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|481591|pir||S38906 hypothetical
FT                   protein 4 - Clostridium pasteurianum
FT                   gi|431950|emb|CAA82211.1| (Z28353) similar to a B.subtilis
FT                   gene (GB: BACHEMEHY_5) [Clostridium pasteurianum], score
FT                   133, E-value 2.00E-30"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23377"
FT                   /db_xref="GOA:Q8RDG2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG2"
FT                   /protein_id="AAM23377.1"
FT                   /translation="MSSTKERIFKAALETFSKRGFYKATMDEIAEAAGVAKGTLYYHFK
FT                   SKDDILDFLIDEGIKRLKQQAIEEISKVNGAIEKLKRIVFVQTNFLYKNHDFIIVLLSQ
FT                   IWGHGDVPRRFREKLSTYLEIIEKVVKEGKEQKLLADCNEKLVAAAFFGMTTSILALKV
FT                   IREEETVDTQEITDTVFNFALNGLKFYH"
FT   misc_feature    77848..77988
FT                   /gene="AcrR"
FT                   /locus_tag="TTE0070"
FT                   /note="Pfam match to entry tetR, Bacterial regulatory
FT                   proteins, tetR family, score 75.8, E-value 8.80E-19"
FT   regulatory      78403..78418
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   repeat_region   78635..80226
FT                   /note="TLR014, identity:100%, copy 1"
FT   gene            78637..80086
FT                   /locus_tag="TTE0071"
FT   regulatory      78637..78641
FT                   /locus_tag="TTE0071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78650..80086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23378"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG1"
FT                   /protein_id="AAM23378.1"
FT                   /translation="MIVIQAKLIFLNQQDKQIVLDLMRRWSSCMRFAYKRLLEGYDRKT
FT                   LKRDLQGTFDLNSRYVDDAIMKARSTLESARQLDNNPKKVIFGGRDLFGKLQKRHINGK
FT                   AYEKLKIRWQEKRKGNLYSRGDKSKKGNLNTRIEVKENGTFLRINVGERKYVYAKIQAG
FT                   WKKNKNREGILQEIAKSNIPYSVELKLKNGSIYAYFAIEEEYPEVKITKEKGVIGIDTN
FT                   AYPENISWVEVDEKGNLISYGNIPMPELASGSKDKKEYFRWHYAHEIVKIAKEKGKAIV
FT                   IEGLEIKEKGKRGDFSGRKSRRIRHSFSYKSLLSKIKTLAKREGIEVIEVDPSYTSIIG
FT                   MLKYAPQYMITKDIAAAYVIARRGLGKEEKIPDNYIKFLHALTVEELEELKEYVKNTVK
FT                   NKYLKKRHLKEINRAIKFLQSLESEPGRVLEPLDGTSFSTYDFWQVLKVAVVTPLSPEK
FT                   VPRDFSALKKLLIQGKWGDS"
FT   gene            80224..80458
FT                   /locus_tag="TTE0072"
FT   regulatory      80224..80228
FT                   /locus_tag="TTE0072"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        80237..80458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0072"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gi|7482772|pir||E69115 phage
FT                   infection protein homolog - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)
FT                   gi|2622994|gb|AAB86324.1| (AE000938) phage infection
FT                   protein homolog [Methanothermobacter thermautotrophicus],
FT                   score 50.8, E-value 2.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23379"
FT                   /db_xref="GOA:Q8RDG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDG0"
FT                   /protein_id="AAM23379.1"
FT                   /translation="MELLPKFFNVINPYLPMTYGVAGLREAISGDNISLILHNISIIAG
FT                   FGALFLLFTILLAERVDKIEIVQKLRQM"
FT   regulatory      80468..80504
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(80515..81434)
FT                   /gene="MesJ"
FT                   /locus_tag="TTE0073"
FT   CDS_pept        complement(80515..81420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MesJ"
FT                   /locus_tag="TTE0073"
FT                   /product="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /note="Best Blastp hit = gi|7445409|pir||D75016
FT                   hypothetical protein PAB1092 - Pyrococcus abyssi (strain
FT                   Orsay) gi|5459084|emb|CAB50570.1| (AJ248288) hypothetical
FT                   protein [Pyrococcus abyssi], score 246, E-value 2.00E-64"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23380"
FT                   /db_xref="GOA:Q8RDF9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF9"
FT                   /protein_id="AAM23380.1"
FT                   /translation="MKCTVCGKPAIVKFPAHNSAFCEEHLDAFFLRQVSKTIEKYKMLP
FT                   PKGRVVVAISGGKDSLVTAYVLKRLGYEVLGFFVDLGITQNDFSPRSREVVENFCKEHD
FT                   IPLEIVDLKERYGKDIPEVAKRQDRICAICGVTKRHLMNEYALSVNADALATGHTLDDM
FT                   AKLLLANLMRWDLHHLAKGVPTLPAEPGFAKKIKPLAFQSEDEIIAFAKLHNIKPVEAK
FT                   CPYGREAKYNRYQEALDMLEEKSPGIKRSFYKNYTKYAYLFEGTQARPPKVNCEVCGFP
FT                   SVSPVCTFCRTWVVDNEKKK"
FT   misc_feature    complement(80518..81420)
FT                   /gene="MesJ"
FT                   /locus_tag="TTE0073"
FT                   /note="Pfam match to entry UPF0021, Uncharacterized protein
FT                   family UPF0021, score 237.5, E-value 1.90E-67"
FT   gene            81332..81513
FT                   /locus_tag="TTE0074"
FT   regulatory      81332..81336
FT                   /locus_tag="TTE0074"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81346..81513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23381"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF8"
FT                   /protein_id="AAM23381.1"
FT                   /translation="MLFAESRVMGWEFDDGGFPAYCALQFKNLLSFIYEHFLKDYAINH
FT                   YKRFSKKLQN"
FT   regulatory      complement(81430..81434)
FT                   /gene="MesJ"
FT                   /locus_tag="TTE0073"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            81566..82421
FT                   /gene="TtdA"
FT                   /locus_tag="TTE0075"
FT   regulatory      81566..81570
FT                   /gene="TtdA"
FT                   /locus_tag="TTE0075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81579..82421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TtdA"
FT                   /locus_tag="TTE0075"
FT                   /product="Tartrate dehydratase alpha subunit/Fumarate
FT                   hydratase class I, N-terminal domain protein"
FT                   /note="Best Blastp hit = gi|7437046|pir||D70453 fumarate
FT                   hydratase (fumarase) - Aquifex aeolicus
FT                   gi|2984079|gb|AAC07618.1| (AE000756) fumarate hydratase
FT                   (fumarase) [Aquifex aeolicus], score 291, E-value 9.00E-78"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23382"
FT                   /db_xref="GOA:Q8R5V4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V4"
FT                   /protein_id="AAM23382.1"
FT                   /translation="MREIKASQIVEVVKKLCIEANYNLPDDILKGLKIRKKEEKSPLGQ
FT                   KILEDIILNAEIAMQEKMAICQDTGMAVVFVEIGQEVRVVDGDLEEAINEGVRLGYKEG
FT                   YLRKSVVKSPIERINTDDNTPAIIHYRVCRGDRLIITVMPKGAGSENMSALKMLKPSDD
FT                   LEGVKRFVIETVEKSGPNACPPLIVGVGLGGDFEYAAYLAKKALLRKVGERHQDILIAR
FT                   LEEELLNEINSLGIGPMGLGGTTTALDVHIEVYPTHIASLPVAVNLGCHATRHATFVL"
FT   gene            82429..82992
FT                   /gene="FumA"
FT                   /locus_tag="TTE0076"
FT   regulatory      82429..82433
FT                   /gene="FumA"
FT                   /locus_tag="TTE0076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82441..82992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FumA"
FT                   /locus_tag="TTE0076"
FT                   /product="Tartrate dehydratase beta subunit/Fumarate
FT                   hydratase class I, C-terminal domain protein"
FT                   /note="Best Blastp hit = gi|7437056|pir||E70445 'C-terminal
FT                   fumarate hydratase, class I - Aquifex aeolicus'
FT                   gi|2984001|gb|AAC07546.1| '(AE000750) C-terminal fumarate
FT                   hydratase, class I [Aquifex aeolicus]', score 227, E-value
FT                   7.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23383"
FT                   /db_xref="GOA:Q8R5V3"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V3"
FT                   /protein_id="AAM23383.1"
FT                   /translation="MYRKLNTPLLDEVTVQLKAGDLILLSGEIYTARDEAHKRMVEALD
FT                   RGEMLPFEIKNSIIYYVGPCPPRPGQVVGSCGPTTSGRMDKYAPRLIELGLKGMIGKGA
FT                   RSEEVVEFMKKHKAVYFTAVGGAGALLAQRVKKVEVVAYEDLGPEAIYKFTVEDFPLIV
FT                   TIDCYGNNLYEIEREKYRKR"
FT   gene            82987..83558
FT                   /locus_tag="TTE0077"
FT   regulatory      82987..82991
FT                   /locus_tag="TTE0077"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82998..83558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0077"
FT                   /product="Uracil-DNA glycosylase"
FT                   /note="Best Blastp hit = gi|7451743|pir||E70446 N-terminus
FT                   of phage SPO1 DNA polymerase - Aquifex aeolicus
FT                   gi|2984015|gb|AAC07559.1| (AE000751) N-terminus of phage
FT                   SPO1 DNA polymerase [Aquifex aeolicus], score 199, E-value
FT                   2.00E-50"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23384"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF7"
FT                   /protein_id="AAM23384.1"
FT                   /translation="MALLPLKELYLACLHCTKCDLHKTKTNMVFGEGNLRAKVMFVGEG
FT                   PGRDEDLQGRPFVGRAGQLLNKMLEDVGLKREEVYIANVVKCRPPNNRVPLQSEIDACL
FT                   PYLRNQVAIIAPKIIVCLGATAAKAIIDKDFKITTMRGQWFERKGVKIIATYHPAAILR
FT                   DPEKLQPAMEDFKKIKEELDKLV"
FT   gene            83821..85348
FT                   /locus_tag="TTEr04"
FT   rRNA            83821..85348
FT                   /locus_tag="TTEr04"
FT                   /product="16S ribosomal RNA"
FT   gene            85501..88428
FT                   /locus_tag="TTEr05"
FT   rRNA            85501..88428
FT                   /locus_tag="TTEr05"
FT                   /product="23S ribosomal RNA"
FT   gene            88432..88504
FT                   /locus_tag="TTEr06"
FT   rRNA            88432..88504
FT                   /locus_tag="TTEr06"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(88583..88814)
FT                   /gene="SirA"
FT                   /locus_tag="TTE0081"
FT   CDS_pept        complement(88583..88801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SirA"
FT                   /locus_tag="TTE0081"
FT                   /product="predicted Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|2842585|sp|Q58397|Y990_METJA
FT                   HYPOTHETICAL PROTEIN MJ0990 gi|2128042|pir||F64423
FT                   hypothetical protein homolog MJ0990 - Methanococcus
FT                   jannaschii gi|1591652|gb|AAB98992.1| (U67541) conserved
FT                   hypothetical protein [Methanococcus jannaschii], score 52,
FT                   E-value 1.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23385"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V2"
FT                   /protein_id="AAM23385.1"
FT                   /translation="MVHEIMCMGEICPLPLLKAKKKYEEMKEGEILKVVVDHRCTLDNL
FT                   ETYFSKLNCSMEVKEVLKGVWEVYIKK"
FT   regulatory      complement(88810..88814)
FT                   /gene="SirA"
FT                   /locus_tag="TTE0081"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(88813..89719)
FT                   /gene="LysR"
FT                   /locus_tag="TTE0082"
FT   CDS_pept        complement(88813..89706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LysR"
FT                   /locus_tag="TTE0082"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|11467486|ref|NP_043632.1|
FT                   former trsE (rbcR homolog) [Odontella sinensis]
FT                   gi|1351752|sp|P49518|YC30_ODOSI HYPOTHETICAL
FT                   TRANSCRIPTIONAL REGULATOR YCF30 gi|7446758|pir||S78291
FT                   probable transcription regulator ycf30 - Odontella sinensis
FT                   chloroplast gi|1185181|emb|CAA91664.1| (Z67753) former trsE
FT                   (rbcR homolog) [Odontella sinensis], score 140, E-value
FT                   2.00E-32"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23386"
FT                   /db_xref="GOA:Q8RDF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF6"
FT                   /protein_id="AAM23386.1"
FT                   /translation="MNIENLRAFYKTVYYKSISSAARELYLSQPAISQQIKALEKDLKA
FT                   TLLKRTNRGVFPTPAGELVYQYAERILNLYDNMVKDLECCQNNCINRLTISACPTIGQY
FT                   ALPCTLHEFKRRYKNITVHVEHNFTPEVIYNVKEGGIDIGFIEGCYVDENISCIPLGDF
FT                   KMHFVASGNWEEKSLSKNKLLRYNFFIIHRKCALRKIIEETLLAHEIDIKKLKIEMEFP
FT                   SIESIKSSVAAGHGLSILPYIAIKKELYTKTLSIVEVEGIEFNYSYSLIYNKKIYKKSK
FT                   MDFIDFIKNNGKDFFC"
FT   misc_feature    complement(89272..89700)
FT                   /gene="LysR"
FT                   /locus_tag="TTE0082"
FT                   /note="Pfam match to entry HTH_1, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 131.5, E-value
FT                   1.50E-35"
FT   regulatory      complement(89715..89719)
FT                   /gene="LysR"
FT                   /locus_tag="TTE0082"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            89873..90129
FT                   /gene="SirA2"
FT                   /locus_tag="TTE0083"
FT   regulatory      89873..89877
FT                   /gene="SirA2"
FT                   /locus_tag="TTE0083"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89887..90129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SirA2"
FT                   /locus_tag="TTE0083"
FT                   /product="predicted Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|13124657|sp|Q9X078|Y983_THEMA
FT                   HYPOTHETICAL PROTEIN TM0983 gi|7449744|pir||D72310
FT                   conserved hypothetical protein - Thermotoga maritima
FT                   (strain MSB8) gi|4981522|gb|AAD36062.1|AE001760_12
FT                   (AE001760) conserved hypothetical protein [Thermotoga
FT                   maritima], score 80.9, E-value 2.00E-15"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23387"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V1"
FT                   /protein_id="AAM23387.1"
FT                   /translation="MSNDVKPTYTLDERGEVCPVPDVDTRRKLKEMKSGEILEVLVDYA
FT                   LSKERIPAGVKEVGGEVISIEEIGPSEWRILIKKL"
FT   misc_feature    89899..90123
FT                   /gene="SirA2"
FT                   /locus_tag="TTE0083"
FT                   /note="Pfam match to entry UPF0033, Uncharacterized protein
FT                   family UPF0033, score 73.5, E-value 4.40E-18"
FT   gene            90137..91166
FT                   /locus_tag="TTE0084"
FT   regulatory      90137..90141
FT                   /locus_tag="TTE0084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        90150..91166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0084"
FT                   /product="predicted transporter components"
FT                   /note="Best Blastp hit = gi|7462169|pir||C72310 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981521|gb|AAD36061.1|AE001760_11 (AE001760) conserved
FT                   hypothetical protein [Thermotoga maritima], score 311,
FT                   E-value 8.00E-84"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23388"
FT                   /db_xref="GOA:Q8RDF5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF5"
FT                   /protein_id="AAM23388.1"
FT                   /translation="MDPRLQGLLVGILFGIVLQRGRICFNSAIRDVKMTKDNYLMKLAL
FT                   LAILVETIGFHLAAQLGWIKLNPKPLIPLAQIIGGFLFGMGMVLAGGCASGVTYRIGEG
FT                   YITAFIAAIFYGITAAAVKGGPLSFVNRWMGKPITTTNNPGGFYAAKDGAVNLTLANLL
FT                   NINPWIVTIIFALLLLIVLVFWKTTERKVSGLNWITGGIALGLVGVIAYLSQKTYPLGI
FT                   TGGWVNLFRTTTANLDLTQPIPYNWEGMEIVGIIIGAYLAALFAKEFRLRVPKDPKTFV
FT                   QVAVGGILMGFGAGSAGGCNIGHILSGLPHLAISSIVFTIFAVLGNWFMVWYLFERK"
FT   gene            91205..91573
FT                   /gene="DsrE"
FT                   /locus_tag="TTE0085"
FT   regulatory      91205..91209
FT                   /gene="DsrE"
FT                   /locus_tag="TTE0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91220..91573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DsrE"
FT                   /locus_tag="TTE0085"
FT                   /product="uncharacterized ACR involved in intracellular
FT                   sulfur reduction"
FT                   /note="Best Blastp hit = gi|7445026|pir||B72310 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981520|gb|AAD36060.1|AE001760_10 (AE001760) conserved
FT                   hypothetical protein [Thermotoga maritima], score 150,
FT                   E-value 7.00E-36"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23389"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF4"
FT                   /protein_id="AAM23389.1"
FT                   /translation="MHVTIQVNVPPYTNEDMDTAIHLAEALLKRGHKVSIFLFADSVLA
FT                   ANKLVKPMKVDRNIPSKLRELSEKGVEVHICGLCAQYRGIGEDMKIEGSDFSGVPEMAS
FT                   LIYNSDRYINLLP"
FT   misc_feature    91220..91564
FT                   /gene="DsrE"
FT                   /locus_tag="TTE0085"
FT                   /note="Pfam match to entry DrsE, DsrE-like protein, score
FT                   78.1, E-value 1.90E-19"
FT   gene            91572..91945
FT                   /locus_tag="TTE0086"
FT   regulatory      91572..91576
FT                   /locus_tag="TTE0086"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91586..91945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7452094|pir||A72310
FT                   hypothetical protein TM0980 - Thermotoga maritima (strain
FT                   MSB8) gi|4981519|gb|AAD36059.1|AE001760_9 (AE001760)
FT                   hypothetical protein [Thermotoga maritima], score 116,
FT                   E-value 1.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23390"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF3"
FT                   /protein_id="AAM23390.1"
FT                   /translation="MKKVLFAVYTSPVGSIWINEAFRSAFGMYGEDLEPAVLFVEEAVL
FT                   AVRSSCKPELIGCLPLAMTFKYIEKYQTPVYAVKEDLDKFNIKEDEIAPQWNLKTVSKD
FT                   ELPEFVHSFDKVVIF"
FT   gene            91944..92235
FT                   /gene="DsrH"
FT                   /locus_tag="TTE0087"
FT   regulatory      91944..91948
FT                   /gene="DsrH"
FT                   /locus_tag="TTE0087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91957..92235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DsrH"
FT                   /locus_tag="TTE0087"
FT                   /product="uncharacterized ACR involved in oxidation of
FT                   intracellular sulfur"
FT                   /note="Best Blastp hit = gi|7462345|pir||H72309 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981518|gb|AAD36058.1|AE001760_8 (AE001760) conserved
FT                   hypothetical protein [Thermotoga maritima], score 64.7,
FT                   E-value 2.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23391"
FT                   /db_xref="GOA:Q8RDF2"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF2"
FT                   /protein_id="AAM23391.1"
FT                   /translation="MALIIVKKSPSEKISEFLLNLALPQDKVLFVQDGVIFAACKNVKN
FT                   LVKEGVELFALKEDFIARGFDEKDSEVTLVDYDGWAELIEKEEKVIS"
FT   gene            92252..93651
FT                   /gene="Lpd"
FT                   /locus_tag="TTE0088"
FT   regulatory      92252..92256
FT                   /gene="Lpd"
FT                   /locus_tag="TTE0088"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92266..93651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Lpd"
FT                   /locus_tag="TTE0088"
FT                   /product="Dihydrolipoamide dehydrogenase/glutathione
FT                   oxidoreductase and related enzymes"
FT                   /note="Best Blastp hit = gi|13622179|gb|AAK33923.1|
FT                   '(AE006548) putative dihydrolipoamide dehydrogenase,
FT                   component E3 [Streptococcus pyogenes]', score 313, E-value
FT                   4.00E-84"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23392"
FT                   /db_xref="GOA:Q8RDF1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDF1"
FT                   /protein_id="AAM23392.1"
FT                   /translation="MENLHTREYDLAVIGGGPGGYVAAIKAAKKGAKVALFEKDKLGGT
FT                   CLNRGCIPTKAYARAAEVYGILKKAKEFGFDIQINYFDYAQVVKRKDTIVGELVEGIKA
FT                   LLKANKIEVFNKEAKVDKEKNVIFEGEKIKAKNIIIATGSSPAELPIEGIDSKNVLNSD
FT                   TILEITSLPKSLCIIGGGVIGMEFAFIMNQFGVEVYVVEMMPNILPSLDKKVSSAVKFA
FT                   AQKRGIKIYTSSTVEKVEEEGENSVVTIRSGDDIKKISVDKVFVSIGRKLNTSIGPIVD
FT                   LLEFDKKAIKVDEHMRTNIEGVWAVGDVTGKMMLAHVASSQGEVAVDNIFGKSRTLDYY
FT                   KIPAAVFTEPEIGYFGYTEEEAKEKFGEIKVGRFDFKHNGRAKTYGETEGFAKIISTED
FT                   GEVVGAWVVGSGASELVHIISTACQSGAKAEELKDVVYAHPTKSETIMEAFKDIFKEAI
FT                   HKI"
FT   misc_feature    92293..93219
FT                   /gene="Lpd"
FT                   /locus_tag="TTE0088"
FT                   /note="Pfam match to entry pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 317.9, E-value
FT                   1.20E-91"
FT   misc_feature    93289..93615
FT                   /gene="Lpd"
FT                   /locus_tag="TTE0088"
FT                   /note="Pfam match to entry pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 152.1, E-value 9.50E-42"
FT   gene            93664..94054
FT                   /gene="GcvH"
FT                   /locus_tag="TTE0089"
FT   regulatory      93664..93668
FT                   /gene="GcvH"
FT                   /locus_tag="TTE0089"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93677..94054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GcvH"
FT                   /locus_tag="TTE0089"
FT                   /product="Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /note="Best Blastp hit = gi|12229791|sp|O59049|GCSH_PYRHO
FT                   PROBABLE GLYCINE CLEAVAGE SYSTEM H PROTEIN
FT                   gi|7441688|pir||G71002 probable glycine cleavage system H
FT                   protein - Pyrococcus horikoshii gi|3257740|dbj|BAA30423.1|
FT                   (AP000006) 138aa long hypothetical glycine cleavage system
FT                   H protein [Pyrococcus horikoshii], score 135, E-value
FT                   1.00E-31"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23393"
FT                   /db_xref="GOA:Q8RDF0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDF0"
FT                   /protein_id="AAM23393.1"
FT                   /translation="MKVLEDLYYSKDHVWVKVEGDKAYIGITDYAQDSLGDAEYIELPE
FT                   VGTEFTAGDVLGVIESAKAASDVYIPVDGEVIEVNNAVAEDPSLVNSDPYGSWLVAVRL
FT                   KDKAQVEKLMKAEEYKKFLET"
FT   misc_feature    93695..94051
FT                   /gene="GcvH"
FT                   /locus_tag="TTE0089"
FT                   /note="Pfam match to entry GCV_H, Glycine cleavage
FT                   H-protein, score 194.9, E-value 1.20E-54"
FT   regulatory      94060..94074
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            94134..95095
FT                   /gene="NagC"
FT                   /locus_tag="TTE0090"
FT   regulatory      94134..94138
FT                   /gene="NagC"
FT                   /locus_tag="TTE0090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94148..95095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NagC"
FT                   /locus_tag="TTE0090"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|13476027|ref|NP_107597.1|
FT                   glucose kinase [Mesorhizobium loti]
FT                   gi|14026787|dbj|BAB53383.1| (AP003011) glucose kinase
FT                   [Mesorhizobium loti], score 250, E-value 2.00E-65"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23394"
FT                   /db_xref="GOA:Q8RDE9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE9"
FT                   /protein_id="AAM23394.1"
FT                   /translation="MKKFLCGVDLGGTKISTGIVDENGNIIKSIKIPTMAEKGPDVVIE
FT                   RIEESIYQVLKDTGLEMSNLKGIGIGSPGPLNAKKGIVISPPNLPHWSNVPIVEILSKR
FT                   LGIEVRLENDANAAAIGEHLFGSGRGVDNFVYITVSTGIGGGVIIEGKLYSGENSNAAE
FT                   IGHHTINFDGPRCNCGNYGCFEAYASGTAIARFAREGIEKGIKTKIKELAGEGEVKAEH
FT                   VFEAAKLGDEFAKELVEKEAFYLGVGIANIMAFYNPRKIAIGGGVSAQWDMLYEKMMET
FT                   VRKKALKPNAEVCEVVKAQLGENIGVLGAAALLL"
FT   misc_feature    94166..94726
FT                   /gene="NagC"
FT                   /locus_tag="TTE0090"
FT                   /note="Pfam match to entry ROK, ROK family, score 229.2,
FT                   E-value 4.50E-67"
FT   gene            95100..95666
FT                   /gene="Tag"
FT                   /locus_tag="TTE0091"
FT   CDS_pept        95100..95666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tag"
FT                   /locus_tag="TTE0091"
FT                   /product="3-Methyladenine DNA glycosylase"
FT                   /note="Best Blastp hit =
FT                   gi|12724082|gb|AAK05220.1|AE006344_9 (AE006344)
FT                   DNA-3-methyladenine glycosidase I (EC 3.2.2.20)
FT                   [Lactococcus lactis subsp. lactis], score 202, E-value
FT                   3.00E-51"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23395"
FT                   /db_xref="GOA:Q8R5V0"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5V0"
FT                   /protein_id="AAM23395.1"
FT                   /translation="MNMQRCPWCLVDPIYIKYHDEEWGVPVHDDRKHFEFLILESFQAG
FT                   LSWLTILKKRENFRRAYSGFDPHMVSQYDEEKIRELLENKGIVRNRKKIEASIHNAKKF
FT                   IEIQKEFGSFDEYIWRFVNYKPIINSWEKVEDIPSRTELSDMISEDLKRRGFVFIGSTI
FT                   VYSYMQAVGLVNDHLVSCFRYKELS"
FT   gene            95705..95944
FT                   /locus_tag="TTE0092"
FT   regulatory      95705..95709
FT                   /locus_tag="TTE0092"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        95720..95944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0092"
FT                   /product="sigma-F transcribed protein csfB"
FT                   /note="Best Blastp hit = gi|586864|sp|P37534|CSFB_BACSU
FT                   CSFB PROTEIN gi|282420|pir||S27525 sigma-F transcribed
FT                   protein csfB - Bacillus subtilis gi|143829|gb|AAA22890.1|
FT                   (M96156) ORF1 [Bacillus subtilis] gi|467414|dbj|BAA05260.1|
FT                   (D26185) unknown [Bacillus subtilis]
FT                   gi|2632291|emb|CAB11800.1| (Z99104) alternate gene name:
FT                   yaaM; sigma-F transcribed gene [Bacillus subtilis], score
FT                   50.1, E-value 5.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23396"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE8"
FT                   /protein_id="AAM23396.1"
FT                   /translation="MVCQMEDVTIKRKCFICDKEVQDGIDVLGKFICEECQKRLINLSP
FT                   FDKNYDFYRQKMIDIWEDYMKDVGYENWV"
FT   regulatory      95930..95955
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            95992..97422
FT                   /gene="LdcC"
FT                   /locus_tag="TTE0093"
FT   regulatory      95992..95996
FT                   /gene="LdcC"
FT                   /locus_tag="TTE0093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        96004..97422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LdcC"
FT                   /locus_tag="TTE0093"
FT                   /product="Arginine/lysine/ornithine decarboxylases"
FT                   /note="Best Blastp hit = gi|118334|sp|P21885|DCLY_BACSU
FT                   LYSINE DECARBOXYLASE (LDC) gi|1075862|pir||A54546 lysine
FT                   decarboxylase (EC 4.1.1.18) cad - Bacillus subtilis
FT                   gi|580835|emb|CAA41337.1| (X58433) lysine decarboxylase
FT                   [Bacillus subtilis] gi|2633834|emb|CAB13336.1| (Z99111)
FT                   lysine decarboxylase [Bacillus subtilis]
FT                   gi|3282147|gb|AAC24937.1| (AF012285) lysine decarboxylase
FT                   [Bacillus subtilis], score 359, E-value 5.00E-98"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23397"
FT                   /db_xref="GOA:Q8RDE7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE7"
FT                   /protein_id="AAM23397.1"
FT                   /translation="MSTPLYDALMEYVKKETVPFHMPGHKQGRVLPKEYIENLAKIDLT
FT                   EVPGLDNLHNPDGPILEAEKLAAKTFGSKQAFFLVNGSTAGIYAAMYAVLNPTDKVLVM
FT                   RNSHKSVYNGVVLTQSIPVYLLPEIDYENGIAMGIDVERLEEVLQKERDVKAVVVTYPN
FT                   YYGFCSDIEKIVDIVHKYGKILIVDEAHGAHFPFSNNLPKSSIKAGADIVVQSLHKTLT
FT                   SFTQTSILHLNSDRVDVDRLKYSLSLFQSTSPSYILMSSIDMAREYMEKEGKKRLEEVI
FT                   QLALYVRREIDKMEGIRCLGEDIVGRYGIVDFDVTKLTISVKNLGIEGPEAEDFLRREC
FT                   NIQVEMSDVYNILAMVTVGDDEKRVKMLLEGLKKLSKNRKRVKFGDRILFPSLPEMELT
FT                   PSEAVRKKKVRVPFEKAEGAISADFVTPYPPGVPLICPGERIEKDMVKYIEVLYNKGIK
FT                   VLGIQDNLLSVCEI"
FT   misc_feature    96004..97410
FT                   /gene="LdcC"
FT                   /locus_tag="TTE0093"
FT                   /note="Pfam match to entry OKR_DC_1, Orn/Lys/Arg
FT                   decarboxylase, score 402.6, E-value 3.80E-117"
FT   gene            97406..98045
FT                   /gene="Tmk"
FT                   /locus_tag="TTE0094"
FT   regulatory      97406..97410
FT                   /gene="Tmk"
FT                   /locus_tag="TTE0094"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97419..98045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tmk"
FT                   /locus_tag="TTE0094"
FT                   /product="Thymidylate kinase"
FT                   /note="Best Blastp hit = gi|586867|sp|P37537|KTHY_BACSU
FT                   THYMIDYLATE KINASE (DTMP KINASE) gi|2127026|pir||S66058
FT                   thymidylate kinase tmk - Bacillus subtilis
FT                   gi|467418|dbj|BAA05264.1| (D26185) unknown [Bacillus
FT                   subtilis] gi|2632295|emb|CAB11804.1| (Z99104) thymidylate
FT                   kinase [Bacillus subtilis], score 182, E-value 3.00E-45"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23398"
FT                   /db_xref="GOA:Q8RDE6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDE6"
FT                   /protein_id="AAM23398.1"
FT                   /translation="MRGKFISFEGIDGCGKTTQVKLLEEHLKKEGYDLLVLREPGGTRV
FT                   GEKVREILLDRENLIFPVTEMLLYASSRAQLVEEKILPALSKGQMVIVDRFIDSSYVYQ
FT                   GYARGLGLEKVKIVNEIATKGLFPDITVYIDITPEEAIKRRQGKKADRLEGEDYEFHKK
FT                   VREGYLRLVKDFPERFILIDGMQEVLAVHKMVVKAVEEYLKGAKV"
FT   misc_feature    97440..98003
FT                   /gene="Tmk"
FT                   /locus_tag="TTE0094"
FT                   /note="Pfam match to entry Thymidylate_kin, Thymidylate
FT                   kinase, score 231.8, E-value 9.80E-66"
FT   gene            98029..98371
FT                   /locus_tag="TTE0095"
FT   regulatory      98029..98033
FT                   /locus_tag="TTE0095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98042..98371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10172655|dbj|BAB03762.1|
FT                   (AP001507) BH0043; unknown conserved protein [Bacillus
FT                   halodurans], score 123, E-value 6.00E-28"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23399"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE5"
FT                   /protein_id="AAM23399.1"
FT                   /translation="MKLVLAIVQDEDVRRLMDGLTEGGFSFTRIASTGGFLRSGNTTLI
FT                   IGVEDDKLDDVISIIEKKCKTRDRIITSPTPMGGATDIFLPQAVEVTIGGATVFVLDVE
FT                   KFFRI"
FT   gene            98363..98826
FT                   /locus_tag="TTE0096"
FT   regulatory      98363..98367
FT                   /locus_tag="TTE0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98377..98826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23400"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE4"
FT                   /protein_id="AAM23400.1"
FT                   /translation="MFAMRVNEVRPSKVVSEMKSEISRTYKVEKKFGETFEKELDRVYK
FT                   DKLSEILSEIDEAADKLKESLNLQDLLKYKKLVKKFLQEATENMLKYTKKEHVDLRGRK
FT                   RIYSLVEKVDKELEKLTEEFLKESKKLELLKMIDDIRGLLIDIYS"
FT   gene            98797..99808
FT                   /gene="HolB"
FT                   /locus_tag="TTE0097"
FT   regulatory      98797..98801
FT                   /locus_tag="TTE0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98846..99808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HolB"
FT                   /locus_tag="TTE0097"
FT                   /product="ATPase involved in DNA replication"
FT                   /note="Best Blastp hit = gi|586870|sp|P37540|HOLB_BACSU
FT                   'DNA POLYMERASE III, DELTA' SUBUNIT' gi|2126931|pir||S66061
FT                   DNA polymerase III delta' chain holB - Bacillus subtilis
FT                   gi|467421|dbj|BAA05267.1| (D26185) similar to B. subtilis
FT                   DnaH [Bacillus subtilis] gi|2632298|emb|CAB11807.1|
FT                   (Z99104) DNA polymerase III (delta' subunit) [Bacillus
FT                   subtilis], score 140, E-value 2.00E-32"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23401"
FT                   /db_xref="GOA:Q8RDE3"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE3"
FT                   /protein_id="AAM23401.1"
FT                   /translation="MYGHEEILKVFRNIINQNKISNAYLFVGEEGLGKRFLAEYFAMMV
FT                   NCKGNDKPCFKCTSCVKMLKKSHPDVFIIEPEGDSIKVETVRYINAEINIKPYESFKKV
FT                   FIIDRADKMTPAAQNAFLKTLEEPPLYGLFILISPQIEALLPTVVSRCNVVRFKRERKE
FT                   VIKEYLIGEKGVSEEEAEVLAHLADGNFGEADKLVDENYKKLRSNVLSEIEKIFEKKGF
FT                   EVLNEYSFFEENKEQIEEVLKIFLSYLRDVLVFKTTKDLKFIKNVDYIDSIEKLESKLT
FT                   FKRLNNIINRIEQFNSQLKSNVNYQLAVENLLLDILGGQ"
FT   gene            99796..100692
FT                   /locus_tag="TTE0098"
FT   regulatory      99796..99800
FT                   /locus_tag="TTE0098"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99811..100692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|586871|sp|P37541|YAAT_BACSU
FT                   HYPOTHETICAL 31.2 KD PROTEIN IN XPAC-ABRB INTERGENIC REGION
FT                   gi|2127029|pir||S66062 signal peptidase II homolog yaaT -
FT                   Bacillus subtilis gi|467422|dbj|BAA05268.1| (D26185)
FT                   unknown [Bacillus subtilis] gi|2632299|emb|CAB11808.1|
FT                   (Z99104) similar to signal peptidase II [Bacillus
FT                   subtilis], score 305, E-value 6.00E-82"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23402"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE2"
FT                   /protein_id="AAM23402.1"
FT                   /translation="MVTVVGVRFKKAGKIYYFDPGDLPIKVGDKVIVETIRGIEFGEVV
FT                   VGIKEVPEEEIVAPLKKVIRIATEEDIEHYYENKKKEAQAFEICLKKIEEHGLEMNLVD
FT                   VEYTFDNTKVIFYFTAEGRVDFRELVKDLASVFRIRIELRQIGVRDEAKIIGGLGPCGR
FT                   PLCCTTFLGEFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYEQEMYEKLRAELPKV
FT                   GSIIRVGDKEMKITEVDVIRRKLKVKMKNVEGIEIIKEYDPEEVEVVEEREEEEKTYEE
FT                   ELFKEDLEKIEE"
FT   gene            complement(100706..101108)
FT                   /locus_tag="TTE0099"
FT   CDS_pept        complement(100706..101095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit =
FT                   gi|12725283|gb|AAK06315.1|AE006450_8 (AE006450) UNKNOWN
FT                   PROTEIN [Lactococcus lactis subsp. lactis], score 60.1,
FT                   E-value 1.00E-08"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23403"
FT                   /db_xref="GOA:Q8RDE1"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE1"
FT                   /protein_id="AAM23403.1"
FT                   /translation="MEKDMKMKLKKENEDLRKMELIISKALSIGVTTSAVVIFLGLLML
FT                   VITGNSGYPHGYYPTTPLSILRGFIALKPYAVILTGLLLLILTPVFRVAVSIITFFYEK
FT                   DYTYTIITTLVFIILIISFLLGKVE"
FT   gene            complement(101099..101948)
FT                   /locus_tag="TTE0100"
FT   CDS_pept        complement(101099..101932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0100"
FT                   /product="predicted permease"
FT                   /note="Best Blastp hit =
FT                   gi|12725284|gb|AAK06316.1|AE006450_9 (AE006450) permease
FT                   [Lactococcus lactis subsp. lactis], score 241, E-value
FT                   8.00E-63"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23404"
FT                   /db_xref="GOA:Q8RDE0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDE0"
FT                   /protein_id="AAM23404.1"
FT                   /translation="MVATSLEIFIFSVIAGVFGALLGLGGGIIVIPALTLLLGVDIRYA
FT                   IGASIVSVIATSSGAAVAYVRDNITNLRIGMFLEIATTLGAITGAYIAGLISSKYLYII
FT                   FGLVLLYSALAMLKKRKEELPQNVISHPLAKKLNLEGSYFDKVLNKEVKYKVAGVYEAF
FT                   GTMYLAGILSGLLGIGSGVFKVLAMDLFMKLPMKVSTATSNFMIGVTAAASAGVYLMRG
FT                   TINPEIAGPVAIGVLLGATLGTKIMERLKNTTIRKIFIPVLIYISVQMLIKGLGV"
FT   regulatory      complement(101104..101108)
FT                   /locus_tag="TTE0099"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(101120..101551)
FT                   /locus_tag="TTE0100"
FT                   /note="Pfam match to entry DUF81, Domain of unknown
FT                   function DUF81, score 89.5, E-value 2.00E-24"
FT   misc_feature    complement(101582..101911)
FT                   /locus_tag="TTE0100"
FT                   /note="Pfam match to entry DUF81, Domain of unknown
FT                   function DUF81, score 42.2, E-value 6.90E-11"
FT   regulatory      complement(101944..101948)
FT                   /locus_tag="TTE0100"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(102016..104208)
FT                   /locus_tag="TTE0101"
FT   CDS_pept        complement(102016..104196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10173162|dbj|BAB04268.1|
FT                   (AP001508) BH0549; unknown [Bacillus halodurans], score
FT                   173, E-value 6.00E-42"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23405"
FT                   /db_xref="GOA:Q8RDD9"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD9"
FT                   /protein_id="AAM23405.1"
FT                   /translation="MKKFIASLLMLLFIFSSISHPLAFPSQNSNKLAVLFILDRTGIED
FT                   LKKYDLPNIKKLMEKGSLALMNTRTAGSYSEPAAYLTIGTGTRAAVGEMGGLCFNKNEA
FT                   YAYTSAENLYYLYTGREVEDNDIVNIGIQDLISQASNLNYTVTPGLLGQILKEHGIDVY
FT                   VFGNGDVKTPYGTAYNRYAALIGMDKEGLARGDVSESLLLRDENSPYMVKANYKKLYEK
FT                   FLEASKEGGLIIIDPGDTLRADAFSKYTTPSLANSYKEKALKEADELIGKILNHMNLSK
FT                   DLFIALSPYPSSSDISKNNLITPVIVAGPSFSKGLATSNTTKREGIVTNLDIAPTILKY
FT                   FNISPPIEMLGHPIKTIPSDNALSKLLKDDEMIVSVHNARTPILKGYASIFIILVILYI
FT                   VLLFIKKDYLGYISPLLLAVITVPLTFLILPLLGPLNLYSNVIAIVLITIAIDLLVMLS
FT                   SKKDLDRVMIISLITSFAILVDLVLHAPLMKNSLLGYDVISGARYYGIGNEYMGVLLGS
FT                   LIMGTALFTEKYPKKIVKATTFLLFIAAFFLMVMPQFGAKVGAFITGFMAFGTVILMMS
FT                   GVKITKKHFLIMFVLMAISLTLMFAISTFLGTMTHMAQTTLIVKAEGINSLFQIFARKL
FT                   QMELKLMKYTIWSWVLVISIVALFVVSYKPTGVLQEAFKNHKYIYTGFFGSIVGMLFAL
FT                   GFNDAGIVAAATMCIYAIPPILLLLQKNENHG"
FT   regulatory      complement(104204..104208)
FT                   /locus_tag="TTE0101"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(104297..105703)
FT                   /gene="ArcA"
FT                   /locus_tag="TTE0103"
FT   CDS_pept        complement(104297..105703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArcA"
FT                   /locus_tag="TTE0103"
FT                   /product="Arginine deiminase"
FT                   /note="Best Blastp hit = gi|10719880|sp|O86131|ARCA_BACLI
FT                   ARGININE DEIMINASE (ADI) (ARGININE DIHYDROLASE) (AD)
FT                   gi|3687416|emb|CAA76777.1| (Y17554) arginine deiminase
FT                   [Bacillus licheniformis], score 383, E-value 1.00E-105"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23406"
FT                   /db_xref="GOA:Q8RDD8"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD8"
FT                   /protein_id="AAM23406.1"
FT                   /translation="MAIFFMFNSSNLSPSFNTFLTSSIFYLSTCLFSTKTSSSVLKITS
FT                   LNSILYKEFIRGRMKNLIKTGIVPRITSEINPLKAVILHRPGRELERLTPQNLSELLFD
FT                   DIPWVRKIQEEHDEFVKVLKENGVEVLYIERLLSEILQDEEVKEEFIEDLLQLNGITSP
FT                   KILDFLFGLLREKPVDELVEISISGLSLYEAKVKRSLMGLAEHIYEEDYYYIKPLPNLY
FT                   FTRDPAAVIDRGLMISSMKAAARKPETLIFKYLYNYHPLFKDNEVPLFYDNTYPHSIEG
FT                   GDILVLNEKVIAVGCSERTSPQAIEQLAHNLFEKGSSVEKILVVQIPAKRSYMHLDTVF
FT                   TMVDTNRFVFYPGIKNELKIFSLIKEEKGFSIHREKDLQTALKNALNLYTIDIIPTGGL
FT                   NAITSAREQWNDSTNTLAIAPGIIVTYSRNEISNKILEKEGIKVIPIEGSELSRGRGGP
FT                   RCMTMPLMRD"
FT   misc_feature    complement(104300..104878)
FT                   /gene="ArcA"
FT                   /locus_tag="TTE0103"
FT                   /note="Pfam match to entry Arg_deiminase, Arginine
FT                   deiminase, score 347, E-value 2.10E-100"
FT   gene            105642..106397
FT                   /gene="SmtA"
FT                   /locus_tag="TTE0102"
FT   CDS_pept        105642..106397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SmtA"
FT                   /locus_tag="TTE0102"
FT                   /product="SAM-dependent methyltransferases"
FT                   /note="Best Blastp hit = gi|586873|sp|P37543|YABB_BACSU
FT                   HYPOTHETICAL 28.3 KD PROTEIN IN XPAC-ABRB INTERGENIC REGION
FT                   gi|2127031|pir||S66064 conserved hypothetical protein yabB
FT                   - Bacillus subtilis gi|467424|dbj|BAA05270.1| (D26185)
FT                   unknown [Bacillus subtilis] gi|2632301|emb|CAB11810.1|
FT                   (Z99104) similar to hypothetical proteins [Bacillus
FT                   subtilis], score 191, E-value 1.00E-47"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23407"
FT                   /db_xref="GOA:Q8RDD7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD7"
FT                   /protein_id="AAM23407.1"
FT                   /translation="MRKVLKEGERLDELNIKNMAIIQHKDKFRFGIDAVLLANFVTAKR
FT                   GDRIVDLGCGNGIIPILIAAKTKDTFIYGVEIQEEMVDMAIRSVAINSLENRIKIIHGD
FT                   VREVEKLLGYEKFDVVTSNPPYMPLYTGFEKKEEAENIARYEVYGGLEDFVKAAFKLLK
FT                   FGGKFFMVHRPDRLVDVMYFLRKYNLEPKKLRFVHPYVDSKPNLLLLEAKKGAQPSLTV
FT                   LPPLYVYERTGEYTEEVKSIYSKESLEEE"
FT   gene            106387..107227
FT                   /locus_tag="TTE0104"
FT   regulatory      106387..106391
FT                   /locus_tag="TTE0104"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106400..107227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0104"
FT                   /product="predicted methyltransferases"
FT                   /note="Best Blastp hit = gi|10172661|dbj|BAB03768.1|
FT                   (AP001507) BH0049; unknown conserved protein [Bacillus
FT                   halodurans], score 229, E-value 4.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23408"
FT                   /db_xref="GOA:Q8RDD6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD6"
FT                   /protein_id="AAM23408.1"
FT                   /translation="MEEYGTLYLCPTPIGNLEDITLRVLRVLSEVDLIAAEDTRQTLKL
FT                   LNHYEIKKSLVSYHEHNKVTMGPKLIEKLKSGKSIALVTDAGTPSISDPGEELVRLCIQ
FT                   EGIKIVPLPGPTAAITALIASGLDASSFVFEGFLPKKSKERREKLERISREERTTILYE
FT                   SPHRLKETLKELKEYIGERKVVVARELTKIHEEFIRGTVEEVLEKLGEEVKGEIVIVIE
FT                   GAKISPLQKDPKELLDKYLKLGMDKKEAVKKVAEELKVSKREVYKLVIDEDIN"
FT   misc_feature    106415..107017
FT                   /locus_tag="TTE0104"
FT                   /note="Pfam match to entry TP_methylase, Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases., score 176, E-value
FT                   6.00E-49"
FT   gene            107321..108198
FT                   /gene="Mmt1"
FT                   /locus_tag="TTE0105"
FT   regulatory      107321..107325
FT                   /gene="Mmt1"
FT                   /locus_tag="TTE0105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107332..108198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Mmt1"
FT                   /locus_tag="TTE0105"
FT                   /product="predicted Co/Zn/Cd cation transporters"
FT                   /note="Best Blastp hit = gi|2501575|sp|P74068|YC63_SYNY3
FT                   HYPOTHETICAL 33.3 KD PROTEIN SLL1263 gi|7429310|pir||S75583
FT                   hypothetical protein sll1263 - Synechocystis sp. (strain
FT                   PCC 6803) gi|1653229|dbj|BAA18144.1| (D90912) hypothetical
FT                   protein [Synechocystis sp.], score 154, E-value 1.00E-36"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23409"
FT                   /db_xref="GOA:Q8RDD5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD5"
FT                   /protein_id="AAM23409.1"
FT                   /translation="MNREKAALLSVVSNSFLITVKLVAGILMHSIGVISEAIHSSIDLI
FT                   ASIIAFFSIRKAAKPADDDHPFGHGKYENVSGFVEAILIFFAALLIIYEALKRIITGAY
FT                   VENLGMGIVVMLFSALINSVVSFYLFKVAKKEDSIALKADAMHLLTDVFTSLGVAAGLV
FT                   VIRFTGINILDPVIAIFVAFLIIKASVDLTKEALKDLTDTSLPEEELKEIEEIIKSNPE
FT                   ITSFHKLRTRKSGQKREIDVHLRVRRDANIVEAHELSHKVSKQIIDRFPEANVTVHIEP
FT                   EEKKEEK"
FT   misc_feature    107350..108189
FT                   /gene="Mmt1"
FT                   /locus_tag="TTE0105"
FT                   /note="Pfam match to entry Cation_efflux, Cation efflux
FT                   family, score 289.1, E-value 5.40E-83"
FT   regulatory      108189..108227
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(108233..108501)
FT                   /locus_tag="TTE0106"
FT   CDS_pept        complement(108233..108487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0106"
FT                   /product="transcription regulator AbrB"
FT                   /note="Best Blastp hit = gi|12084449|pdb|1EKT|A 'Chain A,
FT                   Solution Structure Of The N-Terminal Dna Recognition Domain
FT                   Of The Bacillus Subtilis Transcription-State Regulator
FT                   Abrb' gi|12084450|pdb|1EKT|B 'Chain B, Solution Structure
FT                   Of The N-Terminal Dna Recognition Domain Of The Bacillus
FT                   Subtilis Transcription-State Regulator Abrb', score 88.2,
FT                   E-value 2.00E-17"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23410"
FT                   /db_xref="GOA:Q8RDD4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD4"
FT                   /protein_id="AAM23410.1"
FT                   /translation="MLKSTGIVRKVDELGRVVIPIELRRTLNIAERDALEIYVDGEQIV
FT                   LKKYEPACIFCGNAENVINYKGKNICKNCLEELKKTPLE"
FT   regulatory      complement(108497..108501)
FT                   /locus_tag="TTE0106"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            108654..109251
FT                   /gene="SpmA"
FT                   /locus_tag="TTE0107"
FT   regulatory      108654..108658
FT                   /gene="SpmA"
FT                   /locus_tag="TTE0107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108667..109251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpmA"
FT                   /locus_tag="TTE0107"
FT                   /product="uncharacterized membrane protein"
FT                   /note="required for spore maturation in B.subtilis; Best
FT                   Blastp hit = gi|7448623|pir||S74647 spore maturation
FT                   protein B - Synechocystis sp. (strain PCC 6803)
FT                   gi|1651872|dbj|BAA16799.1| (D90900) spore maturation
FT                   protein B [Synechocystis sp.], score 191, E-value 6.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23411"
FT                   /db_xref="GOA:Q8RDD3"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD3"
FT                   /protein_id="AAM23411.1"
FT                   /translation="MMNYIWFFMIAVGVFVGMANGKMSEVSRAIIDSAQSAVTISIGLL
FT                   GVMALWLGIMKIAEKSGLMDIVAKVLKPVVTKVFPEVPKDHPAISAMIMNISANMLGLG
FT                   NAATPFGIKAMEYLQELNRKESASNAMCRFLVINTASIQLIPAVMIGLRASLGAQNPAD
FT                   FVIVSIFSTATALTAGLIFNNFIEKMSIFRE"
FT   gene            109248..109778
FT                   /gene="SpmB"
FT                   /locus_tag="TTE0108"
FT   CDS_pept        109248..109778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpmB"
FT                   /locus_tag="TTE0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7448622|pir||S74646 spore
FT                   maturation protein A - Synechocystis sp. (strain PCC 6803)
FT                   gi|1651871|dbj|BAA16798.1| (D90900) spore maturation
FT                   protein A [Synechocystis sp.], score 184, E-value 5.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23412"
FT                   /db_xref="GOA:Q8RDD2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD2"
FT                   /protein_id="AAM23412.1"
FT                   /translation="MMCVVEIFSEWLVPVLLIIIPFYGLVKKAKVYEIFIEGAKEGLDV
FT                   VVRIFPSLLAMLVAIGVLRASGALNLLAQILMPFTQKIGMPEELVPLALIRPLSGSGAL
FT                   GIATELMKTYGADSFIGKMASAMYGSTETTFYVLAVYFGAVGIKNIRHSIVSGIFADIV
FT                   AIISCVFYSRIFF"
FT   gene            109840..111253
FT                   /gene="PcnB"
FT                   /locus_tag="TTE0109"
FT   regulatory      109840..109844
FT                   /gene="PcnB"
FT                   /locus_tag="TTE0109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109853..111253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PcnB"
FT                   /locus_tag="TTE0109"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /note="Best Blastp hit = gi|7520819|pir||C70485 poly A
FT                   polymerase - Aquifex aeolicus gi|2984364|gb|AAC07883.1|
FT                   (AE000776) poly A polymerase [Aquifex aeolicus], score 201,
FT                   E-value 2.00E-50"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23413"
FT                   /db_xref="GOA:Q8R5U9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U9"
FT                   /protein_id="AAM23413.1"
FT                   /translation="MATIPRLIRKLGREAYNVYIVGGYIRDRILNKEAKDYDFVVKGNA
FT                   EEIAKLAAEKMGGSFVPFMAEKGTYRIVVGDEILDFTNLRGKDIYEDLAHRDFTINAMA
FT                   IRLTDHFEFEYIIDPFGGLKDIKNRKIRHVADYTFREDPLRALRAVRFAATYKFDIDEA
FT                   TKAKIKEEAHLLKNVAPERIMNEIFMIIREKDSHKYLRLMEELSLMENIFEEVAKLKEV
FT                   GKCYYQLINAWIHSIRAVEEYENIISAMRFPKDVEDLVSEYLEKPMSPGNKVKDIIKLG
FT                   ILFHDIGKADSIYIDVENRLHFYNHEIKGAEIIKKMASRMRIPKKETNLLKKLVLYHKK
FT                   PLDYYIEGVNNKTLFRFFYHLKDNAIGILLASLADYTASRLSFGKEEDIPRYENFITKL
FT                   LKRYVEFKETEKPLLSPLDIILNFDVKDGKKLGQILYEIRKNRFYGEIKTKEDAVEFIK
FT                   ERMRVEKI"
FT   misc_feature    110057..110518
FT                   /gene="PcnB"
FT                   /locus_tag="TTE0109"
FT                   /note="Pfam match to entry PolyA_pol, Poly A polymerase
FT                   family, score 154.8, E-value 1.50E-42"
FT   gene            111599..113529
FT                   /gene="MetG"
FT                   /locus_tag="TTE0110"
FT   regulatory      111599..111603
FT                   /gene="MetG"
FT                   /locus_tag="TTE0110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        111613..113529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MetG"
FT                   /locus_tag="TTE0110"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /note="Best Blastp hit = gi|135148|sp|P23920|SYM_BACST
FT                   METHIONYL-TRNA SYNTHETASE (METHIONINE--TRNA LIGASE) (METRS)
FT                   gi|98214|pir||S16682 methionine--tRNA ligase (EC 6.1.1.10)
FT                   - Bacillus stearothermophilus gi|39989|emb|CAA40999.1|
FT                   (X57925) methionyl-tRNA synthetase [Bacillus
FT                   stearothermophilus], score 831, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23414"
FT                   /db_xref="GOA:Q8RDD1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDD1"
FT                   /protein_id="AAM23414.1"
FT                   /translation="MKKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMF
FT                   LTGTDEHGQKIQRIAREKGMSPKEYVDGIVEWIKDLWKTMDISYDHFIRTTDAYHEEIV
FT                   QKIFMKLYEQGDIYKGEYEGWYCTPCESFWTESQLVDGKCPDCGRPVERVTEEGYFFRL
FT                   SAYGDKLLKYYEEHPDFIQPESRRNEMINFIKAGLEDLFVSRSTFDWGIKVPFDPKHVI
FT                   YVWIDALSNYITALGYMTENDEKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLP
FT                   KKVFGHGWLILEGGKMSKSKGNVVDPKELVDRYGVDAIRYFLLREVPFGADGVFSNEAL
FT                   INRINSDLANDLGNLLSRTVTMIEKYFDGVLPKPSSQEEIDEDLINVAQNLPQKVEEYM
FT                   DKLQFSNALIEIWKLVSRANKYIDETMPWVLAKDESKRGRLGTVLYNLAESLRFIGILI
FT                   SPFMPNTPKKMFEQLGITEDLTTWESLKFGLLKEGTRVKRGEILFPRIDVEKELASLEK
FT                   KTEEKTKETKEEKIDYITIEDFSKVQLRVAEILEAEKVEGSDKLIKMKLKVGEEIRQIV
FT                   GGIGKYYSPEELIGKKIIIVYNLQPRKLMGIESQGMLLAATNEGKMALLTVDKDIESGS
FT                   KIS"
FT   misc_feature    111616..112800
FT                   /gene="MetG"
FT                   /locus_tag="TTE0110"
FT                   /note="Pfam match to entry tRNA-synt_1, 'tRNA synthetases
FT                   class I (I, L, M and V)', score -108, E-value 5.10E-11"
FT   misc_feature    113242..113520
FT                   /gene="MetG"
FT                   /locus_tag="TTE0110"
FT                   /note="Pfam match to entry tRNA_bind, Putative tRNA binding
FT                   domain, score 138, E-value 1.70E-37"
FT   gene            113529..114310
FT                   /gene="TatD"
FT                   /locus_tag="TTE0111"
FT   regulatory      113529..113533
FT                   /gene="TatD"
FT                   /locus_tag="TTE0111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        113540..114310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TatD"
FT                   /locus_tag="TTE0111"
FT                   /product="Mg-dependent DNase"
FT                   /note="Best Blastp hit = gi|586875|sp|P37545|YABD_BACSU
FT                   PUTATIVE DEOXYRIBONUCLEASE YABD gi|2127033|pir||S66068
FT                   conserved hypothetical protein yabD - Bacillus subtilis
FT                   gi|467428|dbj|BAA05274.1| (D26185) unknown [Bacillus
FT                   subtilis] gi|2632306|emb|CAB11815.1| (Z99104) similar to
FT                   hypothetical proteins [Bacillus subtilis], score 240,
FT                   E-value 1.00E-62"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23415"
FT                   /db_xref="GOA:Q8RDD0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDD0"
FT                   /protein_id="AAM23415.1"
FT                   /translation="MLIDSHAHLEDEKYNEDREKVIEECKKDLTFLINVGSNILTSKKT
FT                   IELAHKYDFIYATVGIHPHDAEREKDKIEEIEKLALEDKVVAIGEIGLDYYYGDPPKEF
FT                   QIEAFVKQIRLAKKLKLPIVIHDRVAHEDILKILKKEWTQDLKGVFHSYSGSVEMIKEV
FT                   ISMNFYISLSGTVTFKNAKKVREVAKEVPLEWLLIETDSPYLTPEPYRGKRNKPTYVKF
FT                   VAQKIAEIKGISFEEVCETTSQNAIKLFNLPSCF"
FT   misc_feature    113558..114292
FT                   /gene="TatD"
FT                   /locus_tag="TTE0111"
FT                   /note="Pfam match to entry TatD_DNase, TatD related DNase,
FT                   score 362.9, E-value 3.40E-105"
FT   gene            114436..115465
FT                   /locus_tag="TTE0112"
FT   regulatory      114436..114440
FT                   /locus_tag="TTE0112"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        114449..115465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|586876|sp|P37546|YABE_BACSU
FT                   HYPOTHETICAL 47.7 KD PROTEIN IN METS-KSGA INTERGENIC REGION
FT                   gi|2127034|pir||S66069 conserved hypothetical protein yabE
FT                   - Bacillus subtilis gi|467429|dbj|BAA05275.1| (D26185)
FT                   unknown [Bacillus subtilis] gi|2632307|emb|CAB11816.1|
FT                   (Z99104) similar to hypothetical proteins [Bacillus
FT                   subtilis], score 179, E-value 4.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23416"
FT                   /db_xref="GOA:Q8RDC9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC9"
FT                   /protein_id="AAM23416.1"
FT                   /translation="MDTDDLRRRLKPVALVTLVAVAFAAIGLLAYVNLRKEITLQDENK
FT                   KIVITTFASTVGDLLKERGIELRQEDVVKPSLNTRLKNGMTITIKRAVPVTLNVGGKVE
FT                   NIYSAASTIKDLLSERGIALGPQDKINMTLDTPVFAYMYIDITKVTEKIITEEIDIPYQ
FT                   IETVKDYTMERGQTRIAQQGEMGKKVKVIKVTYENGKEVARNVIEEKVIKNPVPQIVRV
FT                   GTLGVFTTSRGEIVRYREVKTMLATAYDSSEESTGKKPGDPDYGITASGMVARRGVVAV
FT                   DPRVIPLGTRLYVEGYGFCIAADTGGAIKGNRIDVYFPTREEVRNWGRRYVKVYILQ"
FT   regulatory      115466..115483
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            115494..116310
FT                   /gene="KsgA"
FT                   /locus_tag="TTE0113"
FT   regulatory      115494..115498
FT                   /gene="KsgA"
FT                   /locus_tag="TTE0113"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        115504..116310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="KsgA"
FT                   /locus_tag="TTE0113"
FT                   /product="Dimethyladenosine transferase (rRNA methylation)"
FT                   /note="Best Blastp hit = gi|10172669|dbj|BAB03776.1|
FT                   (AP001507) dimethyladenosine transferase [Bacillus
FT                   halodurans], score 206, E-value 3.00E-52"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23417"
FT                   /db_xref="GOA:Q8RDC8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDC8"
FT                   /protein_id="AAM23417.1"
FT                   /translation="MKAKKKWGQNFIFDKNLLSKIVRASGVGEEDFVLEVGTGHGGLTE
FT                   ELAKKVKKVVSFEIDKELFEMSREKLKIYKNVVIINEDILEVDLLEIAQEHFDGNSFKV
FT                   VANLPYYITSPIIMKMLDCKLVKEMTVLVQKEVAERICALPGTKDYGMLTVFVNFKAKP
FT                   EILFNLPPKVFVPPPKVESSLLKLKVYDKPLVEVKDEKLFSEVVRAAFGQRRKVLSNSL
FT                   KVLGFSKEVLHETLLKVGISPQARGETLSIDQFANLANALYLLIKE"
FT   misc_feature    115528..116283
FT                   /gene="KsgA"
FT                   /locus_tag="TTE0113"
FT                   /note="Pfam match to entry RrnaAD, Ribosomal RNA adenine
FT                   dimethylases, score 249.7, E-value 6.00E-77"
FT   gene            116367..117356
FT                   /locus_tag="TTE0114"
FT   regulatory      116367..116371
FT                   /locus_tag="TTE0114"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116382..117356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC7"
FT                   /protein_id="AAM23418.1"
FT                   /translation="MPVNIYKRSYIVLNPEDKGCSFEGKEVSGYLKLEFRGNRGRVTAA
FT                   LQNLNPDYSYNLKLLKSNGDVVVVDFGALKVDDKGRGGGEWTFDLEDVKGSGLKWEEFS
FT                   VILVEAHDGEKFLVPLVSQMNKKSSNWKSAYRKYLIKRESEESETHKEETVEEKKVEVS
FT                   PAPETVYEKIEAEEDALKENLEEYSKKEENKEEADYIKYLKEYVNNIVNFLEEVQPFEK
FT                   NLEGYRWWKVKTGYREGSFDHYLVGFVKDEKGDLKYIVYGMPGFFTLSDQPFAGMTGFV
FT                   VWKPVREGFRGPRDEGYWLMHIDAKTGQIAVPIEPTPPPIIQN"
FT   regulatory      117360..117375
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   repeat_region   117373..117635
FT                   /note="TLR027, identity:100%, copy 2"
FT   gene            complement(117651..117907)
FT                   /locus_tag="TTE0115"
FT   CDS_pept        complement(117651..117893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23419"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC6"
FT                   /protein_id="AAM23419.1"
FT                   /translation="MKEIKVKLSTIESVKRFVEKTSKYPFEIDVVSGRYVIDAKSIMGL
FT                   FSLNLENVLTVVAHTDNEEEMKKLEEDLKEFAAQN"
FT   regulatory      complement(117903..117907)
FT                   /locus_tag="TTE0115"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      117989..118006
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(117998..119237)
FT                   /locus_tag="TTE0116"
FT   CDS_pept        complement(117998..119224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0116"
FT                   /product="S-layer homology domain protein"
FT                   /note="Best Blastp hit = gi|1434920|dbj|BAA13073.1|
FT                   (D86346) crystal protein [Bacillus thuringiensis], score
FT                   85.9, E-value 9.00E-16"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23420"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC5"
FT                   /protein_id="AAM23420.1"
FT                   /translation="MYKYLKSFIFTIIIFSLLSFTVTFAKAQTSYSFDDIKEYKWAIKA
FT                   VEKMHAKGIIKGVGDKKFAPSKPVTHLEALALILRTLGYEETSELPKEYKGKVPAWGKE
FT                   FIGLAYEKGLVTSEELKTFNPNKDAKRYEIAKYLVRALGLEKEAKLNMNQKLLYKDWKA
FT                   VPKDSKGYMYVAVKEGLIVGDGKNLKPNEPVKRIEMAVILERLDEKIGNTISSGKEVIG
FT                   TVYQADESSITVKVGNLLKTFPVIKNVPVFDGNDYLKIDSLKKGYTVRLILDGKNNIIF
FT                   VEVLNKNSEEVIPIQLEKAISLPQNVLNLVESLKETQNVKLVEENGTYYIIATRGMMRT
FT                   GGYSVSIEKAQIIKSENKTTLEVEIKYQNPSENAIVTQAITYPYDVKMFKYDGKIDDIK
FT                   ILYKYNLAP"
FT   misc_feature    complement(119000..119128)
FT                   /locus_tag="TTE0116"
FT                   /note="Pfam match to entry SLH, S-layer homology domain,
FT                   score 43.2, E-value 5.80E-09"
FT   gene            complement(119224..120133)
FT                   /locus_tag="TTE0117"
FT   CDS_pept        complement(119224..120120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23421"
FT                   /db_xref="GOA:Q8RDC4"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC4"
FT                   /protein_id="AAM23421.1"
FT                   /translation="MKAVVIKKEKDKAYLLTADGQFIASKKFKDAEIGETVEILHKNFF
FT                   SHPAAKILIAASVIIALLVSVLTFRAPEVYAYVYIEINPSIKAAVDKNGKVISAISMNE
FT                   EAKKILEKIPYKGLDISTFIVKTVEESEKMGFLRKDGEVIITTIPLKESKIVEEKVQEA
FT                   VENIKKSKSALKFEVNAKEEKIQKTEKKNLKEPKDDKENDKKQDKKLKTKPPVKITNTE
FT                   PKNEVTKDKQEKQKIKVEVPVKITKPDKEVQKETTEKPKEENSEKQEKSKMKDNNSKNG
FT                   KNEKGENDNKNKKEVKK"
FT   regulatory      complement(119233..119237)
FT                   /locus_tag="TTE0116"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(120117..120782)
FT                   /gene="FliA"
FT                   /locus_tag="TTE0118"
FT   CDS_pept        complement(120117..120782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FliA"
FT                   /locus_tag="TTE0118"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="Best Blastp hit = gi|7475808|pir||D69861 RNA
FT                   polymerase sigma factor homolog ykoZ - Bacillus subtilis
FT                   gi|2633716|emb|CAB13218.1| (Z99111) similar to RNA
FT                   polymerase sigma factor [Bacillus subtilis], score 154,
FT                   E-value 9.00E-37"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23422"
FT                   /db_xref="GOA:Q8RDC3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014244"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC3"
FT                   /protein_id="AAM23422.1"
FT                   /translation="MVDLDINERVYIAKKDPSEREKLIEEYTPFIIKQVSHFANKYIDE
FT                   QNSDELSIGLIAFNEAIDSFDITKGSFLNFSSLIIKRRIIDFLRQNQDLAYPLDVYPER
FT                   ESDYEIENRRLEMLSFVNLLSLYGIEIEDLVRQSPKHRETRKLALKIARTICENEHLLS
FT                   YLKKTKTLPVKELIELLRISRKSIEKYRKYIIALVIILSEDLPILKEYINFESEVAKT"
FT   regulatory      complement(120129..120133)
FT                   /locus_tag="TTE0117"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            120878..121967
FT                   /gene="Mrp"
FT                   /locus_tag="TTE0119"
FT   regulatory      120878..120882
FT                   /gene="Mrp"
FT                   /locus_tag="TTE0119"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120891..121967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Mrp"
FT                   /locus_tag="TTE0119"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /note="Best Blastp hit = gi|9714437|emb|CAC01353.1|
FT                   (AL390975) putative ATP-binding protein [Streptomyces
FT                   coelicolor], score 259, E-value 4.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23423"
FT                   /db_xref="GOA:Q8RDC2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC2"
FT                   /protein_id="AAM23423.1"
FT                   /translation="MITKEQILSALKKVYDPELRRNVVDLGMVKNIEIEGDKVTVDINL
FT                   TVKGCPLRDQIKNNAIKEISKIEGVSEVVVNIGAMTEEERQDLARRLKEEKKNLFENTR
FT                   VIVVGSGKGGVGKSTVAVNLAVALSRLGFEVGLLDADILGSSVPRLLGIVGEKPYALDE
FT                   HTVLPIERFGLKIISMGNFVDEDTPLIWRGPLLTGVIDQFFNEVLWGDLDYLVLDLPPG
FT                   TGDIPLTVMQRLPEAKFILVTTPQASASHVAGRIGHMAKKVNVEVIGIVENMSYFECPK
FT                   CGERYNIFGEGETEKLAEALQTEILARIPIVVKIRELSDEGIPPALDDTEEGAIYVELA
FT                   EKIVEKVRPLRHEKEPLK"
FT   misc_feature    120897..121121
FT                   /gene="Mrp"
FT                   /locus_tag="TTE0119"
FT                   /note="Pfam match to entry DUF59, Domain of unknown
FT                   function DUF59, score 93.4, E-value 4.60E-24"
FT   repeat_region   complement(122001..122204)
FT                   /note="TLR027, identity:94%, copy 3"
FT   gene            complement(122261..122638)
FT                   /locus_tag="TTE0120"
FT   CDS_pept        complement(122261..122623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|13815942|gb|AAK42754.1|
FT                   (AE006858) Conserved hypothetical protein [Sulfolobus
FT                   solfataricus], score 55.5, E-value 2.00E-07"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23424"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC1"
FT                   /protein_id="AAM23424.1"
FT                   /translation="MRIAATITEKGYIEKLPDGPHIVIFDTEKNQTEKYDNPGYHLEEN
FT                   RRSTVVDFLFEKNVDVVITVPEAFCSISYGKARQKGLKFIRLKESMPYEEVIKDLSSHL
FT                   ERLTDNIPEDELFKRI"
FT   regulatory      complement(122634..122638)
FT                   /locus_tag="TTE0120"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            122742..123252
FT                   /locus_tag="TTE0121"
FT   regulatory      122742..122746
FT                   /locus_tag="TTE0121"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122755..123252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23425"
FT                   /db_xref="GOA:Q8RDC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDC0"
FT                   /protein_id="AAM23425.1"
FT                   /translation="MLKGIKWQVVILTFAVAFGGLFIGFQIYQNKLIPERISRDLKSVK
FT                   FVKDVTIIAGDKGYDVKVKLDRVENLMETYGEIQEKIKKYPVKINLFILDNSDERLNNV
FT                   YYNLQFALYEAIQKGDYLKMYDFVKELSQENGITSQVYIDEHNIYIDLRDDSHYLYKVI
FT                   AR"
FT   gene            123268..124759
FT                   /gene="HflB"
FT                   /locus_tag="TTE0122"
FT   regulatory      123268..123272
FT                   /gene="HflB"
FT                   /locus_tag="TTE0122"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123281..124759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HflB"
FT                   /locus_tag="TTE0122"
FT                   /product="ATP-dependent Zn proteases"
FT                   /note="Best Blastp hit = gi|7446578|pir||E72358 cell
FT                   division protein FtsH - Thermotoga maritima (strain MSB8)
FT                   gi|4981098|gb|AAD35665.1|AE001733_2 (AE001733) cell
FT                   division protein FtsH [Thermotoga maritima], score 285,
FT                   E-value 9.00E-76"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23426"
FT                   /db_xref="GOA:Q8RDB9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB9"
FT                   /protein_id="AAM23426.1"
FT                   /translation="MVREILLGIAIAFTIFAAFLGINVMPIVFLMAAFLLLSHLIENRG
FT                   LVPANKNIVNPESEVSFEDIGGQNTAISELKEALDFVVNREKIAQMGIRPIKGILLIGP
FT                   PGTGKTLLAKAAAKYTNSSFIATSGSEFIEMYAGVGAQRVRHLFETAKSLAKKEGKNSA
FT                   IIFIDEIDILGAKRGTHESHHEYDQTLNQLLVEMDGIKNNGDVNILVIAATNRPDLLDP
FT                   ALLRPGRFDRQVVVDLPDKNGRLQILKIHTKNKPLGEDVNLEEIAESTFGFSGAHLENL
FT                   CNEAAILALRDGSPSILQKHFKEAIDKVILGEKSDRKPTEEELYRIAVHEAGHAIVGEE
FT                   VNPGSVAVITIVPRGRALGFVRQAEKKDLLIYTKEQLEKDIMVALGGTVAEVLVLGGRS
FT                   TGSANDFEQAVDIAKKIVFTGLSDLGIVSKEDISKEKVNEEVNKIVKNLEDKVKEILER
FT                   RLEKLKEVAELLKKEEAISGEKLREILNKEEVLA"
FT   misc_feature    123572..124153
FT                   /gene="HflB"
FT                   /locus_tag="TTE0122"
FT                   /note="Pfam match to entry AAA, ATPase family associated
FT                   with various cellular activities (AAA), score 286.6,
FT                   E-value 3.20E-82"
FT   misc_feature    124169..124732
FT                   /gene="HflB"
FT                   /locus_tag="TTE0122"
FT                   /note="Pfam match to entry Peptidase_M41, Peptidase family
FT                   M41, score 97.8, E-value 2.20E-25"
FT   gene            124913..126814
FT                   /gene="NuoL"
FT                   /locus_tag="TTE0123"
FT   regulatory      124913..124917
FT                   /gene="NuoL"
FT                   /locus_tag="TTE0123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124928..126814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoL"
FT                   /locus_tag="TTE0123"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 5 (chain
FT                   L)/Multisubunit Na+/H+ antiporter, MnhA subunit"
FT                   /note="Best Blastp hit = gi|3005967|emb|CAA76117.1|
FT                   (Y16191) echA [Methanosarcina barkeri], score 345, E-value
FT                   1.00E-93"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23427"
FT                   /db_xref="GOA:Q8RDB8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB8"
FT                   /protein_id="AAM23427.1"
FT                   /translation="MQSNLLLLSILFPIAAGVVVLFLRQSNIRKGFIAVALAVIVLSSL
FT                   VLLGTLKVPDVFTASDFYGILDVAIKIADFVLLVYVIYISFKIKEWRATFFAVLQLIPL
FT                   IYFEFFMLKEHEMEMFFVDELAIIMNLIISIVGSLIALYAFSYMDHHEEHLHVSPTRQP
FT                   RFFAIILVFLGAMNGLVLSNNLMWMYFFWEVTTLSSFLLIGHDQTEEAIRNAARALWIN
FT                   MMGGFALLLGIIFIYANYSTISLVEVLKIQNASYILLPMFFIAFAAFTKSAQMPFQSWL
FT                   LGAMVAPTPVSALLHSSTMVKAGIYILLRFSPLFRGTLLSDFIAVYGAFTFLATAFLAV
FT                   SQSNAKRILAYSTVSNLGLMIASIGINTSSAIAAAILLLIFHAISKALLFLSVGTIEQH
FT                   IGSRDIEDMKGLINKMPVTTSITFVGILTLMAAPFGMLVSKWLILEVAAGSIIISIILA
FT                   IGSALTVLYYTRWIGNILSGTYFTKKEQERMDVPVGISLYSLTGLAVILSLMIVSLYNM
FT                   LVIPQIVNMKMDVALKAARGYLYTASGGFMIYPIFLTIGLAIVLSLISIQKASKTAVKV
FT                   TPYNAGLNYVEEKSFDVKNYYLTTFATEKTLTKYFNYVSIALIAVILGGAIL"
FT   misc_feature    125285..125440
FT                   /gene="NuoL"
FT                   /locus_tag="TTE0123"
FT                   /note="Pfam match to entry oxidored_q1_N, NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5 N-terminus, score 33.2,
FT                   E-value 3.60E-07"
FT   misc_feature    125471..126322
FT                   /gene="NuoL"
FT                   /locus_tag="TTE0123"
FT                   /note="Pfam match to entry oxidored_q1,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains,
FT                   score 255.5, E-value 7.10E-73"
FT   gene            126799..127662
FT                   /gene="NuoH"
FT                   /locus_tag="TTE0124"
FT   regulatory      126799..126803
FT                   /gene="NuoH"
FT                   /locus_tag="TTE0124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126811..127662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoH"
FT                   /locus_tag="TTE0124"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 1 (chain
FT                   H)"
FT                   /note="Best Blastp hit = gi|3005968|emb|CAA76118.1|
FT                   (Y16191) echB [Methanosarcina barkeri], score 247, E-value
FT                   2.00E-64"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23428"
FT                   /db_xref="GOA:Q8RDB7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB7"
FT                   /protein_id="AAM23428.1"
FT                   /translation="MIKEILIFVAAVILAPIIGGFLSGIDRKLTAFIQGRYGPPIWQPF
FT                   YDIVKLLYKQKILVNNFQVFSAYMYLLTAILSVGLFAIKADLLMILFVMSVGLVFYIAG
FT                   ALSTKSPYSQVGAQRELMQMLAYEPMLIFFAIALYNATGSFNIGQIMTHGRLLLDLPLM
FT                   FILLALVLTIKLKKSPFDLSASEHAHQELVRGILTDYSGPYLALIHIADWYEMVLILMM
FT                   IAILWSENLLIGALIALLTFFLDIVLDNITARMTVKWMLAFSWTISILFTIVNIAYIYF
FT                   RR"
FT   misc_feature    126811..127488
FT                   /gene="NuoH"
FT                   /locus_tag="TTE0124"
FT                   /note="Pfam match to entry NADHdh, NADH dehydrogenase,
FT                   score 48.8, E-value 1.20E-12"
FT   gene            127654..128135
FT                   /gene="NuoB"
FT                   /locus_tag="TTE0125"
FT   regulatory      127654..127658
FT                   /gene="NuoB"
FT                   /locus_tag="TTE0125"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127668..128135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoB"
FT                   /locus_tag="TTE0125"
FT                   /product="NADH:ubiquinone oxidoreductase 20 kD subunit and
FT                   related Fe-S oxidoreductases"
FT                   /note="Best Blastp hit = gi|3005969|emb|CAA76119.1|
FT                   (Y16191) echC [Methanosarcina barkeri], score 184, E-value
FT                   7.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23429"
FT                   /db_xref="GOA:Q8RDB6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB6"
FT                   /protein_id="AAM23429.1"
FT                   /translation="MGLKEFIEKSFKKSPWVLHYNASSCNGCDIEILACMTPIYDMERF
FT                   GMMNVGNPKHADILVVTGSVNTRNKDVLKNIYDQMPEPKVVVAVGVCAATGGVFRDTYN
FT                   VLGGVDKVIPVDVYVPGCPAKPEAIIDGLYKATEILKEKYKKMGKAEEVLK"
FT   misc_feature    127755..128078
FT                   /gene="NuoB"
FT                   /locus_tag="TTE0125"
FT                   /note="Pfam match to entry oxidored_q6, NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit, score 185.1, E-value
FT                   1.10E-51"
FT   gene            128122..128509
FT                   /locus_tag="TTE0126"
FT   regulatory      128122..128126
FT                   /locus_tag="TTE0126"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128132..128509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0126"
FT                   /product="echD"
FT                   /note="Best Blastp hit = gi|3005970|emb|CAA76120.1|
FT                   (Y16191) echD [Methanosarcina barkeri], score 78.2, E-value
FT                   4.00E-14"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23430"
FT                   /db_xref="GOA:Q8RDB5"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR012179"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB5"
FT                   /protein_id="AAM23430.1"
FT                   /translation="MIKTREVKLEEVEKEAKYYYDNGYRFVTETCLEEDGKFRIIYTFE
FT                   KDSELESFHTYVSPEEEVPSISKVYFAAIPVENEIHEMFGLRFKNLALDFQGLLFLGEF
FT                   APISPQASIEIMRRDKGDKNE"
FT   gene            128491..129584
FT                   /gene="NuoD"
FT                   /locus_tag="TTE0127"
FT   regulatory      128491..128495
FT                   /locus_tag="TTE0126"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128502..129584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoD"
FT                   /locus_tag="TTE0127"
FT                   /product="NADH:ubiquinone oxidoreductase 49 kD subunit 7"
FT                   /note="Best Blastp hit = gi|3005971|emb|CAA76121.1|
FT                   (Y16191) echE [Methanosarcina barkeri], score 424, E-value
FT                   1.00E-118"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23431"
FT                   /db_xref="GOA:Q8RDB4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB4"
FT                   /protein_id="AAM23431.1"
FT                   /translation="MSEKSTIPFGPQHPVLPEPIHLKLIVEDEKVVEAYPAFGYVHRGL
FT                   ELLVKKRDFNQMVYVVDHICGICSAIHGETYCQAVEKLIGIDVPERAKFLRVIWAEIHR
FT                   IHSHLLWFGLLADAFGFENLFMLSWRIREKVMDILEATAGNRVVISVNIVGGVRRDIDS
FT                   EQAKWVLAQLKEVEEGLKEIEKIVRDNYTLKKRTVGIGVLSKEEAYMLGAVGPTLRGSG
FT                   VPIDTRTLGYAAYKYLDFEPVVEKDGDTYARTLVRLREMFQSIDLVRQAISKMPEGEIN
FT                   VKVKPNLPAGEVIERAEQPRGEVFYYIKSNGGKYLDRLRIRTPTFANLAALLHMLPGCT
FT                   LADVPVLVLTIDPCISCTER"
FT   misc_feature    128628..128837
FT                   /gene="NuoD"
FT                   /locus_tag="TTE0127"
FT                   /note="Pfam match to entry NiFeSe_Hases, Nickel-dependent
FT                   hydrogenase, score 29.7, E-value 1.30E-08"
FT   misc_feature    128895..129557
FT                   /gene="NuoD"
FT                   /locus_tag="TTE0127"
FT                   /note="Pfam match to entry complex1_49Kd, Respiratory-chain
FT                   NADH dehydrogenase, 49 Kd subunit, score 125.9, E-value
FT                   3.60E-45"
FT   gene            129583..129965
FT                   /gene="NuoI"
FT                   /locus_tag="TTE0128"
FT   regulatory      129583..129587
FT                   /gene="NuoI"
FT                   /locus_tag="TTE0128"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129594..129965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NuoI"
FT                   /locus_tag="TTE0128"
FT                   /product="Formate hydrogenlyase subunit 6/NADH:ubiquinone
FT                   oxidoreductase 23 kD subunit (chain I)"
FT                   /note="Best Blastp hit = gi|3005972|emb|CAA76122.1|
FT                   (Y16191) echF [Methanosarcina barkeri], score 98.6, E-value
FT                   3.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23432"
FT                   /db_xref="GOA:Q8RDB3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB3"
FT                   /protein_id="AAM23432.1"
FT                   /translation="MLSMLKNVVYNLTHKPATRRYPFEKREPFEGTRGHIENDIEKCIL
FT                   CGICQRVCPSNCIQVDRKEGTWKFEPFACIVCGACVDACPTKSLIMLKEYRPISHEKYV
FT                   IVQKKETKASAEKEEKEGI"
FT   misc_feature    129699..129770
FT                   /gene="NuoI"
FT                   /locus_tag="TTE0128"
FT                   /note="Pfam match to entry fer4, 4Fe-4S binding domain,
FT                   score 28.3, E-value 9.80E-05"
FT   gene            129946..130311
FT                   /gene="HybF"
FT                   /locus_tag="TTE0129"
FT   regulatory      129946..129950
FT                   /gene="HybF"
FT                   /locus_tag="TTE0129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129967..130311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HybF"
FT                   /locus_tag="TTE0129"
FT                   /product="Zn finger protein HypA/HybF (possibly regulating
FT                   hydrogenase expression)"
FT                   /note="Best Blastp hit = gi|7445131|pir||B70388 hydrogenase
FT                   accessory protein HypA - Aquifex aeolicus
FT                   gi|2983520|gb|AAC07096.1| (AE000719) hydrogenase accessory
FT                   protein HypA [Aquifex aeolicus], score 70.9, E-value
FT                   5.00E-12"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23433"
FT                   /db_xref="GOA:Q8RDB2"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDB2"
FT                   /protein_id="AAM23433.1"
FT                   /translation="MHELSVTQGLVDMLVEEAEKRKVKKVTKVTVVIGELTGIESESVK
FT                   FYFDILTENTVAEGAELVFKIVRAQFKCTQCGNVFERSNFTFKCPVCGGQGVLIDKRGK
FT                   EFYIESIEVE"
FT   misc_feature    129970..130308
FT                   /gene="HybF"
FT                   /locus_tag="TTE0129"
FT                   /note="Pfam match to entry HypA, Hydrogenase
FT                   expression/synthesis hypA family, score 95.9, E-value
FT                   7.80E-25"
FT   gene            130301..130969
FT                   /gene="HypB"
FT                   /locus_tag="TTE0130"
FT   regulatory      130301..130305
FT                   /gene="HypB"
FT                   /locus_tag="TTE0130"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130313..130969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HypB"
FT                   /locus_tag="TTE0130"
FT                   /product="Ni2+-binding GTPase involved in regulation of
FT                   expression and maturation of urease and hydrogenase"
FT                   /note="Best Blastp hit = gi|3024003|sp|Q43949|HYPB_AZOCH
FT                   HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPB
FT                   gi|484409|pir||JN0647 hydrogenase expression/formation
FT                   protein HupB - Azotobacter chroococcum
FT                   gi|289235|gb|AAA22133.1| (L00674) hydrogenase accessory
FT                   protein HupB [Azotobacter chroococcum], score 187, E-value
FT                   8.00E-47"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23434"
FT                   /db_xref="GOA:Q8RDB1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB1"
FT                   /protein_id="AAM23434.1"
FT                   /translation="MEEIVIIRDVLETNKNIASENKAIKDERNILMVNLIGSPGAGKTS
FT                   FIIKAIEHMKVPCAVIEGDVTSDIDARKMAERNIPVVQINTGGACHLNAASVNKALQAL
FT                   NFDNGIVFIENVGNLICPSAFELGEDFKLAMANVPEGDDKPYKYPALFSKAKAVVLNKI
FT                   DMLPYFEFDRKFFYDGVRALNQEAPIFEVSARTGEGFGEFARWLEEEYHKFRQGK"
FT   misc_feature    130370..130744
FT                   /gene="HypB"
FT                   /locus_tag="TTE0130"
FT                   /note="Pfam match to entry HypB_UreG, HypB/UreG
FT                   nucleotide-binding domain, score 165.7, E-value 7.60E-46"
FT   gene            130900..133182
FT                   /gene="HypF"
FT                   /locus_tag="TTE0131"
FT   regulatory      130900..130904
FT                   /gene="HypF"
FT                   /locus_tag="TTE0131"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130927..133182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HypF"
FT                   /locus_tag="TTE0131"
FT                   /product="Hydrogenase maturation factor"
FT                   /note="Best Blastp hit = gi|7449699|pir||B70359
FT                   transcription regulator HypF - Aquifex aeolicus
FT                   gi|2983269|gb|AAC06863.1| (AE000701) transcriptional
FT                   regulatory protein HypF [Aquifex aeolicus], score 587,
FT                   E-value 1.00E-166"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23435"
FT                   /db_xref="GOA:Q8RDB0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="PDB:3VTH"
FT                   /db_xref="PDB:3VTI"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDB0"
FT                   /protein_id="AAM23435.1"
FT                   /translation="MVRGRVPQIQARQINIFGIVQGVGFRPFVFNIAQKYNLKGIVYNN
FT                   SSGLYIEVEGEEKDIEAFIREIKENPPSLSVIDEIQVREVEVKEYKDFKIVGSKEDGGF
FT                   VPVSPDMGVCEDCLRELKDPKDRRYRYPFINCTNCGPRFSIIEDIPYDRAKTSMKVFPM
FT                   CEKCSREYHDPHDRRFHAQPVACFDCGPSLSFVGEGCFDDEIKCVAKALKEGKIVAIKG
FT                   IGGFHLAVNALDDEAVATLRRRKKRYGKPFAVMMRDVEEVKKYCIVSPEEERLLLSQRR
FT                   PIVLLKKKGEKLAKGIADDLDTLGVMLPYAPIHYLLMEEIDFPIVMTSGNVSEEPICKD
FT                   NEEALEKLKDIADVFLLNNRDIVNRIDDSVTSFNAGAERIIRRARGYAPQPILLKKEVK
FT                   ASILAVGGFYKNTFCMTKGHYAFISHHIGDLDNEKAFNYYIEQIERYKKLFRVDPEVVA
FT                   HDMHKGYLSTQYAKSLDLPKIEVQHHHAHIASCMAEHNLDEKVIGIAYDGTGYGTDGNV
FT                   WGAEILVCDLKSFERIAHLKYKPLPGNELAIKKIYRTALGFIFDNISFYKNFVEQVDSR
FT                   ELDIILKQIDRKINTAYVSSMGRFFDAVAALIGVRKEVLFEGQAAMELESLMAESEEYY
FT                   EYEILKEDRYVIDPELILRQIYEDYMKGFEKSYISAKFHNTVVNFTYDLANLIRKETGI
FT                   NKVVLSGGSFQNRYLLRRLIEKLSLSGFEVYSNSKVPCNDGGISLGQAVIANKILEG"
FT   misc_feature    131551..132078
FT                   /gene="HypF"
FT                   /locus_tag="TTE0131"
FT                   /note="Pfam match to entry Sua5_yciO_yrdC, Sua5/yciO/yrdC
FT                   family, score 242.4, E-value 6.30E-69"
FT   gene            133172..133427
FT                   /gene="HypC"
FT                   /locus_tag="TTE0132"
FT   regulatory      133172..133176
FT                   /gene="HypC"
FT                   /locus_tag="TTE0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133185..133427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HypC"
FT                   /locus_tag="TTE0132"
FT                   /product="Hydrogenase maturation factor"
FT                   /note="Best Blastp hit = gi|7515025|pir||F75031 hydrogenase
FT                   expression/formation protein (hypc) PAB7315 - Pyrococcus
FT                   abyssi (strain Orsay) gi|5458660|emb|CAB50147.1| (AJ248287)
FT                   hydrogenase expression/formation protein (hypC) [Pyrococcus
FT                   abyssi], score 68.2, E-value 1.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23436"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA9"
FT                   /protein_id="AAM23436.1"
FT                   /translation="MCIAVPSKVLKIEGKIAETELGGVIRRVSIEMVPDVKVGDYVMVH
FT                   AGVAISIVDKEEAEAQRGLWNELMEVLNDAAEGNS"
FT   misc_feature    133188..133421
FT                   /gene="HypC"
FT                   /locus_tag="TTE0132"
FT                   /note="Pfam match to entry HupF_HypC, HupF/HypC family,
FT                   score 77.8, E-value 2.30E-19"
FT   gene            133390..134463
FT                   /gene="HypD"
FT                   /locus_tag="TTE0133"
FT   regulatory      133390..133394
FT                   /gene="HypD"
FT                   /locus_tag="TTE0133"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133402..134463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HypD"
FT                   /locus_tag="TTE0133"
FT                   /product="Hydrogenase maturation factor"
FT                   /note="Best Blastp hit =
FT                   gi|12232076|gb|AAG49378.1|AF325724_1 (AF325724) HypD-like
FT                   protein [Nostoc punctiforme], score 323, E-value 3.00E-87"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23437"
FT                   /db_xref="GOA:Q8RDA8"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA8"
FT                   /protein_id="AAM23437.1"
FT                   /translation="MMQQREIVEKAKKAIETLNPGIPFNIMEVCGSHTMAISKFGLRQV
FT                   LPKNIRLISGPGCPVCVTAQNEIDAVIELSNKNIVIATFGDLIRVPGNKSSLQKERAKG
FT                   KEVRVFYSPLDALKYAEENPQKEVVFIGIGFETTVPTVALTIKEAKERKIKNYSVYSLH
FT                   KTMPEALRALLVGGSNVQGFLLPGHVSAITGSRIYEFLPREFGVGGVISGFEAEDILMS
FT                   IVMLLKNYKNPTIEIQYKRVVKEEGNIEAQKIIEEVFEPCDSTWRGLGEIKGSGLKIRD
FT                   KYKDFDAALKFDIKPVGDEIEIKGCRCGDVLKGRIYPNECPLFGRVCTPDNPVGPCMVS
FT                   SEGSCAAFYKYGA"
FT   misc_feature    133411..134460
FT                   /gene="HypD"
FT                   /locus_tag="TTE0133"
FT                   /note="Pfam match to entry HypD, Hydrogenase formation hypA
FT                   family, score 583.2, E-value 1.60E-171"
FT   gene            134409..135464
FT                   /gene="HypE"
FT                   /locus_tag="TTE0134"
FT   CDS_pept        134409..135464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HypE"
FT                   /locus_tag="TTE0134"
FT                   /product="Hydrogenase maturation factor"
FT                   /note="Best Blastp hit =
FT                   gi|12232077|gb|AAG49379.1|AF325724_2 (AF325724) HypE-like
FT                   protein [Nostoc punctiforme], score 333, E-value 2.00E-90"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23438"
FT                   /db_xref="GOA:Q8RDA7"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:3VTI"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA7"
FT                   /protein_id="AAM23438.1"
FT                   /translation="MHGVFGRVLCSVLQVWRIRGDLMERVLLSHGGGGTMMEKLIEEVF
FT                   ADAFDNEYIRAMEDAALLFGNITLTTDSFTVKPLFFPGGDIGKLAVCGTVNDASMRGAK
FT                   PLFLTAAFIIEEGFPVEDLKKIVKSMAEAAKEAGVKIVAGDTKVVEKGSVDRIFINTSG
FT                   IGVLYEGANVSIKNAKPGDIVLISGTIGDHGMAVMSAREELQFDTPIFSDVAPLNGLIE
FT                   KLMTLGEAIKVLRDPTRGGVAEVLYEISKMSGVGIKIYEEKLPVKESVKSACEFMGIDF
FT                   LHLANEGKVVVVVERDYAEKALEIMKSHEYGKDAEIIGEVNDSKLVTINTIYGTSRIVD
FT                   RPIGELLPRIC"
FT   misc_feature    134466..134912
FT                   /gene="HypE"
FT                   /locus_tag="TTE0134"
FT                   /note="Pfam match to entry AIRS, AIR synthase related
FT                   protein, N-terminal domain, score 151.8, E-value 1.20E-41"
FT   misc_feature    134940..135371
FT                   /gene="HypE"
FT                   /locus_tag="TTE0134"
FT                   /note="Pfam match to entry AIRS_C, AIR synthase related
FT                   protein, C-terminal domain, score 144, E-value 1.60E-39"
FT   gene            135543..135764
FT                   /locus_tag="TTE0135"
FT   CDS_pept        135543..135764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23439"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA6"
FT                   /protein_id="AAM23439.1"
FT                   /translation="MVLRNMGEKELYTIIKAWENEGIICYFITFEFETGDRQEFMVGAD
FT                   TYGYLVEGDVGKLTFQGKKFLSFERTSI"
FT   gene            135955..136316
FT                   /gene="CheY"
FT                   /locus_tag="TTE0136"
FT   regulatory      135955..135959
FT                   /gene="CheY"
FT                   /locus_tag="TTE0136"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        135966..136316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CheY"
FT                   /locus_tag="TTE0136"
FT                   /product="CheY-like receiver domains"
FT                   /note="Best Blastp hit = gi|10176412|dbj|BAB07506.1|
FT                   (AP001520) two-component response regulator [Bacillus
FT                   halodurans], score 61.6, E-value 3.00E-09"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23440"
FT                   /db_xref="GOA:Q8RDA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA5"
FT                   /protein_id="AAM23440.1"
FT                   /translation="MSKILVVDDNKGICNLIEEIFRIDGHEVRSYTDISHFMEEIEDFV
FT                   PDVGIFDLSMAKDMVKIINKVKRIHPNMKGIVMSADEPTEPLKNLPFIAKPFDILELKK
FT                   LVYENLKQEMAV"
FT   gene            136337..137202
FT                   /gene="Fba"
FT                   /locus_tag="TTE0137"
FT   regulatory      136337..136341
FT                   /gene="Fba"
FT                   /locus_tag="TTE0137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136351..137202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fba"
FT                   /locus_tag="TTE0137"
FT                   /product="Fructose/tagatose bisphosphate aldolase"
FT                   /note="Best Blastp hit =
FT                   gi|6652729|gb|AAF22441.1|AF052204_1 '(AF052204)
FT                   fructose-1,6-bisphosphate aldolase [Thermus aquaticus]',
FT                   score 313, E-value 2.00E-84"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23441"
FT                   /db_xref="GOA:Q8RDA4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA4"
FT                   /protein_id="AAM23441.1"
FT                   /translation="MLVTGIEILEKAHKEGYAVGAFNTSNLEITQAIVEAAEETRSPVI
FT                   IQVSEGGLKYAGIEAISAIVRTLAEKATVPIALHLDHGTDFNTIMKCLRNGWTSVMIDA
FT                   SKFPLEENIQRTRKIVEIAHSMGVSVEAEIGKIGGTEDHITVDEREASMTDPEEALRFA
FT                   KETGVDYLAIAIGTAHGPYKGEPKLDFERLKRIKELLNMPLVLHGASGVPEEAIKKAVS
FT                   LGINKINIDTDVRQAFTARLRRLLEEDKEVYDPRKILGPCKEAMKEVIKQKMILFGSSL
FT                   KA"
FT   misc_feature    136351..137199
FT                   /gene="Fba"
FT                   /locus_tag="TTE0137"
FT                   /note="Pfam match to entry F_bP_aldolase,
FT                   Fructose-bisphosphate aldolase class-II, score 444.8,
FT                   E-value 7.30E-130"
FT   regulatory      137204..137218
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            137424..138903
FT                   /gene="Rho"
FT                   /locus_tag="TTE0138"
FT   regulatory      137424..137428
FT                   /gene="Rho"
FT                   /locus_tag="TTE0138"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137437..138903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Rho"
FT                   /locus_tag="TTE0138"
FT                   /product="Transcription termination factor"
FT                   /note="Best Blastp hit = gi|9247160|gb|AAD09997.2|
FT                   (AF072894) transcription terminator Rho factor [Listeria
FT                   monocytogenes], score 471, E-value 1.00E-131"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23442"
FT                   /db_xref="GOA:Q8RDA3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA3"
FT                   /protein_id="AAM23442.1"
FT                   /translation="MEFDINNLENLGLMELREIAKELGIKSITKYRKQQLREKIIEKVK
FT                   EKEEEKLKQEEKIPEENKENKEENKEEGEEEKVQSVALSNNGLQSQQAFLKENLPMVKD
FT                   LSDPLKELIQTQGDVVAEGILDILPDGFGFLRVENFTQGPKDIYISQSQIRRFGLKVGD
FT                   KVRGITRIPREGEKYSAILYVEAINDEDPEKAKKRIPFDELTPIFPNQKLRLETSPREF
FT                   SMRLVDLIAPIGKGQRGMIVAPPKAGKTTLLKQIANSISQNHPEVVLIVLLIDERPEEV
FT                   TDMKRSIKGEVVYSTFDELPEHHIKVAEMVLEHAKRLVEYKRDVVILLDSITRLARAYN
FT                   LVTPPSGRTLSGGIDPAALHPPKRFFGAARNIEEGGSLTILATALVETGSRMDEVIFEE
FT                   FKGTGNMELHLDRKLQERRIFPAIDIYKSGTRKEELLLTQEELEAMWILRKAMSNLPPQ
FT                   EVTEMIIEKLIRTKSNAEFVNMIRSQFYKS"
FT   misc_feature    137809..138744
FT                   /gene="Rho"
FT                   /locus_tag="TTE0138"
FT                   /note="Pfam match to entry ATP-synt_ab, ATP synthase
FT                   alpha/beta family, nucleotide-binding domain, score 239.2,
FT                   E-value 5.80E-68"
FT   gene            138956..139178
FT                   /gene="RpmE"
FT                   /locus_tag="TTE0139"
FT   regulatory      138956..138960
FT                   /gene="RpmE"
FT                   /locus_tag="TTE0139"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138969..139178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpmE"
FT                   /locus_tag="TTE0139"
FT                   /product="Ribosomal protein L31"
FT                   /note="Best Blastp hit = gi|417666|sp|Q03223|RL31_BACSU 50S
FT                   RIBOSOMAL PROTEIN L31 gi|1075905|pir||S55431 ribosomal
FT                   protein L31 - Bacillus subtilis gi|143435|gb|AAA02901.1|
FT                   (M97678) ribosomal protein L31 [Bacillus subtilis]
FT                   gi|853770|emb|CAA89878.1| (Z49782) ribosomal protein L31
FT                   [Bacillus subtilis] gi|2636232|emb|CAB15724.1| (Z99122)
FT                   ribosomal protein L31 [Bacillus subtilis]
FT                   gi|2636244|emb|CAB15735.1| (Z99123) ribosomal protein L31
FT                   [Bacillus subtilis], score 93.2, E-value 4.00E-19"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23443"
FT                   /db_xref="GOA:Q8RDA2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDA2"
FT                   /protein_id="AAM23443.1"
FT                   /translation="MKPGIHPTYYHDAVVKCACGNTFITGSTKKEIRVEICSKCHPFFT
FT                   GQQKIVDTGGRVERFRKRFNLEEK"
FT   misc_feature    138969..139169
FT                   /gene="RpmE"
FT                   /locus_tag="TTE0139"
FT                   /note="Pfam match to entry Ribosomal_L31, Ribosomal protein
FT                   L31, score 154.1, E-value 2.40E-42"
FT   regulatory      139185..139209
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            139238..139830
FT                   /gene="Tdk"
FT                   /locus_tag="TTE0140"
FT   regulatory      139238..139242
FT                   /gene="Tdk"
FT                   /locus_tag="TTE0140"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139249..139830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tdk"
FT                   /locus_tag="TTE0140"
FT                   /product="Thymidine kinase"
FT                   /note="Best Blastp hit = gi|729902|sp|Q03221|KITH_BACSU
FT                   THYMIDINE KINASE gi|1075925|pir||S55432 thymidine kinase
FT                   (EC 2.7.1.21) tdk - Bacillus subtilis
FT                   gi|405819|gb|AAA02902.1| (M97678) thymidine kinase
FT                   [Bacillus subtilis] gi|853771|emb|CAA89879.1| (Z49782)
FT                   thymidine kinase [Bacillus subtilis]
FT                   gi|2636231|emb|CAB15723.1| (Z99122) thymidine kinase
FT                   [Bacillus subtilis] gi|2636243|emb|CAB15734.1| (Z99123)
FT                   thymidine kinase [Bacillus subtilis], score 231, E-value
FT                   4.00E-60"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23444"
FT                   /db_xref="GOA:Q8RDA1"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RDA1"
FT                   /protein_id="AAM23444.1"
FT                   /translation="MIYGSLDHGFIEVIVGPMFSGKSEELIRRIRRAQIAKQKVQVFKP
FT                   AIDDRYSIDKVVSHNGSSINAISVTKASEILDLLEEDTQVVAIDEIQFFDHSLVDVVRE
FT                   IADMGKRVICAGLDMDFRGEPFGVTPDIMAIAESVDKLTAICVKCGNPATRTQRLINGK
FT                   PAKYDDPIILVGAHETYEARCRKCHEVPRT"
FT   misc_feature    139273..139812
FT                   /gene="Tdk"
FT                   /locus_tag="TTE0140"
FT                   /note="Pfam match to entry TK, Thymidine kinase, score
FT                   274.6, E-value 1.50E-95"
FT   gene            139770..140773
FT                   /locus_tag="TTE0141"
FT   regulatory      139770..139774
FT                   /locus_tag="TTE0141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139778..140773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7462094|pir||A72239 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982117|gb|AAD36616.1|AE001801_3 (AE001801) conserved
FT                   hypothetical protein [Thermotoga maritima], score 159,
FT                   E-value 4.00E-38"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23445"
FT                   /db_xref="GOA:Q8RDA0"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDA0"
FT                   /protein_id="AAM23445.1"
FT                   /translation="MRLTKQGAESATKFRVHKDGGAVMKKTDIGGQAVIEGVMMRGHKS
FT                   YAIALRKGEEIIIKKEYAVPLTRKNKFFSLPFIRGTFALIDSLVIGIKSLTYSAEVFEE
FT                   EESIEPTRFDVFLQRIFGEKLEDILMYFSVIISLILSIVIFFIGPTYVTDYARLFTKNT
FT                   IVINFVEGTLRVLIFILYLLLIAQMKDIKRIFEYHGAEHKAIHCLEHEEELTVENARKY
FT                   TTLHPRCGTNFLFIVMIISIIVFSFLKWPSLYVRILSRIFLLPVVAGISYEVIKLAGRS
FT                   NNKILALFVYPGLLLQKITTKEPDDKQLEVAIASLKSVLQDEGGREFESI"
FT   gene            140703..141599
FT                   /gene="HemK"
FT                   /locus_tag="TTE0142"
FT   regulatory      140703..140707
FT                   /gene="HemK"
FT                   /locus_tag="TTE0142"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140742..141599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HemK"
FT                   /locus_tag="TTE0142"
FT                   /product="predicted rRNA or tRNA methylase"
FT                   /note="Best Blastp hit = gi|1170229|sp|P45873|HEMK_BACSU
FT                   HEMK PROTEIN HOMOLOG gi|1075945|pir||S55438
FT                   protoporphyrinogen oxidase homolog ywkE - Bacillus subtilis
FT                   gi|853777|emb|CAA89885.1| (Z49782) product similar to
FT                   E.coli PRFA2 protein [Bacillus subtilis]
FT                   gi|2636225|emb|CAB15717.1| (Z99122) similar to
FT                   protoporphyrinogen oxidase [Bacillus subtilis], score 145,
FT                   E-value 8.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23446"
FT                   /db_xref="GOA:Q8RD99"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD99"
FT                   /protein_id="AAM23446.1"
FT                   /translation="MKGGGSLKVYEAIALGAKELESVCPNPRLESELLLSHSLRIDRVK
FT                   LAIKRDEVLKEEELERFLKYIEKRKSRIPYQYIVKKQHFMGFEFYVDERVLIPRPETEI
FT                   LVEEALKRMKSGDLILDIGTGSGAIAISIAKLFPDCKVYAVDVSEEALEVAKYNAEKLG
FT                   VAEKIIFIKSDIFSNIPQDVKFDLIVSNPPYIKKAELENLQEEVKKEPILALDGGEDGL
FT                   FFYKRIIPDCKFYLKKGGRGLFEIGYGQREEVEKIFLENGFDEIEVIKDLAHIDRVIIG
FT                   RYNS"
FT   gene            141638..142718
FT                   /gene="PrfA"
FT                   /locus_tag="TTE0143"
FT   regulatory      141638..141642
FT                   /gene="PrfA"
FT                   /locus_tag="TTE0143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141648..142718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PrfA"
FT                   /locus_tag="TTE0143"
FT                   /product="Protein chain release factor A"
FT                   /note="Best Blastp hit = gi|10176399|dbj|BAB07494.1|
FT                   (AP001519) peptide chain release factor 1 in translation
FT                   [Bacillus halodurans], score 397, E-value 1.00E-109"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23447"
FT                   /db_xref="GOA:Q8RD98"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD98"
FT                   /protein_id="AAM23447.1"
FT                   /translation="MIEKLQAIEDRYVELSQKISDPNVISNVEEWRKYVKEHAAIEDIV
FT                   LKYREYKKVLEEIKATEELLSSQDEELKEMAEEELSQLEEKKEKLMEEIKILLLPKDPN
FT                   DEKNVIMEIRAGAGGEEAALFAYDLFRMYTMYAEKKGWKVEIMSANKTDIGGFKEVIFS
FT                   ISGKGAYSRLKYESGVHRVQRIPTTEAGGRIHTSTATVAVLPEAEEVDVEINPNDIKID
FT                   VFRSSGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQIQNRERALKILRAKLYEMALK
FT                   EQQREIAEARKSQVGTGERSERIRTYNFPQGRVTDHRIGLTLYKLQEVLDGELDEIIDA
FT                   LILNDQAEKLKNMTLN"
FT   misc_feature    142260..142601
FT                   /gene="PrfA"
FT                   /locus_tag="TTE0143"
FT                   /note="Pfam match to entry RF-1, Peptidyl-tRNA hydrolase
FT                   domain, score 265.8, E-value 5.70E-76"
FT   regulatory      142837..142864
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            142933..143665
FT                   /locus_tag="TTE0144"
FT   regulatory      142933..142937
FT                   /locus_tag="TTE0144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142946..143665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0144"
FT                   /product="predicted divalent heavy-metal cations
FT                   transporter"
FT                   /note="Best Blastp hit = gi|7445216|pir||A72218 gufA
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982315|gb|AAD36803.1|AE001812_13 (AE001812) gufA
FT                   protein [Thermotoga maritima], score 90.5, E-value
FT                   2.00E-17"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23448"
FT                   /db_xref="GOA:Q8RD97"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD97"
FT                   /protein_id="AAM23448.1"
FT                   /translation="MSNFEILMIGAFAGVAGTGLGGVFAYFFKNPNPKFFSGIMGITAG
FT                   LMLSVVMFDLLPHSFEISGMPVGVIGVIIGAFLISLFDSHIEKTKFNKGFIREGLLLGI
FT                   AIALHNFPEGLAVGSGFMVSSSLGIDIALVIALHDFPEGVAVAVPLSAGGVSPCKVLLY
FT                   TFLTGLPTALGTFIGILSGGISNTFIGLNLALAGGAMLYVTCGEIIPEARDIYRGKISI
FT                   LGMILGVIGGIIITRYL"
FT   gene            143680..144757
FT                   /gene="Sua5"
FT                   /locus_tag="TTE0145"
FT   regulatory      143680..143684
FT                   /gene="Sua5"
FT                   /locus_tag="TTE0145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143690..144757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Sua5"
FT                   /locus_tag="TTE0145"
FT                   /product="putative translation factor (Sua5)"
FT                   /note="Best Blastp hit = gi|7429862|pir||D71154
FT                   hypothetical protein PH0435 - Pyrococcus horikoshii
FT                   gi|3256838|dbj|BAA29521.1| (AP000002) 340aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 370,
FT                   E-value 1.00E-101"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23449"
FT                   /db_xref="GOA:Q8RD96"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD96"
FT                   /protein_id="AAM23449.1"
FT                   /translation="MMTKVIKIDKDNPEIELIDYAAEVIKKGGLVAFPTETVYGIGANS
FT                   FDEEAVKRIFIAKGRPQDNPLILHIALMDQVYELAAEFPEKAKKLAHRFWPGPLTVVLK
FT                   KSDKVPYVNTAGMNTVAIRMPSNPIAHLLIKRAGVPISAPSANVSGKPSPTDASHVIED
FT                   LYGKVDVIIDGGKCDVGLESTVVDLTEEVPVILRPGAVTLEMLKEVLGEVKLDPSLLTR
FT                   PDENIKPKSPGMKYKHYSPKAEVYIVKGPLDKVVKKIQQLAKNQLKNGKKVGIMATVQT
FT                   STQYKEGEIIVVGDRDKPETIAKNLFETLREFDRRGVEVVFAESFNYDDIGLAIMNRLE
FT                   KAAGYKEIKAEGELT"
FT   misc_feature    143753..144286
FT                   /gene="Sua5"
FT                   /locus_tag="TTE0145"
FT                   /note="Pfam match to entry Sua5_yciO_yrdC, Sua5/yciO/yrdC
FT                   family, score 234.3, E-value 1.70E-66"
FT   gene            144742..145662
FT                   /gene="RpiB"
FT                   /locus_tag="TTE0146"
FT   regulatory      144742..144746
FT                   /gene="RpiB"
FT                   /locus_tag="TTE0146"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144754..145662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpiB"
FT                   /locus_tag="TTE0146"
FT                   /product="Ribose 5-phosphate isomerase RpiB"
FT                   /note="Best Blastp hit = gi|10176391|dbj|BAB07486.1|
FT                   (AP001519) ribose 5-phosphate epimerase (pentose phosphate)
FT                   [Bacillus halodurans], score 167, E-value 1.00E-40"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23450"
FT                   /db_xref="GOA:Q8RD95"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="PDB:4EGS"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD95"
FT                   /protein_id="AAM23450.1"
FT                   /translation="MRVLFVCTGNTCRSPMAEGIFNAKSKALGKDWEAKSAGVFAPEGF
FT                   PASSEAVEVLKKEYGIDISDHRAKSLREEDLKGADLVLAMAFSHKRSLVSQYPEYADKI
FT                   FTIKEFVGLEGDVEDPYGMPLEVYKKTAEELSGLIDKLIEKLSEERKVDRMIALGSDHA
FT                   GYELKEVIKKYLEEKGIPYKDFGTFNEESVDYPDYALKVAEAVASGECTEGILVCGTGI
FT                   GMSITANKVPGIRAAHVEDVFSARAAKEHNNANILCMGGRVTGPGLAIMMVEEWLNATF
FT                   QGGRHQKRIDKITEIEKKYMK"
FT   misc_feature    144754..145188
FT                   /gene="RpiB"
FT                   /locus_tag="TTE0146"
FT                   /note="Pfam match to entry LMWPc, Low molecular weight
FT                   phosphotyrosine protein phosphatase, score 143, E-value
FT                   5.30E-39"
FT   misc_feature    145393..145635
FT                   /gene="RpiB"
FT                   /locus_tag="TTE0146"
FT                   /note="Pfam match to entry LacAB_rpiB, Ribose/Galactose
FT                   Isomerase, score 177.3, E-value 2.50E-49"
FT   gene            145668..146317
FT                   /gene="Upp"
FT                   /locus_tag="TTE0147"
FT   regulatory      145668..145672
FT                   /gene="Upp"
FT                   /locus_tag="TTE0147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145685..146317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Upp"
FT                   /locus_tag="TTE0147"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /note="Best Blastp hit = gi|11258310|pir||T48896 uracil
FT                   phosphoribosyltransferase (EC 2.4.2.9) upp [validated] -
FT                   Bacillus caldolyticus gi|1765902|emb|CAA67884.1| (X99545)
FT                   uracil phosphoribosyltransferase [Bacillus caldolyticus],
FT                   score 322, E-value 2.00E-87"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23451"
FT                   /db_xref="GOA:Q8RD94"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD94"
FT                   /protein_id="AAM23451.1"
FT                   /translation="MYENVFVIDHPLIQHKISLIRDENTGSKEFRELVGEIAMLMAYEV
FT                   TRDLPLEEIEVKTPIAVAKTKVIAGKKLGIIPILRAGLVMADGMLKLIPTAKVGHIGIY
FT                   RDPETLKPVEYYCKLPSDIAERDLIVVDPMLATGGSASAAIHFLKERGAQSIKLVNLIA
FT                   APEGIKAVHKDHPEVPIYVASIDQGLNEHGYIVPGLGDAGDRLFGTK"
FT   misc_feature    145778..146236
FT                   /gene="Upp"
FT                   /locus_tag="TTE0147"
FT                   /note="Pfam match to entry Pribosyltran, Phosphoribosyl
FT                   transferase domain, score 52.1, E-value 1.20E-11"
FT   gene            146268..146774
FT                   /gene="ComEB"
FT                   /locus_tag="TTE0148"
FT   CDS_pept        146268..146774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ComEB"
FT                   /locus_tag="TTE0148"
FT                   /product="Deoxycytidylate deaminase"
FT                   /note="Best Blastp hit = gi|11499353|ref|NP_070592.1| 'dCMP
FT                   deaminase, putative [Archaeoglobus fulgidus]'
FT                   gi|7448896|pir||C69470 dCMP deaminase homolog -
FT                   Archaeoglobus fulgidus gi|2648787|gb|AAB89487.1|
FT                   '(AE000981) dCMP deaminase, putative [Archaeoglobus
FT                   fulgidus]', score 200, E-value 9.00E-51"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23452"
FT                   /db_xref="GOA:Q8RD93"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD93"
FT                   /protein_id="AAM23452.1"
FT                   /translation="MFQGWGMLEIDCLELSEERIKMRPSWDEYFMQIVDVVKTRSTCIR
FT                   RQVGAILVVDKHIISTGYNGPPTGLPHCEETGCLRDQLGIPPGERPELCRGVHAEQNAI
FT                   IQAALHGVSTKGATLYVSASPCVICAKMLINAGVKRIVYEEEYPDELAFQLLKEAGIEL
FT                   VKFKR"
FT   misc_feature    146337..146702
FT                   /gene="ComEB"
FT                   /locus_tag="TTE0148"
FT                   /note="Pfam match to entry dCMP_cyt_deam, Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region, score 144.3,
FT                   E-value 2.10E-39"
FT   regulatory      146798..146810
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   repeat_region   146810..150374
FT                   /note="TLR028, identity:100%, copy 1"
FT   gene            complement(146967..148207)
FT                   /locus_tag="TTE0151"
FT                   /note="authentic frameshift, transposase; Best Blastx hit =
FT                   dbj|BAB07760.1| (AP001520) BH4041; unknown conserved
FT                   protein in others [Bacillus halodurans], score 71.6,
FT                   E-value 3.00E-20"
FT   gene            148370..148569
FT                   /locus_tag="TTE0152"
FT   regulatory      148370..148374
FT                   /locus_tag="TTE0152"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148417..148569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23453"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I8"
FT                   /protein_id="AAM23453.1"
FT                   /translation="MVMLLYQHATGVSQKYLSKLKRDLLLLSLSETKDHLNKNEKFNYE
FT                   IVLPG"
FT   gene            148727..150025
FT                   /locus_tag="TTE0153"
FT   regulatory      148727..148731
FT                   /locus_tag="TTE0153"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148742..150025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0153"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 338, E-value 6.00E-92"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23454"
FT                   /db_xref="GOA:Q8R6J5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J5"
FT                   /protein_id="AAM23454.1"
FT                   /translation="MNKVQKLLLVHSSDIIFVGVDVAKKTHYARIINHIGLEVIKPFKF
FT                   NNSIDGYERLVSKILEAKEKSKATKILIGFEPSGHYWKPLAWFLKEKGYTVVIVNPYHV
FT                   KQRKEEEDNSPSKNDRKDALIIARLIKEGKFLNCLLPQNTYADLRNLSVARKQLIKKLN
FT                   SVKNKIIAILDEYFPEFEEVFKNLWGKAALWILRNCPFPSIILKLSKEEIAEQLKKATN
FT                   NRVGMKRAEKLIEAAKKSIGVKEGIKGAQIRLNIYLDELEFLKTQLETIEKAMEELLKK
FT                   IDIAEYLLSIPGIGVITVAGFLAEVGDIGKYTHYKQIQKLGGLNITDNQSGKHRGKTKI
FT                   SKRGRPELRNLLYKASLTLVAKNKEFKALYNYFLRRRENPLEKKQALIAISIKLIRVMF
FT                   TLAKKKEKYDSQKVLGEYRMKQIKELVA"
FT   misc_feature    149006..149299
FT                   /locus_tag="TTE0153"
FT                   /note="Pfam match to entry Transposase_9, Transposase,
FT                   score 52.6, E-value 8.50E-12"
FT   misc_feature    149522..149851
FT                   /locus_tag="TTE0153"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 87.4, E-value 3.00E-22"
FT   gene            150368..151421
FT                   /gene="Rfe"
FT                   /locus_tag="TTE0154"
FT   regulatory      150368..150372
FT                   /gene="Rfe"
FT                   /locus_tag="TTE0154"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150381..151421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Rfe"
FT                   /locus_tag="TTE0154"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /note="Best Blastp hit = gi|7449552|pir||B69721 teichoic
FT                   acid linkage unit synthesis tagO - Bacillus subtilis
FT                   gi|2582651|emb|CAA06152.1| (AJ004803) putative
FT                   undecaprenyl-phosphate N-acetylglucosaminyltransferase
FT                   [Bacillus subtilis] gi|2636079|emb|CAB15570.1| (Z99122)
FT                   alternate gene name: yvhI [Bacillus subtilis], score 236,
FT                   E-value 3.00E-61"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23455"
FT                   /db_xref="GOA:Q8RD92"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD92"
FT                   /protein_id="AAM23455.1"
FT                   /translation="MKIYFLSFILAFAMSFVTTPLVKKLAFAIGAIDVPDDKRRIHTKP
FT                   IPRLGGLAIFAGTMASLLLLLPKSHETIGIILGSLVIVLLGVLDDKYTLSAKVKLVGQI
FT                   AAALILILSGIRIDWISNPFGSGVIYLKSWVAISLTLLWVVGVTNTINLIDGLDGLAAG
FT                   IAFISSTSLFIISLLNGRYATAVISIAIAGASLGFLPYNFNPAKIFMGDTGAMFLGFLL
FT                   SAISIQGAIKSATAIAIVVPVLVLGVPIFDTLFAIIRRILNKRPIMEADRGHLHHRLLD
FT                   KGLNQKQVVFILYGVSLVLGVSAILISFVSELKSLVILAVSLLFILWGANKIELLRSNK
FT                   KGTQTR"
FT   misc_feature    150594..151085
FT                   /gene="Rfe"
FT                   /locus_tag="TTE0154"
FT                   /note="Pfam match to entry Glycos_transf_4, Glycosyl
FT                   transferase, score 193.4, E-value 3.50E-54"
FT   gene            151430..152602
FT                   /gene="WecB"
FT                   /locus_tag="TTE0155"
FT   regulatory      151430..151434
FT                   /gene="WecB"
FT                   /locus_tag="TTE0155"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151445..152602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WecB"
FT                   /locus_tag="TTE0155"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="Best Blastp hit = gi|7448295|pir||A72304
FT                   UDP-N-acetylglucosamine 2-epimerase - Thermotoga maritima
FT                   (strain MSB8) gi|4981575|gb|AAD36111.1|AE001764_14
FT                   (AE001764) UDP-N-acetylglucosamine 2-epimerase [Thermotoga
FT                   maritima], score 422, E-value 1.00E-117"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23456"
FT                   /db_xref="GOA:Q8RD91"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD91"
FT                   /protein_id="AAM23456.1"
FT                   /translation="MGIKIMAVFGTRPEAIKMAPLIKALEKEKEFDTQVAVTAQHREML
FT                   DQVLRLFNIVPQYDLNIMRERQTLSDITTAAIDGLDRVFLKEKPNLVLVHGDTTTTFAA
FT                   ALVAFYHKIKVGHVEAGLRSFNKWFPYPEEINRKLTGVLADLHFAPTKRAKLNLLNEGV
FT                   EEESIFVTGNTVIDAMSYTVKKDYTFREERLNRIDYKNKKVIVVTAHRRENWGAPLENI
FT                   CNAIKDIAKSYKEEVYFIYPVHMNPVVKNTAHKILGGFDNVLLLDPLETDEMHNLLARC
FT                   YMVMTDSGGLQEEVPSLGKPVLVLRDVTERPEAKEAGTVKLVGTDYERIFKEAKLLIED
FT                   ENEYKKMANAVNPYGDGKASVRIVGAIKYFFGLSKEKPEEYEGGG"
FT   misc_feature    151574..152548
FT                   /gene="WecB"
FT                   /locus_tag="TTE0155"
FT                   /note="Pfam match to entry Epimerase_2,
FT                   UDP-N-acetylglucosamine 2-epimerase, score 599.2, E-value
FT                   2.60E-176"
FT   gene            complement(152621..152931)
FT                   /locus_tag="TTE0156"
FT   CDS_pept        complement(152621..152917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23457"
FT                   /db_xref="GOA:Q8RD90"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD90"
FT                   /protein_id="AAM23457.1"
FT                   /translation="MFWLMVLIVGLISSLVFHPLFNTKAGEGYWDKLNKIWGTYWAALI
FT                   AHLVGAWLGGAYLGKWGWMLYDYNVISGFIGAIVIGYIWYLIAKSQTKQEASK"
FT   regulatory      complement(152927..152931)
FT                   /locus_tag="TTE0156"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            153233..153987
FT                   /locus_tag="TTE0157"
FT   regulatory      153233..153237
FT                   /locus_tag="TTE0157"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153247..153987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10176374|dbj|BAB07469.1|
FT                   (AP001519) BH3750; unknown conserved protein in B. subtilis
FT                   [Bacillus halodurans], score 52.8, E-value 4.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23458"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD89"
FT                   /protein_id="AAM23458.1"
FT                   /translation="MKKTLAGLILFASFFVGFKGEIFFHNKSDADRLYDVFKKTHARYE
FT                   YSNINGWGKIGECFCALEDLEKYAKDVAEEMKALKGAKLSRMDEGNLRQVSLEYLDDKR
FT                   SVTLVVQSIKNGDKKETYLLIDNYLIKGNQNILEERKTVENAFRKVKVKPVVATSIVGS
FT                   FEGKLKLEEASSIVKEVFKELRAKKVEGLEDVQVVSISGYTRSFGEYIEVGDEKINLQV
FT                   ALRYNSYDDRTYIWIASPLIATEY"
FT   gene            153988..155244
FT                   /gene="MurA"
FT                   /locus_tag="TTE0158"
FT   regulatory      153988..153992
FT                   /gene="MurA"
FT                   /locus_tag="TTE0158"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153997..155244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MurA"
FT                   /locus_tag="TTE0158"
FT                   /product="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /note="Best Blastp hit = gi|10176373|dbj|BAB07468.1|
FT                   (AP001519) UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase [Bacillus halodurans], score 458,
FT                   E-value 1.00E-128"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23459"
FT                   /db_xref="GOA:Q8RD88"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD88"
FT                   /protein_id="AAM23459.1"
FT                   /translation="MKTKFVVEKSPPLKGTVKISGAKNSVLPIIAASLLSSDEVILEDI
FT                   PSLEDVNVMIELIKNFGALCELDNGKLKIKVDIKDVEAPYELVKKMRASFLVMGPILAK
FT                   LGHAKISMPGGCAIGARPIDLHLKGFQSLGADITIGHGYVEARAKKLTGKKIYLDFPSV
FT                   GATENIMMAAVFADGVTVIENAAEEPEIVDLANFLNKMGANIKGAGTDTIRIEGVKELK
FT                   GAEHTVIPDRIEAGTFMVAAAMTGGNVLIENVIVDHVRSVIAKLTECGVKITEEKGGLR
FT                   VKGVKNYKAVDIKTLPYPGFPTDMQAQMMAMMTVAKGTSVIIETVFENRFMHVSELKRM
FT                   GANIKIEGRSAMITGVDHLTGAEVKATDLRAGAALVLAGLIAEGRTEINDIYHVDRGYV
FT                   KMEEKLRALGAKIYRK"
FT   misc_feature    154015..155211
FT                   /gene="MurA"
FT                   /locus_tag="TTE0158"
FT                   /note="Pfam match to entry EPSP_syntase, EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase), score
FT                   515.3, E-value 4.50E-151"
FT   gene            155357..157312
FT                   /locus_tag="TTE0159"
FT   regulatory      155357..155361
FT                   /locus_tag="TTE0159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155369..157312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10584311|gb|AAG20912.1|
FT                   (AE005158) Vng6268c [Halobacterium sp. NRC-1], score 338,
FT                   E-value 1.00E-91"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23460"
FT                   /db_xref="GOA:Q8RD87"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD87"
FT                   /protein_id="AAM23460.1"
FT                   /translation="MAKVKESDKRKLSHEAYGGVHGSEYIPFIPADKVLPELTAVAVIV
FT                   GSLFAILFAAANAYLGLKAGMTISAAIPAAVLATALLKGVFKRDSILESNLVMAIAATG
FT                   ESLAGGIIFTLPAIVLWGLKDEFTLTRIVFVILIGGLLGALFVIPLRRYLTVEEHGKLI
FT                   YPEGMAAAEVLVTSNQGGTGFMTVLSGMIVGGIYKLLSGGFGMWSENPSWVIKRFESTE
FT                   VGVNVLASLMGVGFIVGLDVAMYMLAGSVLAWLGLIPLIKFFGAGLTTPVYPATDLIRD
FT                   MSAGAIWSKYIRYIGAGGVLAGGFISLIKALPTIIKAFRESIVGLGMKGKELKRTDVDV
FT                   SLTWVIFGAAFVFFVAWLMPSLGVTALGSLMAVLFAFFFAVVSARITGLVGVSNNPISG
FT                   MTIATLLIVTSVLKLAGVVGNEGMIIAITIGGIVCVAAAIAGANAQSLKTTFIIGGTPK
FT                   YIEIFTYVGIAVASIFAGLVLILLNNAYGFGTKDIPAPQATIMSMVVKGIMTGDLPWTF
FT                   IIAGIFMGIMAEMMHVPVLPFAIGLYLPFELSAAIAVGGIIRWIVDQQYRKDEQLRKEK
FT                   VEKGILVASGLVAGDALMGLVIAIFAGAKISIDFASNWATNTSSFAPWFSLLMFLLVGL
FT                   FLYYYTVKNDKK"
FT   regulatory      157315..157344
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            157349..157705
FT                   /locus_tag="TTE0160"
FT   regulatory      157349..157353
FT                   /locus_tag="TTE0160"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157361..157705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7518600|pir||E71143
FT                   hypothetical protein PH0360 - Pyrococcus horikoshii
FT                   gi|3256751|dbj|BAA29434.1| (AP000002) 108aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 84,
FT                   E-value 6.00E-16"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23461"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD86"
FT                   /protein_id="AAM23461.1"
FT                   /translation="MKDNFLLYVPKKSEKVNWEKRGDKVMFLFYHDKLIEKMVRLFVKK
FT                   PRVTTLELDDIGTAVWELIDGEKNVYEIGQQLKERFGERVEPLYERLSLFMRYLNRRGW
FT                   IYFSKKGDTK"
FT   gene            157808..158946
FT                   /gene="Ald"
FT                   /locus_tag="TTE0161"
FT   regulatory      157808..157812
FT                   /gene="Ald"
FT                   /locus_tag="TTE0161"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157822..158946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Ald"
FT                   /locus_tag="TTE0161"
FT                   /product="Alanine dehydrogenase"
FT                   /note="Best Blastp hit = gi|10175803|dbj|BAB06899.1|
FT                   (AP001518) alanine dehydrogenase [Bacillus halodurans],
FT                   score 426, E-value 1.00E-118"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23462"
FT                   /db_xref="GOA:Q8RD85"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD85"
FT                   /protein_id="AAM23462.1"
FT                   /translation="MRIGVPKEIKTAESRVAITPAGVEAFVKNGHEVYIEKDAGLGSGI
FT                   TNEEYEKAGAKILPTAKEVYDIADMIMKVKEPQPSEYDYLKEGQVLFTYLHLAPDKQQT
FT                   EALLRQKVVGIAYETVQLDNGSLPLLTPMSEVAGRMAVTIGAYLLTSINQGRGIVMGGV
FT                   PGVEPAEVVIIGGGTVGTNAAKVAVGMGARVTILDVNPARLAYLDDIFGGRVTTLMSNS
FT                   FNIAESVKKADLLIGAVLIPGARAPKLVTEEMVKTMKKGAVIVDVAIDQGGCVETCDRT
FT                   TSHTDPYFIKHGVVHYSVPNIPGAVPRTSTFALTNVTLPYALEIANKGYKRALLENRAL
FT                   LKGLNVYKGMVTYKPVAEAQGLEYVDPVEALNKA"
FT   misc_feature    157822..158937
FT                   /gene="Ald"
FT                   /locus_tag="TTE0161"
FT                   /note="Pfam match to entry AlaDh_PNT, Alanine
FT                   dehydrogenase/pyridine nucleotide transhydrogenase, score
FT                   701.9, E-value 3.00E-207"
FT   regulatory      158955..158977
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   repeat_region   158988..159211
FT                   /note="TLR027, identity:89%, copy 4"
FT   repeat_region   159374..159689
FT                   /note="TLR115, identity:89%, copy 1"
FT   gene            159453..159655
FT                   /locus_tag="TTE0162"
FT   regulatory      159453..159457
FT                   /locus_tag="TTE0162"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159467..159655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0162"
FT                   /product="Orf in partial transposon"
FT                   /note="Best Blastp hit = gi|13815201|gb|AAK42123.1|
FT                   (AE006801) First ORF in partial transposon ISC1913
FT                   [Sulfolobus solfataricus], score 48.9, E-value 9.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23463"
FT                   /db_xref="GOA:Q8RD84"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD84"
FT                   /protein_id="AAM23463.1"
FT                   /translation="MIEERPKPKVVLYVRVSTKKQEEYLKNQIRRLEEYANSQGWQYEV
FT                   IHEIASGVNKIKNWQRT"
FT   gene            159699..161149
FT                   /locus_tag="TTE0163"
FT   regulatory      159699..159703
FT                   /locus_tag="TTE0163"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   159707..161186
FT                   /note="TLR014, identity:90%, copy 2"
FT   CDS_pept        159713..161149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23464"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD83"
FT                   /protein_id="AAM23464.1"
FT                   /translation="MIVIQAKLIFLNQEDKQRALDLMRRWSSCMRFAYKRLLEGYDRKT
FT                   LKRDLQGMFDLNSRYVDDAIMKARSTLESARELGNNPKKVIFGGRDLFKKLQKHHINGK
FT                   AYERLKIRWQEKRKGNLYSRGDKSKKGNLNTRIEIKENGTFLRINVGERKYVYAKIEAG
FT                   YKKNKRREELLQEITKSDIPYSVELKLKNGSIYAYFAVEEEYPEIKITKEKGVIGIDIN
FT                   AYPDNISWAEVDEEGNLTSYGSIPMPELASGSKEKREYYRWQYAHEIIKIAKEKGKAIV
FT                   IEKLDIKDKGKKGDFSGRKSRRIRHSFSYKSLLSKIKTLAKREGIEVIEVDPSYTSIIG
FT                   MLKYAPQYMITKDTAAAYVIARRGLGKEEKIPDNYMKFLNALTVEELEELKEHVKKTVR
FT                   NKKLKKKHLKEIKKAIEFLQSLESEPGRVLKPLGGTSFSTHDFWRVLKAAVVIPLSPEK
FT                   VPRDFSVLKELLIQGKWGDP"
FT   repeat_region   161170..161294
FT                   /note="TLR042, identity:98%, copy 1"
FT   gene            161351..163035
FT                   /gene="PpsA"
FT                   /locus_tag="TTE0164"
FT   regulatory      161351..161355
FT                   /gene="PpsA"
FT                   /locus_tag="TTE0164"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161365..163035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PpsA"
FT                   /locus_tag="TTE0164"
FT                   /product="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /note="Best Blastp hit = gi|7521303|pir||E72754 probable
FT                   phosphoenolpyruvate synthase APE0026 - Aeropyrum pernix
FT                   (strain K1) gi|5103414|dbj|BAA78935.1| (AP000058) 622aa
FT                   long hypothetical phosphoenolpyruvate synthase [Aeropyrum
FT                   pernix], score 68.2, E-value 3.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23465"
FT                   /db_xref="GOA:Q8RD82"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD82"
FT                   /protein_id="AAM23465.1"
FT                   /translation="MLEIFSGKKYKIFGNGSIGGKASGLSFAEEVLEKYYKDFKGTVKI
FT                   PESFFIATDYYEMFLEYNRLEDIDENTPYEEAEIRFKEAEFPPEYKKMLKEILQVMDYP
FT                   LAVRSSSLLEDNIKYSFAGKYYTTFISNRGTERERLKQLEKAIKEVYLSVYGPDAVTYR
FT                   KKHASGQRELMGVIVQRLIGSQKGIYFYPDVSGVGFSRNYRRWTDRIKIEDGVVRLVFG
FT                   LGTKCTGRGYARIFSLTNLRLRPEGNNPQEIAKNSQEAFDVLNLMTGELETYDINDVPQ
FT                   FLSYHPRISDIAQVYSRKDNAILNLNMLSSKSGLEKYIFTFENFPRRHKAFFNMVSALF
FT                   KCLESEMKVPVDIEFTYDLETGEFYLVQARPLSSYETFRKVHIPKDIDKRCVLLKGDRM
FT                   LTNGVLKNIKYIVYVDHEVYSNYKDKHEIARIIGRINKSLGDRYILVGPGRWGSSNPYL
FT                   GVPVIYNEISNAAMIVELGIKNGDFMPELSYGTHFFADLDADNILYMPVFDGYENNIFN
FT                   EQWFKKGSYIDTGVKIFEGRFDAYLDGEKMVGYVISNEK"
FT   gene            163257..168536
FT                   /locus_tag="TTE0165"
FT   regulatory      163257..163261
FT                   /locus_tag="TTE0165"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163272..168536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|12862392|dbj|BAB32449.1|
FT                   (AB055648) D86 [Mus musculus], score 68.9, E-value
FT                   5.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23466"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD81"
FT                   /protein_id="AAM23466.1"
FT                   /translation="MRRILAMVVAILMLFSLFPGNMSKAYGAYPPNITAIYSLRLDGTM
FT                   ASPAKGPVDKYTDIKITGSGFVTYDASGNVTASVDYVYIDSPDTSKKLTILSVNENTIY
FT                   AKVPPATSIGLSANIPYTIIVHRSDGQSAAIFNGFTYVNNPSISKVALDNFITLVKDSN
FT                   GNIVGRTSKSYIRMEGSYFNDVGLVQINGETASVVSQSGSVLVTTIPQNIFIDPTSTYT
FT                   VTVTNIYRGSDTKQTQIYAVNHDITGLSKYVAIVGDEITIYGRGFNSLGSDFKVYIGNN
FT                   LVNSSDINIKSDTEMTVKVPAPKDTTLEYQNIDIVASNGSTATLVGALKIIPTPAIFTI
FT                   DNITPNAGSVSGGTKVVIVGQNLREDLIVKFGGVAAKSVQSITLPGLTENQRAIQVVTP
FT                   PYSKSGPVDVTVVDPVTGYTVTKQNAFFYLAVEDTMVVIDMNPTEGYESGNTPVTLWGF
FT                   NFQKNDDPSTYTYNEDKTEITYVNTNYTYKDPVTGNYVTGTRERKLYVTFGGNKAQIEN
FT                   VYKPETGQQTLNVLSPSVTLNPPGQNMPVDVVVTVETTVKDTNGNVVMQYSEQSSPPSK
FT                   FTYKPLPSNPVILSVSPNTGSRAGGDTVIIQGFDIRPGVKVYFGDKLATVKDLTTGGDN
FT                   KSVLTVISPPSTDLGYVDVKVVNKDADSQRGFYVYKNGYYYYTAPSISSIFTNFGSKYG
FT                   GNLITIYGSDFFVGQTVVDGVYSPEYPDVRIGNIQLKVISVEDKDGNLIDGKKFNIGTK
FT                   IKALIPETSTPYPVGWYDVTIKNYDGINGTIGGSVTLPNAFEIKDTQKKPSIISVDPNK
FT                   GPTKGGTLIKITGSNFEKGSIVTIDGVQASVKKVSSGNTEIEATTPPGTLGKKIVQVVN
FT                   PSDGGVALLVDGFEYVLIETKPQITKVVPNYGGKGTLIYIFGSDFSKKVGDSEGAKAYI
FT                   GNTVLENVYVLDENTIIGIIPDMKYTGLYEIKVVNPDTATAVAPEKFHFLVPESNPVIT
FT                   SVTPNFGTVNGGTAILIEGQDFRRGAEVFIGGNKATNVVVSPDGKSITAITPPGKPGKT
FT                   YVTVVNYDGGNYTYGIHEGETGFTYVIPNSQPVITKVEPDKGSTYGGQEVTIYGQDFRI
FT                   SKDEQGNILKDENGNPIGPDVYFGNVKAQKVVYIDYGTLKVITPPNAPGKVRVTVVNYD
FT                   GGLGYLEGGYTYIQSKPQIKQVIPPKFDKTGGTYGIIVGNDFSVPVYDKDKLILPGSSV
FT                   YIDGVEVKDVQVVDSTMIKFIAPPVDKVGTKELKVVNPDGGTATFKVEYVSPSTHPQIY
FT                   SITPDRGSINGGTYVVIKGKDFRDKVKVYFDAYEAKVISVSPDTIVILTPPGDPQKDIN
FT                   RSVDVTVFNEEDGGSFTLKNGFTYIATETKPKITSITPNTGSTKGGETVTITGDDFRQG
FT                   ARVFFGEKEALNVVVKSYNTIIATTPSHPEGKVDVIVRNPDYADAVFPQGFTYVQTVPD
FT                   EPVGFWVESIPGNDHTLRLRWSETKGAKYYEIYLVSDSTYKFIASTDKLEYYVTNLSPN
FT                   TKYTFALRAVNELGPSNFVTASSTTDRSSNSKYDTYVEGAKENKTSISTSNGALIVTLG
FT                   DTSESEYILNFKDDIYKNINKWVINVPSKYKNTAKKVKIYTQKFEMEFYLTDLYFTGDY
FT                   DRITITRITGKEYEDMVKNLSKNVTILSDIYDIKYEKITDGKAVNYTNFKNNIYVLIGV
FT                   ENNRLGKKDINRAKISYITYYLPYVGPNPMVIMYNVDRNKNTVSGKISSPGQIAVTY"
FT   misc_feature    164286..164558
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 47.7,
FT                   E-value 2.50E-10"
FT   misc_feature    165027..165281
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 50.9,
FT                   E-value 2.80E-11"
FT   misc_feature    165678..165932
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 60.4,
FT                   E-value 4.00E-14"
FT   misc_feature    166227..166493
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 42.9,
FT                   E-value 7.40E-09"
FT   misc_feature    166509..166808
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 46.5,
FT                   E-value 6.00E-10"
FT   misc_feature    167112..167375
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 50.1,
FT                   E-value 5.00E-11"
FT   misc_feature    167391..167639
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry TIG, IPT/TIG domain, score 62.6,
FT                   E-value 8.60E-15"
FT   misc_feature    167649..167879
FT                   /locus_tag="TTE0165"
FT                   /note="Pfam match to entry fn3, Fibronectin type III
FT                   domain, score 32.9, E-value 7.40E-06"
FT   gene            168536..171077
FT                   /locus_tag="TTE0166"
FT   regulatory      168536..168540
FT                   /locus_tag="TTE0166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168549..171077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0166"
FT                   /product="S-layer homology domain protein"
FT                   /note="Best Blastp hit = gi|1235795|gb|AAB00841.1| (M57692)
FT                   pullulanase [Thermoanaerobacterium thermosulfurigenes],
FT                   score 64.3, E-value 6.00E-09"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23467"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD80"
FT                   /protein_id="AAM23467.1"
FT                   /translation="MKGKRLLAFLLALIFLLQLNSVSYAQTTFYGVEYAPSIYHNMIFK
FT                   DIQNSFAKYDIMKMAALSVIRGGGDQKFYPKSYLKKEEALAYIVRLTNTSSSTGVAGSM
FT                   PATLPPKFKVDDWAKGVIDAALKANLLTKDELNTDFTLNATREEVAYWLAKGLGFQPLS
FT                   GTDLQQVYTFRDVKDINSSYLPYVGAVVKRGIMSGYSDGKFRPKTNITREQMASVLNRV
FT                   FNYSYSLMGYSVLTGTIKNILQENLVGEGAMKNTFVISNQMGQENFVVTKVRPSSNGGG
FT                   HLLDFLTISNGKPVYSQAFTVGDKVRFYIKDGKVIFAEKLPQNETVVYGEIVNITPSTI
FT                   ALKGGYNYSNTFSYTSYTEVYINDYPASTKDLRVGQTILAYLEGGTAYRIDVNYEEYAS
FT                   DKIEAGSRQVTGSIISIQNPQGDLTKGGIDITLDSGDTYYISPNIPLVKGGVSASLSSL
FT                   KIGDYVNLIFDDPYSDTPIKVLVDNGYYNVTGVFRGTLGSVMPLSKVINLSNVEKYYQG
FT                   TWQKVSDYVSYPFEKAEFYLNGLKIDESSLKNYTGRTIYITTENHFGKEYITFANIVSP
FT                   FTMAYQGMASFDPYSMTLTLSDGRKVTVNDGTIVVKGGRRVPANSLKSNQVYVSFSKED
FT                   NLHANFVSVIDTVDVPSYYYAKGYLFYATANSVTVGDVPWRGSYYSTVTGYYEISNNQW
FT                   SFVSGSRVFYVGDSTFVVDNRDKESKVVPYSELLNIRYGSSQFKDAFAYVVANGDNAVA
FT                   INVMPSDNNERVSTAKVEGIEGTKVTVSEVKDWNEVEGIWNLNTSLEVVDLSKAVIVKD
FT                   GRTVDVSSLKKGDFIYMIRSASRGIIVTVK"
FT   misc_feature    169065..169196
FT                   /locus_tag="TTE0166"
FT                   /note="Pfam match to entry SLH, S-layer homology domain,
FT                   score 53.5, E-value 4.60E-12"
FT   gene            171083..172577
FT                   /locus_tag="TTE0167"
FT   regulatory      171083..171087
FT                   /locus_tag="TTE0167"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171096..172577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0167"
FT                   /product="S-layer homology domain protein"
FT                   /note="Best Blastp hit = gi|4099045|gb|AAD09354.1| (U82255)
FT                   s-layer associated multidomain endoglucanase [anaerobic
FT                   thermophile KM-THCJ], score 81.3, E-value 3.00E-14"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23468"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD79"
FT                   /protein_id="AAM23468.1"
FT                   /translation="MKKLAFAFFFVFLFSMFPANIFAYNSGFEAGISNEQEYKEVVFIT
FT                   GEPVVFSGFLKVTSSKRGDTTTTTYRYTLSTPSGDKLTRTLTFVTEEKQKPEYNQIIAE
FT                   TTLKNYTESIKIGGDTYTLDRNNGYIYQGSEVKSINPAVTYYAGNYSGSKVYRMNGNKG
FT                   TVKVSIEDKTVGFSHKYGSAETHQMYYQIEATIGTGNNVKKWVGEVQVNVSFTDKSSIE
FT                   YVENDPQYISFRGGYLLRRNSEDVMTYAYNLPKFDENGNEIGRNTGSNSLRMDGIYTEN
FT                   RLVVPEVRDISGTWGKDDINKLLSLEIFPKDSLYFGPKLYILRSDFAVAVAKAIGIAPY
FT                   EPPKNALYSARKMPVEVSPFKDVPTNDPNYGYIKAASDIGLISGIGPSQFGPSLRLTRA
FT                   QAAVIFIRALGLENLAPQGYFKTGFLDDSSIPLWAKRSVYVAREIGLVGGDTFGRFNPE
FT                   SYVTREEAASMISRMIDFMMKDLTFDYVERVLNFK"
FT   misc_feature    172173..172301
FT                   /locus_tag="TTE0167"
FT                   /note="Pfam match to entry SLH, S-layer homology domain,
FT                   score 38.6, E-value 1.50E-07"
FT   misc_feature    172365..172496
FT                   /locus_tag="TTE0167"
FT                   /note="Pfam match to entry SLH, S-layer homology domain,
FT                   score 28.5, E-value 0.00015"
FT   gene            172672..173718
FT                   /gene="SpoIID"
FT                   /locus_tag="TTE0168"
FT   regulatory      172672..172676
FT                   /gene="SpoIID"
FT                   /locus_tag="TTE0168"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172681..173718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpoIID"
FT                   /locus_tag="TTE0168"
FT                   /product="sporulation protein and related proteins"
FT                   /note="Best Blastp hit = gi|282468|pir||S27530 sporulation
FT                   protein - Clostridium acetobutylicum
FT                   gi|144915|gb|AAA23281.1| (M87835) sporulation protein
FT                   [Clostridium acetobutylicum], score 226, E-value 3.00E-58"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23469"
FT                   /db_xref="GOA:Q8RD78"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD78"
FT                   /protein_id="AAM23469.1"
FT                   /translation="MRYLLYGVLSIFLSLIILPSIVIFGFSTHEVSVEKNLVLVEGGKS
FT                   VKLDKLPSYEVIRVFITNQNKIEEMQLEDYVKGVVAAEMPAEFEIEALKAQAVAARTYA
FT                   LAKEVALGGKGCDLHEGVDVCTDPEHCQAWQSVEELKGKWGENFEKYYSKISQAVDSTK
FT                   GLVMVYQDALILPVYHAISGGRTENSEDVWQKKIPYLRSVVSPGEEVASKYKTTVVVSQ
FT                   AEFVKKLKERQPSLKLTSNNILSEIKNIERTQAGHVKTLKIGDVTFEGKEIKELFGLNS
FT                   TNFTFSKQKDDIVITVIGYGHGVGMSQYGANALAKEGKKFDEILKYYYQGIEIVKIEDL
FT                   LKGKH"
FT   gene            173772..174599
FT                   /gene="NlpD"
FT                   /locus_tag="TTE0169"
FT   regulatory      173772..173776
FT                   /gene="NlpD"
FT                   /locus_tag="TTE0169"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        173787..174599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NlpD"
FT                   /locus_tag="TTE0169"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /note="Best Blastp hit = gi|11353968|pir||G81864 probable
FT                   membrane peptidase NMA1692 [imported] - Neisseria
FT                   meningitidis (group A strain Z2491)
FT                   gi|7380333|emb|CAB84920.1| (AL162756) putative membrane
FT                   peptidase [Neisseria meningitidis Z2491], score 78.2,
FT                   E-value 1.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23470"
FT                   /db_xref="GOA:Q8RD77"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD77"
FT                   /protein_id="AAM23470.1"
FT                   /translation="MRINRENFLRFFDRKGFYIVLFLSIVVIAATAVYVTDSNLKKLEE
FT                   IRKAQQEEINSAVESNLNYDYEEEMKRAKEEKPAVGQDFNVAQKEPEKKEAEPEAKSEQ
FT                   IKTKEVFSTEAKKLTVTPSPAKTDKKTSISTRLVLLRPLEGKVVMEFAKDKLVYSKTLN
FT                   EWTTHKGIDIAGKLGEPVVAASDGIVSKVYKDPKLGNTVVIKNGIWEMVYASLGDNIKV
FT                   KEGDKITKGQQIGEVGDTAKFEIAEGPHLHFELRENGVPIDPTPYFGE"
FT   misc_feature    174330..174587
FT                   /gene="NlpD"
FT                   /locus_tag="TTE0169"
FT                   /note="Pfam match to entry Peptidase_M37, Peptidase family
FT                   M23/M37, score 83.7, E-value 3.80E-21"
FT   regulatory      174606..174630
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            174706..174983
FT                   /locus_tag="TTE0170"
FT   regulatory      174706..174710
FT                   /locus_tag="TTE0170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174720..174983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0170"
FT                   /product="transcription regulator of
FT                   sigma-E/sigma-K-dependent gene spoIIID"
FT                   /note="Best Blastp hit = gi|134766|sp|P15281|SP3D_BACSU
FT                   STAGE III SPORULATION PROTEIN D (14 KD TRANSCRIPTION
FT                   FACTOR) gi|98493|pir||A33472 transcription regulator of
FT                   sigma-E/sigma-K-dependent gene spoIIID - Bacillus subtilis
FT                   gi|580763|emb|CAA33541.1| (X15520) transcription factor (AA
FT                   1-93) [Bacillus subtilis] gi|580931|emb|CAA36295.1|
FT                   (X52076) spoIIID protein (AA 1-93) [Bacillus subtilis]
FT                   gi|1684653|emb|CAB05384.1| (Z82987) SpoIIID [Bacillus
FT                   subtilis] gi|2636167|emb|CAB15659.1| (Z99122)
FT                   transcriptional regulator [Bacillus subtilis], score 111,
FT                   E-value 2.00E-24"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23471"
FT                   /db_xref="GOA:Q8RD76"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD76"
FT                   /protein_id="AAM23471.1"
FT                   /translation="MKDYIEERTLEISKYIVEHKATVREAAKVFGVSKSTVHKDVTERL
FT                   PEINFELYKEVREVLSKNKAERHIRGGKATKMKYQKLNNKIS"
FT   gene            175099..176139
FT                   /gene="MreB"
FT                   /locus_tag="TTE0171"
FT   regulatory      175099..175103
FT                   /gene="MreB"
FT                   /locus_tag="TTE0171"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175111..176139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MreB"
FT                   /locus_tag="TTE0171"
FT                   /product="HSP70 class molecular chaperones involved in cell
FT                   morphogenesis"
FT                   /note="Best Blastp hit = gi|417314|sp|P32444|MBL_BACCE
FT                   MREB-LIKE PROTEIN (MBL PROTEIN) gi|484937|pir||PN0441 mreB
FT                   protein - Bacillus cereus gi|49005|emb|CAA44237.1| (X62374)
FT                   MREB [Bacillus cereus] gi|4584137|emb|CAB40597.1|
FT                   (AJ010138) mreB-like protein [Bacillus cereus], score 372,
FT                   E-value 1.00E-102"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23472"
FT                   /db_xref="GOA:Q8RD75"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD75"
FT                   /protein_id="AAM23472.1"
FT                   /translation="MFAISRDIGIDLGTASVLVYVRGEGIVLNEPSVVAIDRNTNKILA
FT                   VGEEAQRMVGRTPGNILAIKPLRAGVISDYDITEKMLRYFINKACGSRFLIRPRIMICI
FT                   PSGVTQVEKRAVIDAALQAGARKAYLIEEPIAAAIGAGLDISQPSGNMIVDIGGGTTDI
FT                   AVISLGSAVVSKNIKVAGDNFDEAIIRYMRKKYHIIIGERMAEEIKINIGTAYFDGKEE
FT                   KMVVKGRSLLSGLPQNVEVTSSEICEALQEPLEQIVEAVHSVLERTPPELAADISDKGM
FT                   VLTGGGALLKGMDRLLRERMQIPVYLANDPISCVALGAGKALESLELLEKSETVIDIHK
FT                   IR"
FT   gene            176134..176907
FT                   /gene="FlgE"
FT                   /locus_tag="TTE0172"
FT   regulatory      176134..176138
FT                   /gene="FlgE"
FT                   /locus_tag="TTE0172"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176152..176907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FlgE"
FT                   /locus_tag="TTE0172"
FT                   /product="Flagellar basal body and hook proteins"
FT                   /note="Best Blastp hit = gi|7443092|pir||D71259 probable
FT                   flagellar basal-body rod protein (flgG-2) - syphilis
FT                   spirochete gi|3323282|gb|AAC65916.1| (AE001264) flagellar
FT                   basal-body rod protein (flgG-2) [Treponema pallidum], score
FT                   191, E-value 8.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23473"
FT                   /db_xref="GOA:Q8RD74"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD74"
FT                   /protein_id="AAM23473.1"
FT                   /translation="MIRGLYTAASGMLAQTKVMDVLANNLANANTVGYKKDIVVLSSFP
FT                   NLETIREGGDNVPPDRKVGRIEYGVLIDTFHTVFEEGPLMETTGKLDFAIDGNGFFVVN
FT                   TPQGERYTRDGAFTMNADGYLVTKDGYIVLGENGPIRLSQGDVSVDENGNIINNGQLVD
FT                   RLRIVDFDNYDALRKQGDNLFYLDNAVNTQIIPATGRIKQGFLEGSNVNSVKEMVNMIS
FT                   VMRNYESNQKVVTAFDETLGKAVNEVGRV"
FT   misc_feature    176164..176256
FT                   /gene="FlgE"
FT                   /locus_tag="TTE0172"
FT                   /note="Pfam match to entry flg_bb_rod, Flagella basal body
FT                   rod protein, score 48.8, E-value 4.30E-11"
FT   gene            176908..177723
FT                   /gene="FlgE2"
FT                   /locus_tag="TTE0173"
FT   regulatory      176908..176912
FT                   /gene="FlgE2"
FT                   /locus_tag="TTE0173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176923..177723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FlgE2"
FT                   /locus_tag="TTE0173"
FT                   /product="Flagellar basal body and hook proteins"
FT                   /note="Best Blastp hit = gi|7443089|pir||B72243 flagellar
FT                   basal-body rod protein FlgG - Thermotoga maritima (strain
FT                   MSB8) gi|4982109|gb|AAD36609.1|AE001800_19 (AE001800)
FT                   flagellar basal-body rod protein FlgG [Thermotoga
FT                   maritima], score 236, E-value 2.00E-61"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23474"
FT                   /db_xref="GOA:Q8RD73"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD73"
FT                   /protein_id="AAM23474.1"
FT                   /translation="MMRALWSAATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLI
FT                   YQTLQRENVYGGQGRPVNMQVGVGVRPSAIVKDFSEGNLYQTGNPLDLALDGPGFFAVL
FT                   GPDDKVYYTRDGSFKLSPDGNTFMLVTADGYPVLDDSNNPIVFDGNVNDITVSPLGVIQ
FT                   VKNPDGTTQEVATLGIYNFTNPQGLLSVGNNLYEATEASGQPGTRDDFEGRMGKVMQGF
FT                   LETSNVQVVKEMVDMIAAQRAYEINSKAIQAADEMLGIANNLRR"
FT   misc_feature    176935..177027
FT                   /gene="FlgE2"
FT                   /locus_tag="TTE0173"
FT                   /note="Pfam match to entry flg_bb_rod, Flagella basal body
FT                   rod protein, score 48.4, E-value 5.80E-11"
FT   gene            177722..178069
FT                   /gene="FlgJ"
FT                   /locus_tag="TTE0174"
FT   regulatory      177722..177726
FT                   /gene="FlgJ"
FT                   /locus_tag="TTE0174"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        177734..178069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FlgJ"
FT                   /locus_tag="TTE0174"
FT                   /product="Flagellum-specific muramidase"
FT                   /note="Best Blastp hit = gi|7459892|pir||B71259
FT                   hypothetical protein TP0959 - syphilis spirochete
FT                   gi|3323289|gb|AAC65923.1| (AE001264) T. pallidum predicted
FT                   coding region TP0959 [Treponema pallidum], score 53.1,
FT                   E-value 1.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23475"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD72"
FT                   /protein_id="AAM23475.1"
FT                   /translation="MEINPIEGAIKNMLPLWGNQQVEDFERIINKAMEEKDKDKLMEAC
FT                   KQLEANFISLMLKEMRKTIPEDPLTGNNLANDIFTSMLYDKYAELMAQSGGFGLAEEIY
FT                   NQLSKKV"
FT   regulatory      178071..178083
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            178147..178585
FT                   /gene="FabA"
FT                   /locus_tag="TTE0175"
FT   regulatory      178147..178151
FT                   /gene="FabA"
FT                   /locus_tag="TTE0175"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178160..178585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FabA"
FT                   /locus_tag="TTE0175"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /note="Best Blastp hit = gi|10176359|dbj|BAB07454.1|
FT                   (AP001519) hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase [Bacillus halodurans], score 179, E-value
FT                   1.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23476"
FT                   /db_xref="GOA:Q8RD71"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD71"
FT                   /protein_id="AAM23476.1"
FT                   /translation="MENKDIRKILPHRYPFLLVDRIIELEEGKRAVGIKNVTSNEPFFQ
FT                   GHFPDNPIMPGVLIVEALAQVAGIAVMNVEEFKGKLGLFAGIDKCRFKKVVRPGDQLIL
FT                   EVSIDSIRMGLVKAKGVAKVGEEIAATAELMFVMAEE"
FT   misc_feature    178160..178552
FT                   /gene="FabA"
FT                   /locus_tag="TTE0175"
FT                   /note="Pfam match to entry Thioester_dehyd, Thioester
FT                   dehydrase, score 210.6, E-value 2.30E-59"
FT   gene            178584..180158
FT                   /gene="MviN"
FT                   /locus_tag="TTE0176"
FT   regulatory      178584..178588
FT                   /gene="MviN"
FT                   /locus_tag="TTE0176"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178596..180158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MviN"
FT                   /locus_tag="TTE0176"
FT                   /product="uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="Best Blastp hit = gi|11348209|pir||D83074 conserved
FT                   hypothetical protein PA4562 [imported] - Pseudomonas
FT                   aeruginosa (strain PAO1)
FT                   gi|9950808|gb|AAG07950.1|AE004870_1 (AE004870) conserved
FT                   hypothetical protein [Pseudomonas aeruginosa], score 207,
FT                   E-value 2.00E-52"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23477"
FT                   /db_xref="GOA:Q8RD70"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD70"
FT                   /protein_id="AAM23477.1"
FT                   /translation="MSTVKKTVKAASVIMVLTLISKIFGFFRDVTLAAKFGTSVFMDAY
FT                   NMATVIPMILFAAVTAAIATTVIPIFTEYYQKEGKEKAFDFINNLLGTVGVATIVLTFI
FT                   GIIFAPYLVKFVAPAFTGEKFELTVKLTEILLPTMVLIASSNIFTGALQAMEHFTVPAM
FT                   IGIPYNIVVIGAAILYAHKFGIIAIAYSIIFATFIQALMQLPVLYKLGYRFRLKINFKD
FT                   EGVKKVIVLAIPVLIGTGIQTINVYVDRVIASFLPDGSIAALNYANRLNMFALGIFSTA
FT                   ITTVIYPVLSRHSVQEDKEGFVKSLNFAVSGILYILLPVSVGAMVLRVPIIRVLFERGA
FT                   FDERSTYLTSIALFYFAIGMTAYGLRDVLSRSFYSMKDTKTPMINGALAVLVNIILNLI
FT                   LVRYLELGGLALSTSIAAIFATFLLFNSLKKKIGSINGKQMLISFLKAMGASLVMGITV
FT                   YFVYNHLTARVPDKKIYEALTLFMTIIVGALVYIPIVLLSDKNAFNYFKKGIKFINAKF
FT                   VRL"
FT   gene            180157..181289
FT                   /locus_tag="TTE0177"
FT   regulatory      180157..180161
FT                   /locus_tag="TTE0177"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        180171..181289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0177"
FT                   /product="uncharacterized Fe-S center protein"
FT                   /note="Best Blastp hit = gi|7450084|pir||B69111 conserved
FT                   hypothetical protein MTH1826 - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)
FT                   gi|2622960|gb|AAB86292.1| (AE000936) unknown (contains
FT                   ferredoxin domain) [Methanothermobacter
FT                   thermautotrophicus], score 409, E-value 1.00E-113"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23478"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD69"
FT                   /protein_id="AAM23478.1"
FT                   /translation="MKAKVYYYNMRADKASSSLASKVARIFDLAGFKSIINKNDLVAIK
FT                   IHFGEKGNNAYIHPIYVRKIVDKVKSYGGKPFLTDTNTLYKGSRSNAVDHLVTAIENGF
FT                   AYAVVNAPIIIADGLLSKNSIEVKINKKHFDTVKIASDIFYANAMIVMSHFKGHELAGF
FT                   GGAIKNLAMGCAPAAGKQQQHSTVKPVVGKGCTACQMCIRNCPVGAISLVNGSAYIDHS
FT                   ICIGCGECVSMCQYGVIKPQWGTDMDAFIERMTEYAYGAYSVKKGKIAFINFVMNVTPL
FT                   CDCTPWSDAPIVPDVGILASFDPVAIDQASYDLVNQQFGHRGTALEEAGYGMNPGEDKF
FT                   KALHPETKGELQLKYGEEIGLGTRDYELIELK"
FT   misc_feature    180819..180890
FT                   /locus_tag="TTE0177"
FT                   /note="Pfam match to entry fer4, 4Fe-4S binding domain,
FT                   score 34, E-value 3.50E-06"
FT   repeat_region   181330..181530
FT                   /note="TLR027, identity:90%, copy 5"
FT   gene            181614..181823
FT                   /locus_tag="TTE0178"
FT   CDS_pept        181614..181823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23479"
FT                   /db_xref="GOA:Q8RD68"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD68"
FT                   /protein_id="AAM23479.1"
FT                   /translation="MLYYINRRGVFTKERNLMEKYFIIIPIISMITVALLFFIQVLFIK
FT                   WTDKVFGIKQEKEKKDVEDKKEEE"
FT   gene            181825..182651
FT                   /locus_tag="TTE0179"
FT   regulatory      181825..181829
FT                   /locus_tag="TTE0179"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181833..182651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|11135552|sp|O31726|YLMD_BACSU
FT                   HYPOTHETICAL 30.9 KDA PROTEIN IN SIGG-DIVIVA INTERGENIC
FT                   REGION gi|7474647|pir||D69876 conserved hypothetical
FT                   protein ylmD - Bacillus subtilis gi|2633910|emb|CAB13411.1|
FT                   (Z99112) similar to hypothetical proteins [Bacillus
FT                   subtilis], score 171, E-value 1.00E-41"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23480"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD67"
FT                   /protein_id="AAM23480.1"
FT                   /translation="MPLKIGFKRNEKNGVVFYTIPSFEETGVVKHLFTTRIGGVSKGKY
FT                   ASLNLSLKRFDIKEEVYENFKIICAVGEFTCQNMVFSDQVHGNVVRKITYEDRGKNFGG
FT                   SDIVGVDGLVTDEREIPLVTFHADCVPLFFLDPVKKVVALSHAGWRGTVARIGPNTVEV
FT                   MKREYNSNPKDILVGIGPSIYKCCYEVGEDVAERVKEAIGDWKEVLVKKSDGKWLLDLQ
FT                   HANYIELVSSGIPDENITVSQICTSCNLEFYSYRRDKGITGSMAAFVELK"
FT   misc_feature    181959..182648
FT                   /locus_tag="TTE0179"
FT                   /note="Pfam match to entry DUF152, Uncharacterized ACR,
FT                   YfiH family COG1496, score 197.3, E-value 2.50E-55"
FT   gene            182751..185669
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT   regulatory      182751..182755
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182766..185669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT                   /product="NtrC family Transcriptional regulator, ATPase
FT                   domain protein"
FT                   /note="Best Blastp hit = gi|126223|sp|P23914|LEVR_BACSU
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN LEVR
FT                   gi|98399|pir||A39160 transcription activator of levanase
FT                   operon levR - Bacillus subtilis gi|143150|gb|AAA22572.1|
FT                   (M60105) levR [Bacillus subtilis]
FT                   gi|2108261|emb|CAA63460.1| (X92868) transcriptional
FT                   regulatory protein [Bacillus subtilis]
FT                   gi|2635154|emb|CAB14650.1| (Z99117) transcriptional
FT                   regulator (NifA/NtrC family) [Bacillus subtilis], score
FT                   417, E-value 1.00E-115"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23481"
FT                   /db_xref="GOA:Q8R5U8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U8"
FT                   /protein_id="AAM23481.1"
FT                   /translation="MLDKIFEIIQKEDKKNPLTDEQIAALLNIKREDVTQFRLKNNIPD
FT                   SRERRKPYLLEDLKKIIKEDPSISDRNLTRELNFLGYNISRFVVSQLKKEILKEIKVER
FT                   KVYLKNFVPEEDVESQKEEILSFKDIIGSEGSLKAQISLAKAAVLYPPHGLHTLIVGPP
FT                   GAGKSQLAEAMYNFAVESGRFREGAPFVVFNCADYADNPQLLMAQLFGYVKGAFTGADT
FT                   EKRGLVEKANGGILFLDEVHRLPSEGQEILFYLLDKGKFRRLGETENTREAQIMLIAAT
FT                   TENPESALLLTFRRRIPVLIELPSLSERPPHERYEIIYNFFTKESVRLNKTIVIKKEAL
FT                   RALMLYECPGNLGQLRSDIQVACAKSFLASLGSKSSSLVVDVSDLPNHVKMGLFRLNKR
FT                   DPEIERYLGEDLVVYPDKKVKIFPKEDRYMLPDEIYQFIEERFIDLKRQGLTKEEIDKI
FT                   LSKEMEIELKKFAASVKTSISISKKELVNVVGEKIVNAVEKAYEIARRSFKNLEDNLFY
FT                   SLAIHLSATYERILSGKPIFNPQLENIIREYPLEYSTAKIMAKEINKELGIELPEEEIG
FT                   FIAMYLKTFSGEKPVEEGRVGVIVLTHGHVASSMAEVANRLLGVNHAIGIDMALDEKPE
FT                   KVLERTIEVVKRIDEGKGCIILVDMGSLVTFGEIITKRTGIPTRVVARVDTVMVLEAVR
FT                   RAIIPETTLDEIADAIDSEKSYVGKVETLFDKKPSKAIVTVCITGEGTALKIKKYIEDL
FT                   IPELKENYKIIPVGMLRQEDIAKEIEKIRKENDVAAFVGTINPGIESIPFISVEEVLKG
FT                   DGVEKIKKIIGLKKENPLKEVIDEELIFLDVDAFVKSDVIDLLAEKLYEKGYVDDRFLL
FT                   SVYKREAMGATILNDGIAIPHGYPEHVIKPAIAIAKLKEPIYWEKDLMADLVFMIALKE
FT                   ESKEYFMYLYHVLTDQNSINKLKGARNPDEVREILTS"
FT   misc_feature    183237..183629
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT                   /note="Pfam match to entry sigma54, Sigma-54 interaction
FT                   domain, score 85.6, E-value 8.20E-23"
FT   misc_feature    184236..184520
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT                   /note="Pfam match to entry BglG_antitermin, Transcriptional
FT                   antiterminator bglG family, score 71.8, E-value 1.50E-17"
FT   misc_feature    185259..185666
FT                   /gene="PspF"
FT                   /locus_tag="TTE0180"
FT                   /note="Pfam match to entry PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 53.9, E-value 3.60E-12"
FT   gene            185728..186219
FT                   /gene="PtsN"
FT                   /locus_tag="TTE0181"
FT   regulatory      185728..185732
FT                   /gene="PtsN"
FT                   /locus_tag="TTE0181"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185740..186219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PtsN"
FT                   /locus_tag="TTE0181"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /note="Best Blastp hit = gi|13700160|dbj|BAB41459.1|
FT                   '(AP003129) ORFID:SA0236.; hypothetical protein, similar to
FT                   PTS fructose-specific enzyme IIBC component [Staphylococcus
FT                   aureus]' gi|13873578|dbj|BAB44395.1| (AP003358)
FT                   hypothetical protein [Staphylococcus aureus], score 115,
FT                   E-value 4.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23482"
FT                   /db_xref="GOA:Q8RD66"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD66"
FT                   /protein_id="AAM23482.1"
FT                   /translation="MMKLTEFFHKELIVTNLQANNKEEVFEVLFNKLLENGYVKESFLE
FT                   GIMTREKNFPTGLLLNGNNVAIPHTDPEHVLKPAIAVATLSKPVVFKNMANPQEDVNVN
FT                   IVFMIALNAAHSQVELLQRLVEMIQNENLLEEILKAKGGDEVVKIIESYQTLEKE"
FT   misc_feature    185755..186198
FT                   /gene="PtsN"
FT                   /locus_tag="TTE0181"
FT                   /note="Pfam match to entry PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 77.3, E-value 3.10E-19"
FT   gene            186212..186517
FT                   /locus_tag="TTE0182"
FT   regulatory      186212..186216
FT                   /locus_tag="TTE0182"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        186224..186517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0182"
FT                   /product="PTS system, galactitol-specific enzyme II, B
FT                   component"
FT                   /note="Best Blastp hit = gi|10172803|dbj|BAB03910.1|
FT                   '(AP001507) PTS system, galactitol-specific enzyme II, B
FT                   component [Bacillus halodurans]', score 91.3, E-value
FT                   2.00E-18"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23483"
FT                   /db_xref="GOA:Q8RD65"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD65"
FT                   /protein_id="AAM23483.1"
FT                   /translation="MVSMRKKTILVACGTGIATSTVVTEKILEAAKKENLDVNIIQCKV
FT                   SEIKSYAEDADFIVTTTILKDSFGKKSINALPLITGIGEEQVLKEIIEEIKK"
FT   gene            186528..187775
FT                   /locus_tag="TTE0183"
FT   CDS_pept        186528..187775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|13700162|dbj|BAB41461.1|
FT                   (AP003129) ORFID:SA0238.; probable PTS galactitol-specific
FT                   enzyme IIC component [Staphylococcus aureus]
FT                   gi|13873580|dbj|BAB44397.1| (AP003358) hypothetical protein
FT                   [Staphylococcus aureus], score 382, E-value 1.00E-105"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23484"
FT                   /db_xref="GOA:Q8RD64"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD64"
FT                   /protein_id="AAM23484.1"
FT                   /translation="MSIIKYILDLGATVMLPIIIFLLALILGEKPGRAFRSALTIGIGF
FT                   VGINLVIGLLVNNLGPAAQAMVEHMGVHLNVIDVGWPASAAIAFASKVGAFVIPIGLLV
FT                   NIIMLATRLTKTVNVDLWNYWHFAFTGALVTAATGSLTWGLVAAAINAAIVLLLADWTA
FT                   KMVQDFYGLPGISLPHGFSAAYVPIAIPLNKLIDKIPVINKIEADTDTINKRFGIFGEP
FT                   IVIGLILGVVLGILAKYDVKGILNLGISMAAVMLLLPRMVRILMEGLIPISEAAKAFMQ
FT                   KRFQGREFYIGLDSAIAVGHPAAIATALVLVPITILLAIILPGNHVLPFGDLATIPFMV
FT                   VMVVPVTKGNVFRSILIGTIVIGVGLWIATNVAPLFTQVAAEAAFKFPTGATEISSICD
FT                   GANPLTWVILQIMRLF"
FT   regulatory      187781..187796
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(187799..188786)
FT                   /gene="DeoR"
FT                   /locus_tag="TTE0184"
FT   CDS_pept        complement(187799..188740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DeoR"
FT                   /locus_tag="TTE0184"
FT                   /product="Transcriptional regulator, contains sigma
FT                   factor-related N-terminal domain"
FT                   /note="Best Blastp hit = gi|10173394|dbj|BAB04499.1|
FT                   (AP001509) transcriptional regulator [Bacillus halodurans],
FT                   score 196, E-value 3.00E-49"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23485"
FT                   /db_xref="GOA:Q8RD63"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD63"
FT                   /protein_id="AAM23485.1"
FT                   /translation="MDKDLHLFQKISLVAELYYTYGLTQQQIADKLQISRPWVSKLLKK
FT                   AEELGLVRVDVITSTSGVKELEEEIQKKYRLKGVKVIKKAVTSDADIVELGKAAANYFI
FT                   SILEPNDVIGVSWGKTLSALANHLIPIYYPDTTVVPLIGGMGHTPSLLSNHIAMQISSA
FT                   ISGKCLLLHAPAFASNKHEKEVFLKNPLVSQVIEKSENIDIALVGLGSLWNSTILEYNY
FT                   ITVNEIKDLEKVGAIGDIALHFIDASGRIVSHPIHERLIAGNLSKIRKSARIMMGVAGG
FT                   LHKKEIVKAALVGKWIDILVTDIEVAHYLIEN"
FT   regulatory      complement(188782..188786)
FT                   /gene="DeoR"
FT                   /locus_tag="TTE0184"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            188918..189574
FT                   /gene="Rpe"
FT                   /locus_tag="TTE0185"
FT   regulatory      188918..188922
FT                   /gene="Rpe"
FT                   /locus_tag="TTE0185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        188930..189574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Rpe"
FT                   /locus_tag="TTE0185"
FT                   /product="Pentose-5-phosphate-3-epimerase"
FT                   /note="Best Blastp hit = gi|10175122|dbj|BAB06221.1|
FT                   (AP001515) ribulose-phosphate 3-epimerase [Bacillus
FT                   halodurans], score 163, E-value 2.00E-39"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23486"
FT                   /db_xref="GOA:Q8RD62"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD62"
FT                   /protein_id="AAM23486.1"
FT                   /translation="MKISASILAADTAFLGKEVLELEKLGIDFIHVDVIDGHYANNFGF
FT                   SPKTVKDLRRITDLPIEVHLEILNPENYVEIFSEAGADIIIVQFDTCSHPLRILRKIKA
FT                   LGKKAGVALSPCVSFESLRWCLNDVDYLLFMSVEPGFGGQNFETFTIDKIKLAKVQLKE
FT                   MGFSIPIGVDGGVNLGNINLLREVGVDIVVVGSALFLNENKERFIFQVKGG"
FT   misc_feature    188933..189535
FT                   /gene="Rpe"
FT                   /locus_tag="TTE0185"
FT                   /note="Pfam match to entry Ribul_P_3_epim,
FT                   Ribulose-phosphate 3 epimerase family, score 219.1, E-value
FT                   6.50E-62"
FT   gene            189702..190703
FT                   /gene="AcoA"
FT                   /locus_tag="TTE0186"
FT   CDS_pept        189702..190703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcoA"
FT                   /locus_tag="TTE0186"
FT                   /product="Thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1 component alpha subunit"
FT                   /note="Best Blastp hit = gi|10173390|dbj|BAB04495.1|
FT                   (AP001509) acetoin dehydrogenase (TPP-dependent) alpha
FT                   chain [Bacillus halodurans], score 376, E-value 1.00E-103"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23487"
FT                   /db_xref="GOA:Q8RD61"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD61"
FT                   /protein_id="AAM23487.1"
FT                   /translation="MKLKGGRIVTMEFSKEKLLWMYKKMVQIRQFELKTDELYKKNMIW
FT                   GTYHLYVGEEAAAVGACAALEPTDYITSTHRGHGHTIAKGADLKRMMAELLGKETGHCK
FT                   GRGGSMHIADIFTGHLGANGIVAGGIPIATGAALASKLRGDKRVTLCFFGDGAANTGAF
FT                   NESLNMAAIWQLPVVYFCENNQYAMSAPVNKFTAVKNIADRAASYNMPGVIVDGNDVLE
FT                   VYKAVKEAVDRARKGEGPTLIEAKTYRWFGHSKSDPRVYRTREEEEEWKKKDPIKRFAE
FT                   KLLSEGVATEEELKKIDEEVAKEIEEAYQFAVESPEPKVEDLAKYVYAEEGE"
FT   misc_feature    189768..190664
FT                   /gene="AcoA"
FT                   /locus_tag="TTE0186"
FT                   /note="Pfam match to entry E1_dehydrog, Dehydrogenase E1
FT                   component, score 489.4, E-value 2.70E-143"
FT   gene            190690..191686
FT                   /gene="AcoB"
FT                   /locus_tag="TTE0187"
FT   regulatory      190690..190694
FT                   /gene="AcoB"
FT                   /locus_tag="TTE0187"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190706..191686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcoB"
FT                   /locus_tag="TTE0187"
FT                   /product="Thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1 component beta subunit"
FT                   /note="Best Blastp hit = gi|10173391|dbj|BAB04496.1|
FT                   (AP001509) acetoin dehydrogenase (TPP-dependent) beta chain
FT                   [Bacillus halodurans], score 385, E-value 1.00E-106"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23488"
FT                   /db_xref="GOA:Q8RD60"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD60"
FT                   /protein_id="AAM23488.1"
FT                   /translation="MAEKLYIEALAEAIKEEFERDPNVFMMGEDIGIYGGAFGVTKGMY
FT                   PKYKDKLIETPISEASIVGAGVGAALVGMRPIVEIMFSDFMMDAMEWIVNQAAKLRYMT
FT                   GGQLKVPLVIRSPMGSGTGAAAQHSQSLPAMFAHIPGLKVVMPATPYDVKGLFKAAVRD
FT                   DNPVIFFEHKLLYWTKGEVPEGDYIVPIGKADVKREGKDITIIAGSITVIRSLEAAEKL
FT                   KGEGIDVEVIDVRSLSPLDTETIVNSVIKTGKVLIVEDDNKSYGWGAEVLSRIVESDAF
FT                   DYLDYPIQRLGGKDVPIPYNPKLERAAVPQVEDIIEAVKAIFGKE"
FT   gene            191679..192938
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT   regulatory      191679..191683
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191694..192938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT                   /product="Dihydrolipoamide acyltransferases"
FT                   /note="Best Blastp hit = gi|10173392|dbj|BAB04497.1|
FT                   (AP001509) dihydrolipoamide S-acetyltransferase [Bacillus
FT                   halodurans], score 269, E-value 4.00E-71"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23489"
FT                   /db_xref="GOA:Q8RD59"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD59"
FT                   /protein_id="AAM23489.1"
FT                   /translation="MANVKLMPKLGMTMTAGKVVRWLKKEGEKVEAGEPLLEIETDKVT
FT                   MEEEAGYTGTLLKILVREGEEVPINQPIAIIGGEGEDIEEILKTLKVSEGVEEEKKEEK
FT                   IKVKIEEKPEEVKREEISKPRATPAARKIAREHGIDLSEVIGSGAHGRIHRKDVEEYIR
FT                   KRTEIVPSQVTVEQKVEKKEEIPSYRVIPFTGMRKIIAEKMQKSINTAPHFYVTMEVKM
FT                   REILKLRETLNSKLKEDEAKISLNTLLMKAAGIAIKDYPIFNSYVEEGQIILRNEINIG
FT                   LAVALDEGLIVPVIREVDKKGLKEIAREEKALIQKAREGKLTPDEYTGGSFTISNLGMF
FT                   DVVRFAAIINPPEVAILAVGKIREIPVVEEGQIEIEPIMEMTLSSDHRVIDGALAAKFL
FT                   RRIKEILEDPLQFML"
FT   misc_feature    191700..191921
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT                   /note="Pfam match to entry biotin_lipoyl, Biotin-requiring
FT                   enzyme, score 81.5, E-value 1.70E-20"
FT   misc_feature    192063..192179
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT                   /note="Pfam match to entry e3_binding, e3 binding domain,
FT                   score 71.1, E-value 2.30E-17"
FT   misc_feature    192246..192935
FT                   /gene="AceF"
FT                   /locus_tag="TTE0188"
FT                   /note="Pfam match to entry 2-oxoacid_dh, 2-oxo acid
FT                   dehydrogenases acyltransferase (catalytic domain), score
FT                   337.5, E-value 1.50E-97"
FT   gene            192947..193291
FT                   /locus_tag="TTE0189"
FT   regulatory      192947..192951
FT                   /locus_tag="TTE0189"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192962..193291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10173389|dbj|BAB04494.1|
FT                   (AP001509) BH0775; unknown [Bacillus halodurans], score 99,
FT                   E-value 2.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD58"
FT                   /protein_id="AAM23490.1"
FT                   /translation="MYTYMKGMLYCLYCKKETEHTIVYEGDMIKKIKCDECGTELEIDK
FT                   EKAKKNYTEDFINRIFTKPQRMTEELQKDLTAFLLSLPIRIVTKPYRVLEEVKEQIDKI
FT                   RRKDI"
FT   gene            193410..195426
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT   regulatory      193410..193414
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193423..195426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT                   /product="Transketolase"
FT                   /note="Best Blastp hit = gi|10174972|dbj|BAB06071.1|
FT                   (AP001515) transketolase [Bacillus halodurans], score 904,
FT                   E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23491"
FT                   /db_xref="GOA:Q8RD57"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD57"
FT                   /protein_id="AAM23491.1"
FT                   /translation="MAKRIEQLAINAIRVLSIDAIEKAKSGHPGMPMGAAPMAYVLWTE
FT                   FMNHNPLNSKWFNRDRFVLSAGHASMLLYALLHLSGYKVSMEDIKNFRQWGSKTPGHPE
FT                   YGLTDGVEATTGPLGQGLGMAVGMAMAERFLANKYNRGSYNIIDHYTYVIASDGDLMEG
FT                   ISHEAGSLAGHLKLGKLIVLYDSNDVTLDGDRHLSFTESVADRFKAYGWQVLRVDDGND
FT                   LDAIRNAISEAKKNTEQPTLIEVKTVLGYGAPNKAGKSDAHGAPLGEEEARLAKEYYKW
FT                   EYEPFFIPEEIYEHYRAKVLERGKKAEEEWNKLFEAYKKEYPELAKELEDAINGNLPEG
FT                   WDKDMPSYDKGAYATRDVSGEMINALAKNIPYFIGGSADLASSNKTAIKGEQPFGPTSN
FT                   YTGRNIWFGVREFGMATALNGMALHGGLKVYGGTFLVFSDYLRPALRLSALMGVPVTYV
FT                   FTHDSIAVGEDGPTHQPVEHLAAFRAMPNVSVIRPADGNETRAAWKLAVQSKNKPTVLI
FT                   LTRQKLPILPTTKEKVEEGVAKGAYIVSDGEKEIPDILLLASGSEVSLAVEAQKKLKEE
FT                   GIDARVISMPSWDRFEEQDKSYKDYILPPNVKKRLAIEAAAPLGWERYVGDEGKVLGVN
FT                   TFGASAPGEKLMEEYGFTVDRIVKEAKELLRK"
FT   misc_feature    193435..194436
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT                   /note="Pfam match to entry transketolase, Transketolase,
FT                   thiamine diphosphate binding domain, score 703.5, E-value
FT                   1.00E-207"
FT   misc_feature    194455..194997
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT                   /note="Pfam match to entry transketolaseD2, Transketolase,
FT                   central domain, score 367.1, E-value 1.90E-106"
FT   misc_feature    195004..195393
FT                   /gene="TktA"
FT                   /locus_tag="TTE0190"
FT                   /note="Pfam match to entry transketolaseD3, Transketolase,
FT                   C-terminal domain, score 178.5, E-value 1.10E-49"
FT   regulatory      195457..195483
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            195476..198311
FT                   /gene="AtoC"
FT                   /locus_tag="TTE0191"
FT   regulatory      195476..195480
FT                   /gene="AtoC"
FT                   /locus_tag="TTE0191"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195516..198311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoC"
FT                   /locus_tag="TTE0191"
FT                   /product="AAA superfamily ATPases with N-terminal receiver
FT                   domain"
FT                   /note="Best Blastp hit = gi|126223|sp|P23914|LEVR_BACSU
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN LEVR
FT                   gi|98399|pir||A39160 transcription activator of levanase
FT                   operon levR - Bacillus subtilis gi|143150|gb|AAA22572.1|
FT                   (M60105) levR [Bacillus subtilis]
FT                   gi|2108261|emb|CAA63460.1| (X92868) transcriptional
FT                   regulatory protein [Bacillus subtilis]
FT                   gi|2635154|emb|CAB14650.1| (Z99117) transcriptional
FT                   regulator (NifA/NtrC family) [Bacillus subtilis], score
FT                   431, E-value 1.00E-119"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23492"
FT                   /db_xref="GOA:Q8RD56"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD56"
FT                   /protein_id="AAM23492.1"
FT                   /translation="MVYFLLNIHEKRGRFSLTNKEKVFNLVKELSQNINVKEKKGITAQ
FT                   EVARKLNLRRNVASHLLNELHKEGKLIKINTRPVYFVDREIYEKRAKEFKDTTKDVSTS
FT                   LKSSSEDPFVKLVGYNGSLKEQVKLCKSAASYPPNGLPILLTGSTGVGKSYIAQLIYEY
FT                   AKYIGVIDENAPYVIFNCAEYANNPELLSANLFGYVKGAFTGADRDKPGLLEEADGGYL
FT                   FLDEVHRLPPEGQEKLFLFMDKGIFRRLGETNNWRTAKVRFVFATTEDPEKTFTKTFLR
FT                   RIPLVVHIPSFDERPLHERLQLIYNFYKNEARNLGMDILISKQVLNVLLKTKVSGNIGK
FT                   LINVIKYSCAQAYSHIIKSKTNILRIHLYDLPKEMQTDLDIVKSNFHFNGMLISHNKKD
FT                   EGLSWEKDDNREIYSALNKMFELFKEYQNNGIASEEFKKNVLVYLNELTDTIIFKNDSS
FT                   YIDSIVFNAIKNVVENVLNIMQNMYGIKYYGNSVLVLSHFINYLLSDVTYEKYSESIES
FT                   ALEILKNIFPKEFIIANKMADLIEVNLDIKLNKIAVAYFTLYVRSLNKTESANLINSII
FT                   IAHGYSTASSIASVANRLLGQFVFEAFDMPIEMSTQEVMARVQDYLKNIDTSRGVIILV
FT                   DMGSLEEIYKSLTDIVEGDIAIINNITTQLALDVGNRILQNQPLEQIVTEAIQRNSSRY
FT                   KFIKSQKSKENAILTTCVTGIGTAVKIKDLLRECFEEDDIEIIPYDYTRLKGNGIKDEI
FT                   FKNYNVKLIIGTADPGIKEVPYLSLEDLIAGRGDVLLSRILKGIVDDETVEQVNQKIVR
FT                   LFSLQNVLHHLTILNPDKIIVQVEKAISDLERFIGIRFSNDLKISLYIHVSVMVERLVM
FT                   KEPITSYSNLEEFEQCHRQFINFVKSAFSVIEETYKVEIPTTEIGFIYDLIKDRVPNMK
FT                   L"
FT   misc_feature    195861..196274
FT                   /gene="AtoC"
FT                   /locus_tag="TTE0191"
FT                   /note="Pfam match to entry sigma54, Sigma-54 interaction
FT                   domain, score 65.8, E-value 2.80E-17"
FT   gene            198405..198830
FT                   /gene="ManX"
FT                   /locus_tag="TTE0192"
FT   regulatory      198405..198409
FT                   /gene="ManX"
FT                   /locus_tag="TTE0192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198420..198830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ManX"
FT                   /locus_tag="TTE0192"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /note="Best Blastp hit = gi|12721142|gb|AAK02918.1|
FT                   (AE006122) unknown [Pasteurella multocida], score 68.2,
FT                   E-value 4.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23493"
FT                   /db_xref="GOA:Q8RD55"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="PDB:3LFH"
FT                   /db_xref="PDB:5IM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD55"
FT                   /protein_id="AAM23493.1"
FT                   /translation="MKEKFVLIITHGDFGKGLLSGAEVIIGKQENVHTVGLNLGDNIEV
FT                   VRKEVEKIIKEKLQEDKEIIIVVDLFGGSPFNIALSMMKEYDVKVITGINMPMLVELLT
FT                   SINVYDTTELLENISKIGKDGIKVIEKSSLKM"
FT   gene            198835..199351
FT                   /locus_tag="TTE0193"
FT   regulatory      198835..198839
FT                   /locus_tag="TTE0193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198848..199351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0193"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /note="Best Blastp hit = gi|1142714|gb|AAB04152.1| (U28163)
FT                   phosphoenolpyruvate:mannose phosphotransferase element IIB
FT                   [Lactobacillus curvatus], score 105, E-value 3.00E-22"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23494"
FT                   /db_xref="GOA:Q8RD54"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="PDB:3LFJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD54"
FT                   /protein_id="AAM23494.1"
FT                   /translation="MWKIVFARIDDRLIHGQVMTRWMKGFPEASIVIIDDELAVDEFMK
FT                   NIYTMAAPPGVKVKVFGVDAALKEWSQKTSVEEKVFLLFKNIDTCKRVMDGGLPITTLN
FT                   IGGVAKTPQRKGISQSVSLSEDEVKTLLELKTKYNVDVYLQMIPDSEKIHLTTVVEKYF
FT                   PELK"
FT   gene            199406..201085
FT                   /locus_tag="TTE0194"
FT   regulatory      199406..199410
FT                   /locus_tag="TTE0194"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199421..201085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0194"
FT                   /product="mannose-specific PTS enzyme IID"
FT                   /note="Best Blastp hit = gi|131485|sp|P08188|PTND_ECOLI
FT                   'PTS SYSTEM, MANNOSE-SPECIFIC IID COMPONENT (EIID-MAN)
FT                   (MANNOSE-PERMEASE IID COMPONENT) (PHOSPHOTRANSFERASE ENZYME
FT                   II, D COMPONENT) (EII-M-MAN)' gi|66860|pir||WQECMM
FT                   'phosphotransferase system enzyme II (EC 2.7.1.69),
FT                   mannose-specific, factor IID - Escherichia coli'
FT                   gi|147404|gb|AAA24445.1| (J02699) mannose permease subunit
FT                   II-M-Man [Escherichia coli] gi|1736464|dbj|BAA15631.1|
FT                   '(D90826) PTS system, Mannose-specific IID component
FT                   (EIID-MAN) (Mannose- permease IID component)
FT                   (Phosphotransferase enzyme II, D component) (EII-M-MAN).
FT                   [Escherichia coli]' gi|1788122|gb|AAC74889.1| '(AE000276)
FT                   PTS enzyme IID, mannose-specific [Escherichia coli K12]'
FT                   gi|12515862|gb|AAG56808.1|AE005404_11 '(AE005404) PTS
FT                   enzyme IID, mannose-specific [Escherichia coli O157:H7
FT                   EDL933]' gi|13361996|dbj|BAB35952.1| (AP002558)
FT                   mannose-specific PTS enzyme IID [Escherichia coli O157:H7],
FT                   score 157, E-value 4.00E-37"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23495"
FT                   /db_xref="GOA:Q8RD53"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD53"
FT                   /protein_id="AAM23495.1"
FT                   /translation="MAISALQAALIAAWVAIVESRIIGYTLSGFLRFTAVGTGLVVGLI
FT                   MGNVPQAMIIAATIQLVYMGVIAPGGTTPSETVVATAVAVPVALASGMAPEQSIAVAVP
FT                   VGLLASYLVSFRFFINSLITHWVDRLAEELNDRGITFASIILPTIITISLFFPSVFVAV
FT                   YYGAPLIDSFLKTIPASVLHALTVVGGSLPALGIALTLAVIGRRDLMVFYFLAYFVSLI
FT                   LKPLNVNALVYAILGGIAAYLYVALYYRSALEENNANSENVSSGEEPQYEKESLPQNEL
FT                   KVTEKDLKMTWFRWWLTVEVPHSFERLQALSFQWAIMPVLRKLYGKNPEELKEAYKRHL
FT                   VFFNTQGTWGGAPILGITLSLEEQRARAIAKGEEAPDPNIINATKVGLMGPLAGIGDSV
FT                   EWSTIMYLLIAIALPWAKSGSAMGALFPLILFPVITYAYGYYFLRMGYRLGRESVSVLL
FT                   GGEKIKTLITGLSTLGLFMMGILTSNYVSVSTPLKWTISGKVFELQAILDKILPGMLPL
FT                   LTVLLVYWYFTKKGLKVLKVLGWMVVIFFILGWIGVL"
FT   regulatory      201093..201116
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            201160..202578
FT                   /gene="Gnd"
FT                   /locus_tag="TTE0195"
FT   regulatory      201160..201164
FT                   /gene="Gnd"
FT                   /locus_tag="TTE0195"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        201175..202578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Gnd"
FT                   /locus_tag="TTE0195"
FT                   /product="6-phosphogluconate dehydrogenase, family 1"
FT                   /note="Best Blastp hit = gi|7431259|pir||A72377
FT                   '6-phosphogluconate dehydrogenase, decarboxylating -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4980945|gb|AAD35523.1|AE001722_7 '(AE001722)
FT                   6-phosphogluconate dehydrogenase, decarboxylating
FT                   [Thermotoga maritima]', score 614, E-value 1.00E-175"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23496"
FT                   /db_xref="GOA:Q8RD52"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD52"
FT                   /protein_id="AAM23496.1"
FT                   /translation="MNDVGLIGLAVMGQNFALNMARKGYRVSVYNRTPERTKKFVEEKV
FT                   RDESIFPFYTIEEFVKSLKKPRKIILMIKAGKAVDDMIAEILPYLELGDLIVDSGNSHF
FT                   ADTARRLEYLSQKNILFLGMGISGGEYGALHGPSLMPGGTKEAYDLIKDILLKAAAKTE
FT                   DGPCCTYVGKGSAGHFVKMVHNGIEYAIMQLIAEVYDFMKKVLNMTNEQIGDVFEKWNK
FT                   GELNSYLMEISYKIMRYKDKETGGFLIDYILDKAEQKGTGKWTAQTSLDLGVPTPTLNL
FT                   AVEARIISHYKEERKILSKLYSKEKNIISVNKEEMIEHLKKALLFGVFMSFSQGLWLID
FT                   EASKQYNYGIDLSEILRIWKGGCIIRAEILDFLRDIIRENEEDANLLHSDKAIDFIKDK
FT                   LNSIYQVTEIGKNYRIPLMTMNSALDYYFALTEENLPANIIQAQRDFFGAHTYERIDRE
FT                   GIFHTEWER"
FT   misc_feature    201202..202536
FT                   /gene="Gnd"
FT                   /locus_tag="TTE0195"
FT                   /note="Pfam match to entry 6PGD, 6-phosphogluconate
FT                   dehydrogenase, score 704.5, E-value 5.10E-208"
FT   gene            202771..204121
FT                   /gene="TrkG"
FT                   /locus_tag="TTE0196"
FT   regulatory      202771..202775
FT                   /gene="TrkG"
FT                   /locus_tag="TTE0196"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202787..204121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TrkG"
FT                   /locus_tag="TTE0196"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /note="Best Blastp hit = gi|2581795|gb|AAC46143.1|
FT                   (AF001974) putative TrkG [Thermoanaerobacter ethanolicus],
FT                   score 579, E-value 1.00E-164"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23497"
FT                   /db_xref="GOA:Q8RD51"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD51"
FT                   /protein_id="AAM23497.1"
FT                   /translation="MIKIKLTPTQVLALGFATIILIGTLLLMLPVATKSGEGADFITAL
FT                   FTATSATCVTGLVVVDTETYWSTFGQIVIMLLIQVGGLGIMTMSTLFALILGRRITFKE
FT                   RLVMQEAFNTNSLGGIVKFAKYILMVSFLFESIGAIILTLRFLPQMGLKKAVYYGLFHS
FT                   ISAFNNAGFDLMGNFRSLTGYVSDWVVNLVIMSLIIFGGLGFYVLLDIYEHRHFSKLTL
FT                   HSKAVITITLFLIAGGALLIFLFEYNNPKTLKPLDFPTKILASLFQAVTPRTAGFNTLS
FT                   LSDMTIASKFLTIILMFIGASPAGTGGGIKTTTFGVILYTVLSVIKGEEETVLYKRTIS
FT                   RNIVYKAVAISFISVFIIFSVTMVLSITETSDFLTLLYETTSAFGTVGLSLGLTPELTT
FT                   VGRIIIIFTMYTGRVGPLTLALALAQRQKKPKPIMKYVEEKIMVG"
FT   misc_feature    202811..204070
FT                   /gene="TrkG"
FT                   /locus_tag="TTE0196"
FT                   /note="Pfam match to entry TrkH, Sodium transport protein,
FT                   score 470.7, E-value 1.20E-137"
FT   gene            204127..204790
FT                   /gene="TrkA"
FT                   /locus_tag="TTE0197"
FT   regulatory      204127..204131
FT                   /gene="TrkA"
FT                   /locus_tag="TTE0197"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204137..204790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TrkA"
FT                   /locus_tag="TTE0197"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /note="Best Blastp hit = gi|2581796|gb|AAC46144.1|
FT                   (AF001974) putative TrkA [Thermoanaerobacter ethanolicus],
FT                   score 335, E-value 4.00E-91"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23498"
FT                   /db_xref="GOA:Q8RD50"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD50"
FT                   /protein_id="AAM23498.1"
FT                   /translation="MKQFVVIGLGSFGISLAKTLYEMGNDVLVIDKDEELVQSMAGLVT
FT                   HAVRADATDENVLKSLGVKNFDVAIVAIGKNMESSIMITMLVKEMGVKYVIAKAHNELH
FT                   ARVLYKVGADRVVMPEKDMGIRVARNIFSSNLLDLIEFSKDYSIAEILPIEEWFHKTLK
FT                   EIRMRERYGLNVIAAKKMNNEIIVSPGPDYVVDEGDILAVCGKNIDIKKFEIKM"
FT   misc_feature    204143..204493
FT                   /gene="TrkA"
FT                   /locus_tag="TTE0197"
FT                   /note="Pfam match to entry KTN, KTN NAD-binding domain,
FT                   score 180.6, E-value 2.60E-50"
FT   misc_feature    204536..204787
FT                   /gene="TrkA"
FT                   /locus_tag="TTE0197"
FT                   /note="Pfam match to entry TrkA, Potassium channel, score
FT                   55.1, E-value 1.50E-12"
FT   gene            204821..205034
FT                   /locus_tag="TTE0198"
FT   regulatory      204821..204825
FT                   /locus_tag="TTE0198"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204855..205034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0198"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gi|2581798|gb|AAC46146.1|
FT                   (AF001974) xylulose kinase; XylB [Thermoanaerobacter
FT                   ethanolicus], score 50.8, E-value 2.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23499"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD49"
FT                   /protein_id="AAM23499.1"
FT                   /translation="MPKCYESMDVTGYVTKDVVDLTGLKEGTIIIGRTSISSRSNWSSI
FT                   SCYFRVVCVFETTI"
FT   gene            205037..205970
FT                   /gene="MviM"
FT                   /locus_tag="TTE0199"
FT   regulatory      205037..205041
FT                   /gene="MviM"
FT                   /locus_tag="TTE0199"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205047..205970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MviM"
FT                   /locus_tag="TTE0199"
FT                   /product="predicted dehydrogenases and related proteins"
FT                   /note="Best Blastp hit = gi|2498599|sp|P75931|MVIM_ECOLI
FT                   VIRULENCE FACTOR MVIM HOMOLOG gi|7466881|pir||A64850
FT                   probable virulence factor mviM - Escherichia coli
FT                   gi|1787307|gb|AAC74152.1| (AE000207) putative virulence
FT                   factor [Escherichia coli K12] gi|4062647|dbj|BAA35876.1|
FT                   (D90743) MviM protein [Escherichia coli], score 131,
FT                   E-value 1.00E-29"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23500"
FT                   /db_xref="GOA:Q8RD48"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD48"
FT                   /protein_id="AAM23500.1"
FT                   /translation="MKKLKAIIVGPGNIFNKAYLPFIFTLEELEIVGIVGRNEEKLKKY
FT                   KEKYGCSVYTDLEEAIKLKPDCAFVHTATVSHYEIVRMLLENGVNVYVDKPITNEIDKT
FT                   KELIDLARKKSLIFTIGFNRRYAPLYQKAFEFFESVKPELCLMEKHRDNDIRDDLKYTL
FT                   YDDFIHIADTLYYIVKEVGELDIHVLKENNALKSIMVTLKSKNYTAIGLMHRNTGKDYE
FT                   KLEIHGNNRSAVVEDMELLRTMEKRRVEVHTFGSWDSTSYKKGFVNIVKSFIRNVLDDN
FT                   KKLANEELDYALKAHEIVEEIYKKAL"
FT   misc_feature    205056..205412
FT                   /gene="MviM"
FT                   /locus_tag="TTE0199"
FT                   /note="Pfam match to entry GFO_IDH_MocA, Oxidoreductase
FT                   family, NAD-binding Rossmann fold, score 73.7, E-value
FT                   3.70E-18"
FT   regulatory      205964..205999
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(205993..207237)
FT                   /locus_tag="TTE0200"
FT   CDS_pept        complement(205993..207237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0200"
FT                   /product="predicted ATPase related to phosphate
FT                   starvation-inducible protein PhoH"
FT                   /note="Best Blastp hit = gi|7475749|pir||A69873 phosphate
FT                   starvation inducible protein homolog ylaK - Bacillus
FT                   subtilis gi|2224770|emb|CAB09716.1| (Z97025) product
FT                   similar to E. coli PhoH protein [Bacillus subtilis]
FT                   gi|2633852|emb|CAB13354.1| (Z99111) similar to phosphate
FT                   starvation inducible protein [Bacillus subtilis], score
FT                   452, E-value 1.00E-126"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23501"
FT                   /db_xref="GOA:Q8RD47"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD47"
FT                   /protein_id="AAM23501.1"
FT                   /translation="MIEEIDSMKNLQNEVGRNARLVGRILDRLREKGKLNEGVPLENGG
FT                   LIKIELNHIANETVKEHFLEIANDNRILAVALNLFHEEQKKENPMPVILVSKDVIMRVK
FT                   ADTLGISSQDYLSDKIKNYDALYTGFITVFVHPSTIDSFYTEKHLPKSQVPELKETIDI
FT                   YPNQFVIFKDSFGSNKSAVARYNKYTDSFEHLYSPESVWDVSPRNVQQRMAMDLLVNDS
FT                   IPIVTLTGKSGTGKSLLALAWELSKVLDEKVYNKLLIARPIVPMGNDIGYLPGDKEEKL
FT                   KPWMKPIYDNFEYIFRNRKTDTNIEDVIAGIKNIEIEALTYIRGRSIPKQFIIIDEAQN
FT                   LTRHEIKTTISRVGESSKIVLLGDPEQIDNPYLDATSNGLTQVVEKFKESKLSGHVTLI
FT                   KGERSKVAELAAKLL"
FT   misc_feature    complement(206014..206949)
FT                   /locus_tag="TTE0200"
FT                   /note="Pfam match to entry PhoH, PhoH-like protein, score
FT                   -90.6, E-value 4.30E-08"
FT   gene            207503..208532
FT                   /gene="PurR2"
FT                   /locus_tag="TTE0201"
FT   regulatory      207503..207507
FT                   /gene="PurR2"
FT                   /locus_tag="TTE0201"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207516..208532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PurR2"
FT                   /locus_tag="TTE0201"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|1168844|sp|P46828|CCPA_BACME
FT                   GLUCOSE-RESISTANCE AMYLASE REGULATOR (CATABOLITE CONTROL
FT                   PROTEIN) gi|2126809|pir||I39800 catabolite control protein
FT                   - Bacillus megaterium gi|415664|gb|AAA22295.1| (L26052)
FT                   catabolite control protein [Bacillus megaterium], score
FT                   256, E-value 2.00E-67"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23502"
FT                   /db_xref="GOA:Q8RD46"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD46"
FT                   /protein_id="AAM23502.1"
FT                   /translation="MAVTIKDIARLANVSVTTVSRVINNKPEGVSEETRQKILKLVKEL
FT                   GYQPNAIARGLVTKKTKTIGLIIPDISNPFFPDIARGVEDSAHIYGYNVFLCNTDDNLE
FT                   KESEYIRALKEKYVDGIIFTSSSIPKHEHIIELVESGIPVVIMDRRVDSENIYGVFLDN
FT                   YEGGYIATKHLIDLGHEKIGCITGPLYTKSAKERLEGYKKALLDSGIKIDEKLIFEGDY
FT                   KINGGIIGAERLLKDNKDMSAIFACNDLMAYGAYKTIRSFGYKIPDDISVVGFDDIQLS
FT                   QILEPQLSTIKQPAYDMGLTAARMLIKLIEGKKLKKKIINFRPQLVIRQSTKLVKGG"
FT   misc_feature    207516..207599
FT                   /gene="PurR2"
FT                   /locus_tag="TTE0201"
FT                   /note="Pfam match to entry lacI, Bacterial regulatory
FT                   proteins, lacI family, score 54.2, E-value 5.60E-14"
FT   misc_feature    207696..208526
FT                   /gene="PurR2"
FT                   /locus_tag="TTE0201"
FT                   /note="Pfam match to entry Peripla_BP_like, Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family., score 123, E-value 5.40E-33"
FT   gene            208523..209456
FT                   /gene="RbsK"
FT                   /locus_tag="TTE0202"
FT   regulatory      208523..208527
FT                   /gene="RbsK"
FT                   /locus_tag="TTE0202"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208536..209456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsK"
FT                   /locus_tag="TTE0202"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /note="Best Blastp hit = gi|11352488|pir||B83403 ribokinase
FT                   PA1950 [imported] - Pseudomonas aeruginosa (strain PAO1)
FT                   gi|9947947|gb|AAG05338.1|AE004621_9 (AE004621) ribokinase
FT                   [Pseudomonas aeruginosa], score 224, E-value 1.00E-57"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23503"
FT                   /db_xref="GOA:Q8RD45"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD45"
FT                   /protein_id="AAM23503.1"
FT                   /translation="MRKIVVVGSINMDIVIRVPRIPVVGETVIAYDLKNYGGGKGANQA
FT                   VSIARLGGNVSMIGRVGNDEYGQKLYRDLKSNGVGVEGIEFDSETPTGTAYINVSEKGE
FT                   NNIVVYQGANKRLNMTQIKRYEHFFDEAEICLLQLEIPIETVKFVVDLCYSRGIKVILN
FT                   PAPAYELPDTVLEKVYILTPNETELAFLSKSKIETIEDIRKASKYLLDKGVQNVITTIG
FT                   EKGSYFINKNTEKLFDAIKVTAVDTTAAGDSFTGALAFALSKGEKIEDAIRFATFVAAL
FT                   TVTKEGAQTSLPYKEEVEKFIKERS"
FT   misc_feature    208536..209420
FT                   /gene="RbsK"
FT                   /locus_tag="TTE0202"
FT                   /note="Pfam match to entry pfkB, pfkB family carbohydrate
FT                   kinase, score 299.2, E-value 5.10E-86"
FT   gene            209448..209853
FT                   /gene="RbsD"
FT                   /locus_tag="TTE0203"
FT   regulatory      209448..209452
FT                   /gene="RbsD"
FT                   /locus_tag="TTE0203"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        209461..209853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsD"
FT                   /locus_tag="TTE0203"
FT                   /product="uncharacterized components of ribose/xylose
FT                   transport systems"
FT                   /note="Best Blastp hit = gi|12720374|gb|AAK02240.1|
FT                   (AE006050) RbsD [Pasteurella multocida], score 125, E-value
FT                   3.00E-28"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23504"
FT                   /db_xref="GOA:Q8RD44"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD44"
FT                   /protein_id="AAM23504.1"
FT                   /translation="MKKTELLNSEISEVVARLGHKDLLVIADSGLPIPDNVKRIDIALT
FT                   KGIPSFRDTLNTVLTELGVEKAYVAREMIDKNKKLYLELSEQFGDKLVIIDHEQLKEMC
FT                   KNAKAVIRTGEYTPYANIVLESGVEF"
FT   gene            209857..211362
FT                   /gene="MglA"
FT                   /locus_tag="TTE0204"
FT   regulatory      209857..209861
FT                   /gene="MglA"
FT                   /locus_tag="TTE0204"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        209872..211362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MglA"
FT                   /locus_tag="TTE0204"
FT                   /product="ABC-type sugar (aldose) transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|290599|gb|AAA62102.1| (L10328)
FT                   high affinity ribose transport protein [Escherichia coli],
FT                   score 520, E-value 1.00E-146"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23505"
FT                   /db_xref="GOA:Q8RD43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD43"
FT                   /protein_id="AAM23505.1"
FT                   /translation="MEPILQMKGISKKFGNVKVLDNVDLTLYRGRVLALLGENGAGKST
FT                   LMKILCGIYEKDEGSIYLKGKKVNIRNVRDAEKYGIAMIHQELNLVPSLSVAENIFLGR
FT                   EYVRTFNSIDWKKIKQESAKILHELGMDLNVDRLVKHLSVGEQQMVEIARSLLMNAEIL
FT                   VMDEPTAALTEGETRRLFEVIKRLRKEGKSIIYISHRMNEIFEICDDYIVLRDGCLISQ
FT                   GEISEVTRDDLVKMMVGRELKEHFPYECSSPGEEILRVENLTVKGMFEKVSFVVKKGEV
FT                   VGFAGLIGAGRTEVAKTIFGFYKKTSGKIYLGGEEVKINSPRDAIEKGIMYLSEDRRNE
FT                   GLIIKHTLKENMTLSALKKISDYIGTINFSKERSIVNEMIQKLNIKSFSPNQKIFRLSG
FT                   GNQQKVAIAKCLLTNPKLIILDEPTRGIDVGAKNEIYKLINDLKRQGIGIILISSELPE
FT                   VLNISDRIIVMHEGKITGEISREEATEEKVMLKAVGGE"
FT   misc_feature    209959..210522
FT                   /gene="MglA"
FT                   /locus_tag="TTE0204"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   212.2, E-value 8.00E-60"
FT   misc_feature    210706..211287
FT                   /gene="MglA"
FT                   /locus_tag="TTE0204"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   120.6, E-value 2.80E-32"
FT   gene            211350..212320
FT                   /gene="AraH"
FT                   /locus_tag="TTE0205"
FT   regulatory      211350..211354
FT                   /gene="AraH"
FT                   /locus_tag="TTE0205"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211364..212320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AraH"
FT                   /locus_tag="TTE0205"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Best Blastp hit = gi|10176355|dbj|BAB07450.1|
FT                   (AP001519) ribose ABC transporter (permease) [Bacillus
FT                   halodurans], score 229, E-value 4.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23506"
FT                   /db_xref="GOA:Q8RD42"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD42"
FT                   /protein_id="AAM23506.1"
FT                   /translation="MKLPNEKAMKINIGELLLKAKSLIGLLGLIIAFSILSPRFLDYYN
FT                   LTNVLRQTSLNAIMAVGMTFVILTGGIDLSVGSILAFSSAVTAGMLKDGMPLIIALLAG
FT                   LIIGTGLGLFNGFVIIRWNIPPFIATFAMMTIARGLTLVYTNGQPITGLGKAFGYIGNG
FT                   YVGSIPVPIIITILVFVIGYYILKNNRLGRYVYATGGNLQAAKLAGINTNKIILFVYAL
FT                   SGFLAAVSGLIITSRLNSAAPTAGQGAELDAIAAVVLGGTSLSGGEGGIIGTLIGALII
FT                   GVLNNGLNLLNVSPFYQYIVKGVVILLAIALDKKESE"
FT   gene            212394..213351
FT                   /gene="RbsB"
FT                   /locus_tag="TTE0206"
FT   regulatory      212394..212398
FT                   /gene="RbsB"
FT                   /locus_tag="TTE0206"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212410..213351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsB"
FT                   /locus_tag="TTE0206"
FT                   /product="Periplasmic sugar-binding proteins"
FT                   /note="Best Blastp hit = gi|12720371|gb|AAK02237.1|
FT                   (AE006050) RbsB [Pasteurella multocida], score 325, E-value
FT                   5.00E-88"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23507"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:2IOY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD41"
FT                   /protein_id="AAM23507.1"
FT                   /translation="MRKSRILLLLTIFVTSAALILSGCKTNTPNTASTSTKEGKTIGLV
FT                   ISTLNNPFFVTLKNGAEEKAKELGYKIIVEDSQNDSSKELSNVEDLIQQKVDVLLINPV
FT                   DSDAVVTAIKEANSKNIPVITIDRSANGGDVVCHIASDNVKGGEMAAEFIAKALKGKGN
FT                   VVELEGIPGASAARDRGKGFDEAIAKYPDIKIVAKQAADFDRSKGLSVMENILQAQPKI
FT                   DAVFAQNDEMALGAIKAIEAANRQGIIVVGFDGTEDALKAIKEGKMAATIAQQPALMGS
FT                   LGVEMADKYLKGEKIPNFIPAELKLITKENVQ"
FT   misc_feature    212524..213333
FT                   /gene="RbsB"
FT                   /locus_tag="TTE0206"
FT                   /note="Pfam match to entry Peripla_BP_like, Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family., score 44, E-value 3.40E-09"
FT   gene            213341..213538
FT                   /locus_tag="TTE0207"
FT   CDS_pept        213341..213538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23508"
FT                   /db_xref="GOA:Q8RD40"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD40"
FT                   /protein_id="AAM23508.1"
FT                   /translation="MYSDLRFLPVTKVTGVFLFNFIVIIGKYICQVFNDSILNLKLYSK
FT                   FSIDTIEMKTFNDIIIYNLE"
FT   regulatory      213364..213385
FT                   /locus_tag="TTE0207"
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            213593..215255
FT                   /gene="OppA2"
FT                   /locus_tag="TTE0208"
FT   regulatory      213593..213597
FT                   /gene="OppA2"
FT                   /locus_tag="TTE0208"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        213609..215255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppA2"
FT                   /locus_tag="TTE0208"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, periplasmic components"
FT                   /note="Best Blastp hit = gi|98474|pir||A38447 oligopeptide
FT                   ABC transport system substrate-binding protein oppA
FT                   precursor - Bacillus subtilis gi|143603|gb|AAA62687.1|
FT                   (M57689) sporulation protein [Bacillus subtilis]
FT                   gi|2633497|emb|CAB13000.1| (Z99110) oligopeptide ABC
FT                   transporter (binding protein) [Bacillus subtilis], score
FT                   387, E-value 1.00E-106"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23509"
FT                   /db_xref="GOA:Q8RD39"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD39"
FT                   /protein_id="AAM23509.1"
FT                   /translation="MRGKKSIISLFVAVLFILSLSFSGCSKSSNPISSQKVLADEQVLN
FT                   INLGEEPPSLDPQLATDLVSFEMLNATLEGLVRLNKYGKIEKGSGLALDWEVSPDGLRY
FT                   VFHLRDAKWSDGTPITAHDFEYAWKRALDPKTGSNYAYMLYYLKNGEAFNKGEAKAEDV
FT                   GVRALNDKTLEVILERPAPQFLGLTGWGTYLPAQKAAIEKFGDKYGTSPDTMVYSGPYM
FT                   IKEWNHEQNIVLVKNPYYWDKDSVKLQQINMDMVKEENTIIQNWETGRYDSISVPAQYI
FT                   AKYKNDPNFHQMPIGVTYYVMFNNKSKIFSNVNIRKAFSYAIDRQSFVDYVFAGGGIPA
FT                   LAFVPPGIPGDKEEFRKEGGDYFKDNDVAKAKELLAQGMRELGIDKLPKIKFVAGDSDA
FT                   ARKHSQVLQEFWSKNLGVTVDIYNVAFKVRLDMMNKGDYDIVYTNWVADYNDPMTFLDL
FT                   WVTDGGNNRAFYSNPQYDQLIKKANSTIDNSVGMQAMHEAENILMEDMPIAPLLFRITS
FT                   YLERPYVKDWIRFPVGIDDEWKWTYIEGKNK"
FT   misc_feature    213648..215147
FT                   /gene="OppA2"
FT                   /locus_tag="TTE0208"
FT                   /note="Pfam match to entry SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   422.6, E-value 3.70E-123"
FT   regulatory      215258..215298
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            215448..216259
FT                   /gene="MurI"
FT                   /locus_tag="TTE0209"
FT   regulatory      215448..215452
FT                   /gene="MurI"
FT                   /locus_tag="TTE0209"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        215459..216259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MurI"
FT                   /locus_tag="TTE0209"
FT                   /product="Glutamate racemase"
FT                   /note="Best Blastp hit = gi|1346607|sp|P48797|MURI_LACBR
FT                   GLUTAMATE RACEMASE gi|1075977|pir||JC4005 glutamate
FT                   racemase (EC 5.1.1.3) - Lactobacillus brevis
FT                   gi|468450|dbj|BAA06106.1| (D29627) glutamate racemase
FT                   [Lactobacillus brevis], score 186, E-value 2.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23510"
FT                   /db_xref="GOA:Q8RD38"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD38"
FT                   /protein_id="AAM23510.1"
FT                   /translation="MDKNGPIGIIDSGVGGITVLKRLLEILPEEDYIYFGDTLRVPYGN
FT                   RPKEEIEKFTREIVNYLKKQKVKAVVIACNTICSSINKNDYEILMFGILEAGIKSAVEA
FT                   TSNGRIGVIATKRTVESEAYLKGIKRLNRNAMVFQKACPELVLIVENGFYEASSIYSAV
FT                   KKCTEEFLEKDIDTLVLGCTHFPILLPFIERVVDNKVTVVDPAIKLAHEVKKYLVENNL
FT                   VKDKKGGQIRFLVTGEKENFIKVAGTFLNDKHIDVLRIAIEELK"
FT   misc_feature    215477..216112
FT                   /gene="MurI"
FT                   /locus_tag="TTE0209"
FT                   /note="Pfam match to entry Asp_Glu_race, Asp/Glu/Hydontoin
FT                   racemase, score 230.7, E-value 2.10E-65"
FT   gene            216267..217624
FT                   /gene="LysA"
FT                   /locus_tag="TTE0210"
FT   regulatory      216267..216271
FT                   /gene="LysA"
FT                   /locus_tag="TTE0210"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216281..217624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LysA"
FT                   /locus_tag="TTE0210"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /note="Best Blastp hit = gi|729299|sp|P41023|DCDA_BACMT
FT                   DIAMINOPIMELATE DECARBOXYLASE (Dap DECARBOXYLASE)
FT                   gi|2144180|pir||I39877 diaminopimelate decarboxylase (EC
FT                   4.1.1.20) - Bacillus methanolicus gi|304155|gb|AAC36985.1|
FT                   (L18879) diaminopimelate decarboxylase [Bacillus
FT                   methanolicus], score 446, E-value 1.00E-124"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23511"
FT                   /db_xref="GOA:Q8RD37"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD37"
FT                   /protein_id="AAM23511.1"
FT                   /translation="MFYNSIKVNSKGHLVIGGCDAVELAERFGTPLYVIDEDVLRANSR
FT                   IFYNALKSHNPENEVVYAGKAFLTTAMCKIIQQEGLGLDVVSGGELYTALKAGFPTEKI
FT                   YFHGNNKSEEELIMALQSEVGRIIIDNWDELELLEILAKKLNKEPAIYIRVTPGIEAHT
FT                   HRYIMTGQIDSKFGFTISNGEAFKAVKRALTSGSLKFKGLHCHIGSQILESTPYKIAVK
FT                   IMLELLKEIKDTLGRGVEELDLGGGFGIPYVEDDSYQPVEEMLRDILEELEAQVSLLKI
FT                   KLPKIIVEPGRAIIGNTGITLYKVGGVKEIPGVRKYVFVDGGMSDNIRTALYGARYSAV
FT                   IANRVYNGRLEKVTIAGKLCESGDVIIWDILLPEVKKGDIIAVLNTGAYGYSMASNYNR
FT                   LPKPAVILVSKGKAEIIVKRETYEDVIKNDVIPERLEEKFQGREMQAI"
FT   misc_feature    216386..217171
FT                   /gene="LysA"
FT                   /locus_tag="TTE0210"
FT                   /note="Pfam match to entry Orn_Arg_deC_N,
FT                   Pyridoxal-dependent decarboxylase, pyridoxal binding
FT                   domain, score 258.4, E-value 1.40E-75"
FT   misc_feature    217178..217507
FT                   /gene="LysA"
FT                   /locus_tag="TTE0210"
FT                   /note="Pfam match to entry Orn_Dap_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, C-terminal sheet domain,
FT                   score 137.2, E-value 1.30E-37"
FT   gene            217724..218585
FT                   /gene="RpiR"
FT                   /locus_tag="TTE0211"
FT   regulatory      217724..217728
FT                   /gene="RpiR"
FT                   /locus_tag="TTE0211"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        217737..218585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpiR"
FT                   /locus_tag="TTE0211"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|7388462|sp|Q45581|YBBH_BACSU
FT                   HYPOTHETICAL 33.3 KDA PROTEIN IN FEUA-SIGW INTERGENIC
FT                   REGION gi|1944008|dbj|BAA19503.1| (AB002150) YbbH [Bacillus
FT                   subtilis], score 194, E-value 1.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23512"
FT                   /db_xref="GOA:Q8RD36"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD36"
FT                   /protein_id="AAM23512.1"
FT                   /translation="MTDVLAVIREMSSSFTPSEAKIAKYILENPTVVTELSVNELANAC
FT                   DTSEASIIRFCRTIGLKGFQELKIKIAVSLAKQTRKLDGGITSEDDVMAVIQKIANFNK
FT                   QAIDSTIAVLNAEELTKAAEALANANKIDFYGVAASGVVAYDAMLKFSRINIPCTAYQD
FT                   THLQLTSAVNLKKGDVAFGISYSGATKEIVEAIQTAKEAGATTISLTKYGQSPLAKAAD
FT                   INLFVSSEEAMFRAGAMASRIAQLTVIDILFILVAQKKYNDVVRYLENTSEVLSMRKIN
FT                   N"
FT   misc_feature    217740..218057
FT                   /gene="RpiR"
FT                   /locus_tag="TTE0211"
FT                   /note="Pfam match to entry HTH_6, Helix-turn-helix domain,
FT                   rpiR family, score 118.2, E-value 1.60E-31"
FT   misc_feature    218103..218510
FT                   /gene="RpiR"
FT                   /locus_tag="TTE0211"
FT                   /note="Pfam match to entry SIS, SIS domain, score 101.1,
FT                   E-value 2.20E-26"
FT   gene            218595..219528
FT                   /locus_tag="TTE0212"
FT   regulatory      218595..218599
FT                   /locus_tag="TTE0212"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        218608..219528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0212"
FT                   /product="predicted sugar phosphate isomerase"
FT                   /note="Best Blastp hit = gi|2494700|sp|P76535|YFEU_ECOLI
FT                   31.2 KDA PROTEIN IN CYSP-AMIA INTERGENIC REGION
FT                   gi|7448150|pir||C65017 hypothetical protein b2428 -
FT                   Escherichia coli (strain K-12) gi|1788768|gb|AAC75481.1|
FT                   (AE000330) putative regulator [Escherichia coli K12], score
FT                   330, E-value 2.00E-89"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23513"
FT                   /db_xref="GOA:Q8RD35"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD35"
FT                   /protein_id="AAM23513.1"
FT                   /translation="MTLEELITEGRNPNTMDIDRLSTVDMLKKINEEDKKVPLAVEKVI
FT                   PSIAEAIDRIVPRMKKGGRLIYVGAGTSGRIGILDASECPPTFGVDPGLVVGIIAGGDS
FT                   AIRNAIESAEDDVEGGRQDLVNINLTERDSVIGISASGRTPYVIGALRYAKEVGALTIG
FT                   LFCNENKNVENIVDVMITPIVGPEVIMGSTRMKAGTAQKLVLNMISTGVMIKLGKVYSN
FT                   LMVDLQASNEKLRERARRMVKLATGAKEDLIERVLNETNYNVKLAILMIVGDMEKEKAQ
FT                   KLLEMADGYIAEAIKLKDLVLQGEE"
FT   gene            219516..220599
FT                   /gene="AmpC"
FT                   /locus_tag="TTE0213"
FT   regulatory      219516..219520
FT                   /gene="AmpC"
FT                   /locus_tag="TTE0213"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        219532..220599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AmpC"
FT                   /locus_tag="TTE0213"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /note="Best Blastp hit = gi|11228458|emb|CAC16441.1|
FT                   (AL450165) putative esterase [Streptomyces coelicolor],
FT                   score 180, E-value 3.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23514"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD34"
FT                   /protein_id="AAM23514.1"
FT                   /translation="MSFNLSKLEKAFMLLDKGIEEGVFPGVAAAVGDDKGFVRVEVKGN
FT                   KRLYPYDEKLNRESLFDLASLTKVVATTMLLMKMLESGLISVYDRVSEYIPNFKGDGKD
FT                   KITIFQLLTHTSGLPAYLPFYEKCKDYLDSINYICEEVKLNPNKNVEYSDLNFILLGRI
FT                   LEILGGNRLDTLCHKEVFEPLGMKDTMFNPIGKDVVPTELDKTTGKVIEGVCHDENARF
FT                   FGGVSGHAGLFSTIDDLVKFATMLINFGRVREEVFLSYPLFIRMITNYTPNSEENRGWG
FT                   WVIKGHTAFGGDLFSEKAFGHTGFTGTSIWVDPEYKVFMILLTNRVHPTRENVKIIRFR
FT                   RLFHNAVLSALDWRN"
FT   gene            220602..221744
FT                   /locus_tag="TTE0214"
FT   CDS_pept        220602..221744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|732404|sp|P40407|YBBC_BACSU
FT                   HYPOTHETICAL 46.0 KDA PROTEIN IN FEUA-SIGW INTERGENIC
FT                   REGION PRECURSOR (ORF2) gi|2126965|pir||I39840 hypothetical
FT                   protein ybbC - Bacillus subtilis gi|438456|gb|AAA64352.1|
FT                   '(L19954) 19/20 residue stretch (32-51) identical to
FT                   N-terminal putative signal sequence of unknown, partly
FT                   cloned B. subtilis gene.; putative [Bacillus subtilis]'
FT                   gi|1944005|dbj|BAA19498.1| (AB002150) YbbC [Bacillus
FT                   subtilis] gi|2632432|emb|CAB11941.1| (Z99104) alternate
FT                   gene name: yzbB [Bacillus subtilis], score 367, E-value
FT                   1.00E-100"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23515"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD33"
FT                   /protein_id="AAM23515.1"
FT                   /translation="MVKCGVDLLEKYKELFKGKRIGLITSPSGVNQDMKSTIEIFHENF
FT                   NLTALFSPEHGVRGEFQAGEKVKGYVDERTGVKVYSLYGDTKKPTPEMLEEIDVLVIDV
FT                   QDVGSRYYTYLYTMAYAMEACKENGKEFVVLDRPNPIGGLKVEGNILDTKFRSFVGWYP
FT                   IPQRYGLTIGELSHLFNKEFGINCDLHVVKLEGWKRDMYYDETGLLWVNPSPNISSLDA
FT                   AVLYSGTCLFEGTNISEGRGTTRPFEIIGAPWIDPYKLADSMNKKGLKGVVFRPVYFIP
FT                   SFSKHKGQLCKGVQIHVKDRKAVDSVEVGIKLLYEIIRQSGENFEWLPPYGESNVYFID
FT                   LLAGTDELRLMKYDEDQLLDKWKRESEEFKRLKESYHFYE"
FT   gene            221747..223339
FT                   /gene="BglX"
FT                   /locus_tag="TTE0215"
FT   regulatory      221747..221751
FT                   /gene="BglX"
FT                   /locus_tag="TTE0215"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221759..223339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BglX"
FT                   /locus_tag="TTE0215"
FT                   /product="Beta-glucosidase-related glycosidases"
FT                   /note="Best Blastp hit = gi|10173289|dbj|BAB04394.1|
FT                   (AP001509) beta-hexosamidase A precursor [Bacillus
FT                   halodurans], score 380, E-value 1.00E-104"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23516"
FT                   /db_xref="GOA:Q8RD32"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD32"
FT                   /protein_id="AAM23516.1"
FT                   /translation="MKKIEEMTLEEKIGQMLMIGFPSAFYDDHIRELVTSYKIGNVILF
FT                   SRNVQDARQVMDLCTDIQKEAIENTGIPAFISIDQEGGMVTRIYRGATYFPGNMAIGAT
FT                   KDPENAYKVGEIAGRELRTIGININFAPVMDVNNNPLNPVIGVRSYGENPEDVANFGIN
FT                   YIKGLQKEGVIATAKHFPGHGDTTVDSHLDLPKVNHGKDRLYEVELYPFKKAVENGVDA
FT                   IMTAHILFPALEDSKVPATLSYNILTRILREEFKFDGLVITDCMEMNAIAKYFGTQKAA
FT                   SMAIKAGADIVLVSHTKELQIKAFENIKEAVERGDISVERIDESVRRILKMKEKYGLFD
FT                   RPYPEKDKFDTTVGIEKHRKIAKAISLKSITVVKDEKKLIPLKTKNVLAISPETVPVSF
FT                   VDDALMDRLSFARQFTSTFGGVEETISVNPNNREISVILEKAKDKEVVVVGTYNANLNE
FT                   GQVKLVNALLQVNKNVIVVALRNPYDLQKFENVPTYVCAYEYTPLSVESVIGVLTGKYP
FT                   AEGKLPVTI"
FT   misc_feature    221822..222703
FT                   /gene="BglX"
FT                   /locus_tag="TTE0215"
FT                   /note="Pfam match to entry Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3 N terminal domain, score 304.8, E-value
FT                   1.00E-87"
FT   gene            223344..224281
FT                   /locus_tag="TTE0216"
FT   regulatory      223344..223348
FT                   /locus_tag="TTE0216"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        223358..224281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0216"
FT                   /product="predicted N-acetylglucosamine kinase"
FT                   /note="Best Blastp hit =
FT                   gi|6634777|gb|AAF19757.1|AC009917_16 (AC009917) F26G16.16
FT                   [Arabidopsis thaliana], score 142, E-value 6.00E-33"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23517"
FT                   /db_xref="GOA:Q8RD31"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD31"
FT                   /protein_id="AAM23517.1"
FT                   /translation="MEYVVGIDGGGTKSAISILDLQGNVLFTGRGGPTNIRSEGREKAC
FT                   ENLKNLIVKSVEKMHLKLGDCRAICVGTAGAGREEEKEIITNCLKEIGVKGNIVVTHDA
FT                   EIILSETIEKREGIVIIAGTGSLVYGRKDGIEKRAGGWGHLLGDEGSAYYIAVEGIKAA
FT                   LRYYDGRGNYTKLLYMMMERLNVKRPEEFIGFVYKDGITKADIAELAKVVDEAYKEGDK
FT                   EARKILEKSAKELFKLAKAVIEAFEWENDEIPIVVTGSVFINNEFVFKEFSRLIKRYYP
FT                   KANIKKLDKDASYGAAILALNFLKER"
FT   gene            224285..225486
FT                   /locus_tag="TTE0217"
FT   regulatory      224285..224289
FT                   /locus_tag="TTE0217"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        224296..225486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|6136599|sp|P74706|YB79_SYNY3
FT                   HYPOTHETICAL 41.4 KD PROTEIN SLR1179 gi|7429641|pir||S76913
FT                   hypothetical protein - Synechocystis sp. (strain PCC 6803)
FT                   gi|1653915|dbj|BAA18825.1| (D90917) hypothetical protein
FT                   [Synechocystis sp.], score 249, E-value 3.00E-65"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23518"
FT                   /db_xref="GOA:Q8RD30"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD30"
FT                   /protein_id="AAM23518.1"
FT                   /translation="MDRLLRIYNKEERLVVGLMSGTSADGIDAALVKVKGRGLDTKVEL
FT                   LEFEKFPYEEEVQKKIFELFDPHTGTVEKICHMNFLLGELFAEATLKLIKKAGLTPKDI
FT                   DLIGSHGQTIYHIPNFIEDMGYKVRSTLQIGEPAVIAERTGIVTVADFRVRDVAAGGQG
FT                   APLVPYTEYILYRSPNETIALQNIGGIGNVTVLPKGGSIEDVIAFDTGPGNMVIDEVVK
FT                   RITHGKMNFDKDGELASRGKVNEEFLAELLKDEFFKMKPPKTTGREHFGKNYVDNLMKK
FT                   ASYLEIDKYDLVATVTALTAYSVVRSYEKFIFPYYKVDKVVIGGGGSFNKTLVQMIKKQ
FT                   LPQVRVITQEDIGFNSDAKEAVAFAILASETINGNFNNIPKATGAKHPVVMGKISL"
FT   gene            225488..226460
FT                   /gene="RimI"
FT                   /locus_tag="TTE0218"
FT   regulatory      225488..225492
FT                   /gene="RimI"
FT                   /locus_tag="TTE0218"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        225501..226460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RimI"
FT                   /locus_tag="TTE0218"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23519"
FT                   /db_xref="GOA:Q8RD29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD29"
FT                   /protein_id="AAM23519.1"
FT                   /translation="MGIDYLPLARDKGEEIVRLWNKELGKEFPLRKELFYQNSLEDKNV
FT                   LLEGSWIALEKEKLVGFIISKIWKEDLECVKNKKDTGYIQVILVDSDYRNKGIGSELLR
FT                   KAEEALKANGVKTVVLGQDPWHYFPGIPSEYIDTVEWFKKKGYVEFGEEYDLYCRLNGE
FT                   GQVTLPVFPEVEFKILDKWQKNSFLEFLNRCFPGRWEYEAIKYFEKGGEGREFVVAEKK
FT                   GKIIGFCRINDSKSPFIAQNVYWAPLFEEELGGIGPLGIDPEERGKGYGLAIVQAGMYF
FT                   LNQRGIRNIVIDWTNLVDFYGKLGCKVWKRYIKYEKQF"
FT   misc_feature    225651..225944
FT                   /gene="RimI"
FT                   /locus_tag="TTE0218"
FT                   /note="Pfam match to entry Acetyltransf, Acetyltransferase
FT                   (GNAT) family, score 46.1, E-value 7.90E-10"
FT   misc_feature    226149..226421
FT                   /gene="RimI"
FT                   /locus_tag="TTE0218"
FT                   /note="Pfam match to entry Acetyltransf, Acetyltransferase
FT                   (GNAT) family, score 36.6, E-value 5.60E-07"
FT   gene            226524..227274
FT                   /locus_tag="TTE0219"
FT   regulatory      226524..226528
FT                   /locus_tag="TTE0219"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226537..227274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|1176704|sp|P42981|YPJG_BACSU
FT                   HYPOTHETICAL 24.8 KD PROTEIN IN DapB-PAPS INTERGENIC REGION
FT                   gi|7474677|pir||F69937 conserved hypothetical protein ypjG
FT                   - Bacillus subtilis gi|755605|gb|AAA92876.1| (L38424)
FT                   unknown [Bacillus subtilis] gi|1146236|gb|AAB38444.1|
FT                   (L47709) putative [Bacillus subtilis]
FT                   gi|2634665|emb|CAB14163.1| (Z99115) alternate gene name:
FT                   jojG; similar to hypothetical proteins [Bacillus subtilis],
FT                   score 72.8, E-value 4.00E-12"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23520"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD28"
FT                   /protein_id="AAM23520.1"
FT                   /translation="MKEVEFKMGKKLHIMAVGAHCGDMELVAGGVIAKYTRAGHEASIV
FT                   HLTPGEKGHPHLKPEEYAKQKIEEAKKAAEILGAESIFLPYRDAELPVNDEVKFKLAEV
FT                   IREKKPDVIITHWKNSMHPDHANTYLIVEGALLIAALPAFELKYPAHGVRGLFYGENWE
FT                   DPYGFEPDVYVDITSTYDVWVEAIKQYEFVRGGVSTFRYLDYYTHLAVVRGCLMGVKYA
FT                   QAFMMPEGANKRRGASLPGFNLE"
FT   misc_feature    226555..227217
FT                   /locus_tag="TTE0219"
FT                   /note="Pfam match to entry DUF158, Uncharacterized
FT                   LmbE-like protein, COG2120, score 38.9, E-value 8.20E-09"
FT   gene            227274..228241
FT                   /gene="RimI2"
FT                   /locus_tag="TTE0220"
FT   regulatory      227274..227278
FT                   /gene="RimI2"
FT                   /locus_tag="TTE0220"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227288..228241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RimI2"
FT                   /locus_tag="TTE0220"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23521"
FT                   /db_xref="GOA:Q8RD27"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD27"
FT                   /protein_id="AAM23521.1"
FT                   /translation="MRYIVRTYRGGDEKGIVEAWQQSLPFDPINQHLFRAKVLLDPNFD
FT                   PEGAIVAEDEKGQIIGFTLTLVRKLPMYKDDLEPENSWITVFFVHPAYRGQGIGSKMFE
FT                   KAKEFVQKKGRKYIFFSSYAPNYFLPGIDEKTYPEGYRFLLKQGFTKLYSPVAMDRSLL
FT                   DFTIPEEVKKLKEEREKEGFKFGYAEDRHLYELIEFANVVFNPDWGRAIREGILQGLHL
FT                   EQILVAEKDDKIVGFCLYGAYEGIRERFGPFGVDPSMQGLGLGKILLNYCLFEMRCKGL
FT                   HNVWFLWTGEESAAGHLYKKTGFKITRKFHVMRFSF"
FT   misc_feature    227438..227737
FT                   /gene="RimI2"
FT                   /locus_tag="TTE0220"
FT                   /note="Pfam match to entry Acetyltransf, Acetyltransferase
FT                   (GNAT) family, score 37.2, E-value 3.80E-07"
FT   misc_feature    227963..228202
FT                   /gene="RimI2"
FT                   /locus_tag="TTE0220"
FT                   /note="Pfam match to entry Acetyltransf, Acetyltransferase
FT                   (GNAT) family, score 57.1, E-value 3.80E-13"
FT   gene            228267..230079
FT                   /locus_tag="TTE0221"
FT                   /note="authentic frameshift, electron transfer
FT                   flavoprotein; Best Blastx hit = gb|AAK42928.1| (AE006876)
FT                   Electron transfer flavoprotein alpha and beta-subunit
FT                   (etfAB/fixAB) [Sulfolobus solfataricus], score 323, E-value
FT                   1.00E-115"
FT   gene            230066..231489
FT                   /gene="GlcD"
FT                   /locus_tag="TTE0224"
FT   regulatory      230066..230070
FT                   /gene="GlcD"
FT                   /locus_tag="TTE0224"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        230080..231489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlcD"
FT                   /locus_tag="TTE0224"
FT                   /product="FAD/FMN-containing dehydrogenases"
FT                   /note="Best Blastp hit = gi|10175351|dbj|BAB06449.1|
FT                   (AP001516) glycolate oxidase subunit [Bacillus halodurans],
FT                   score 337, E-value 3.00E-91"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23522"
FT                   /db_xref="GOA:Q8RD26"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD26"
FT                   /protein_id="AAM23522.1"
FT                   /translation="MYNKLTNEIVEELKKIVGTNNVIYDDPDALEAYSHDEVAEKHYAH
FT                   MPEAVVKPSSAEEIARIMKLANKYKIPITPRGAGSGLSGGAVPVYGGIVLSVERMNRIL
FT                   EIDKENLVVVVEPGVVTNEINNAVKEYGLFYAGYPMSVETCYIGGNVAENAGGGRAVKY
FT                   GVTGRYVIGLEVVTPTGDIVHLGGKVMKDVTGYDLIHLMVGSEGTLGIFTKIYLKLMPL
FT                   PQAKVDLLVLFHDMDTAIKVVPKIMTFGRIIPTSIEFMDDLSFKAACKYLNEKIPFEEA
FT                   GAMLLIELDGNNKTELEEQYEIIGNLCMENGAIEVYVADNATTSERIWRIRRNIAEAWK
FT                   QFSPHQSLEDVVVPISEIPTFLKKIREISNKYRVPIPCYGHAGDGNIHATPIKPPELSM
FT                   EEWHEKLEKLLEEMYVVVKELGGVISGEHGIGHKRKKYLPLVLEPAHIEMMRAIKKALD
FT                   PDLILNPGKII"
FT   misc_feature    230110..230703
FT                   /gene="GlcD"
FT                   /locus_tag="TTE0224"
FT                   /note="Pfam match to entry FAD_binding_4, FAD binding
FT                   domain, score 267.7, E-value 1.60E-76"
FT   misc_feature    230707..231483
FT                   /gene="GlcD"
FT                   /locus_tag="TTE0224"
FT                   /note="Pfam match to entry FAD-oxidase_C, FAD linked
FT                   oxidases, C-terminal domain, score 212, E-value 9.20E-60"
FT   gene            231651..232682
FT                   /gene="DppB2"
FT                   /locus_tag="TTE0225"
FT   regulatory      231651..231655
FT                   /gene="DppB2"
FT                   /locus_tag="TTE0225"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231663..232682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppB2"
FT                   /locus_tag="TTE0225"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|7449133|pir||H72428
FT                   'oligopeptide ABC transporter, permease protein -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4980514|gb|AAD35124.1|AE001690_18 '(AE001690)
FT                   oligopeptide ABC transporter, permease protein [Thermotoga
FT                   maritima]', score 194, E-value 1.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23523"
FT                   /db_xref="GOA:Q8RD25"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD25"
FT                   /protein_id="AAM23523.1"
FT                   /translation="MMKKILTNYFFIRFLRALVTIFVVATFTFFLIRLMPGNPLDIFIA
FT                   TQLSQGVPLQEAQERAASLFHIDLSKPLLVQYVDYLKNLARGDFGVSIISTNTPVSKII
FT                   LRFLPWTLFVVTVSLFISFVGGVLLGVLMAIYRNSWLDQILSFFASIISAIPNYVIAML
FT                   IVVYFGVKLKWFNIAEIRGSLSPGVRPEFSLYFLKDAFYHAMLPIIVYVLTTIGSWMLV
FT                   MKSSTISTLGEDYVEVAKARGIKQANIMINYVGRNAILPLFVSLAISIGFVVGGSPLIE
FT                   SIFVYQGIGLKLSDAIVTRDYPVMQAIFLIITASVVFANFLADILLGVLDPRIRTSRS"
FT   gene            232701..233585
FT                   /gene="DppC2"
FT                   /locus_tag="TTE0226"
FT   regulatory      232701..232705
FT                   /gene="DppC2"
FT                   /locus_tag="TTE0226"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        232719..233585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppC2"
FT                   /locus_tag="TTE0226"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|13815988|gb|AAK42788.1|
FT                   '(AE006862) ABC transporter, permease protein [Sulfolobus
FT                   solfataricus]', score 199, E-value 5.00E-50"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23524"
FT                   /db_xref="GOA:Q8RD24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD24"
FT                   /protein_id="AAM23524.1"
FT                   /translation="MKNILASLKESLKIMMRNKVGFVGFIGTLFFILLAFIGPYLMPLN
FT                   MKTDLNSIYTGPTLAHPLGTDYQGRDILMQVLHGGREVIYVALMAALLTVLIAATFGAL
FT                   AAVVGGIVDTLLNGLAEIIITIPHFPLLLVLASLIKFKSATGLAVILAAIGWGGLMRAI
FT                   RAQVLSLKERDYVEAARVLGLPTSHIIFKEILPNMLSYISVQFILSMTGAIYAQVGLIF
FT                   LGVVPMEQHNWGVMITLAWNQGALFNPKAQWYLLVPITIIVLLQLSLITMTRSMEELFN
FT                   PRLRRGG"
FT   misc_feature    233217..233444
FT                   /gene="DppC2"
FT                   /locus_tag="TTE0226"
FT                   /note="Pfam match to entry BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 42, E-value 1.40E-08"
FT   gene            233576..234621
FT                   /gene="DppD2"
FT                   /locus_tag="TTE0227"
FT   regulatory      233576..233580
FT                   /gene="DppD2"
FT                   /locus_tag="TTE0227"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        233587..234621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppD2"
FT                   /locus_tag="TTE0227"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|11355773|pir||E82301 'peptide
FT                   ABC transporter, ATP-binding protein VC0617 [imported] -
FT                   Vibrio cholerae (group O1 strain N16961)'
FT                   gi|9655050|gb|AAF93783.1| '(AE004147) peptide ABC
FT                   transporter, ATP-binding protein [Vibrio cholerae]', score
FT                   260, E-value 2.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23525"
FT                   /db_xref="GOA:Q8RD23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD23"
FT                   /protein_id="AAM23525.1"
FT                   /translation="MATKHIIVEDLSVEYLGPTKKIYALQHVSLEIYRGESIALVGESG
FT                   CGKSTLGVAFIRLLPVNSRITSGRIRFVDGSREINILELSQSELQKIRWSKIVMMAQGA
FT                   LNAFNPVMRIKDHFIDTAYSHGWKNKTEVLKKARYLLERVHLDSERVLNSFPHELSGGM
FT                   RQRVLLSLGLFLNPEVVILDEPTTALDILTQRNIIELLKELKKEFNFTLIFITHDLSLA
FT                   AELADRVAVMYAGKIVEVGDVYNIFGTPYHPYTAGLITSTPKLRGKSTEITSIPGSPPN
FT                   LSEIFKGCPFYERCPLRSSVCLNTPPTLTFVDGQEGHFVACHHASKDTLSKIRQSDWLS
FT                   TIQK"
FT   misc_feature    233689..234291
FT                   /gene="DppD2"
FT                   /locus_tag="TTE0227"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   174, E-value 2.40E-48"
FT   gene            234622..235633
FT                   /gene="OppF2"
FT                   /locus_tag="TTE0228"
FT   regulatory      234622..234626
FT                   /gene="OppF2"
FT                   /locus_tag="TTE0228"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234635..235633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppF2"
FT                   /locus_tag="TTE0228"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|7442540|pir||F71211 probable
FT                   oligopeptide transport ATP-binding protein appF -
FT                   Pyrococcus horikoshii gi|3258402|dbj|BAA31085.1| (AP000007)
FT                   335aa long hypothetical oligopeptide transport ATP-binding
FT                   protein appF [Pyrococcus horikoshii], score 286, E-value
FT                   4.00E-76"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23526"
FT                   /db_xref="GOA:Q8RD22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD22"
FT                   /protein_id="AAM23526.1"
FT                   /translation="MEELVIELNNIKKFYRKRNRVVKVINDISLKFKDDEILCLVGESG
FT                   SGKTTLGKIIAGLIEPTEGEIRYNGKLLSQLKGKETKEIRRAIQMIHQDPFASLNPVRS
FT                   VYQTLSTPLIYYKLAKDENDAKKRVLELLEVVDLTPPEDFIYKYPHQLSGGQRQRVAIA
FT                   RALTVNPKFIVADEPVSMVDASIKASIINTLKRIRREFKVGFLFITHDLALARLFGGDG
FT                   KLGVMYTGRIVEYGLTDDIIENPKHPYTITLLSAVPEPDPVVTRSKKRIKLRSDDIPRL
FT                   DNLPEGCHFHPRCPVFVEGKCDKELPKLEADGLNHYVACFTKDAREKMLGE"
FT   misc_feature    234737..235324
FT                   /gene="OppF2"
FT                   /locus_tag="TTE0228"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   183.3, E-value 3.90E-51"
FT   gene            235624..235837
FT                   /locus_tag="TTE0229"
FT   regulatory      235624..235628
FT                   /locus_tag="TTE0229"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235637..235837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23527"
FT                   /db_xref="GOA:Q8RD21"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD21"
FT                   /protein_id="AAM23527.1"
FT                   /translation="MIGEFMKRWFQISIWIVLVAAILIIFEEKDTPEYYITLFSLIIGL
FT                   VFFIIALILYVIYKRKDEKSD"
FT   gene            235917..236085
FT                   /locus_tag="TTE0230"
FT   regulatory      235917..235921
FT                   /locus_tag="TTE0230"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235927..236085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD20"
FT                   /protein_id="AAM23528.1"
FT                   /translation="MYEKILGHIDCFDYGSLSYVCGLFWKTNSACAEYSIKRRNKEGSC
FT                   ITWRMGI"
FT   gene            236122..237787
FT                   /gene="OppA3"
FT                   /locus_tag="TTE0231"
FT   regulatory      236122..236126
FT                   /gene="OppA3"
FT                   /locus_tag="TTE0231"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        236135..237787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppA3"
FT                   /locus_tag="TTE0231"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, periplasmic components"
FT                   /note="Best Blastp hit = gi|13815984|gb|AAK42787.1|
FT                   '(AE006861) ABC transporter, periplasmic component
FT                   [Sulfolobus solfataricus]', score 93.6, E-value 6.00E-18"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23529"
FT                   /db_xref="GOA:Q8RD19"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD19"
FT                   /protein_id="AAM23529.1"
FT                   /translation="MPGSPYTALMTSPLAFYYWSDGSWDKYLATDWTLDKDNSTLTVKL
FT                   RQGVKWSDGTTFNVDDLITYLWIARAKGYMVWRYIDSFERIDDYTIKFKLNSISPVVEY
FT                   YILRIMPQPRSVYGDWAKKFEDLYTTYKDTVKKLNELKGEELNKFKETAEYKEFNDKLK
FT                   ALLDEFDTFRPTDYVASGPFKMDTQNITEAQLTLVKRPDSWVADKVKIDKIVIYNGETA
FT                   QATPLVLDKKLDFVTHAFPPATEQQFIQMGLRIIRFPYYTGPAIFFNNNIYPFNRVEFR
FT                   QALAYAINRQEAGTVALAKSGVAVKYMSGMSDNLLDIWLDKDTINKLNQYEYNPAKAEE
FT                   ILKSIGFQKKDGQWYDDKGKKLEFELMVPSDFLDWSAAADNVAQQLNNFGIKTSIRGVV
FT                   WSQYTTEMNKGNFQMGFLPWGSSTPHPQFAYMAALLNYNGGAKGNKEMPGQNFPLVQEY
FT                   KGEKIDFDELITEVGKGDMEYQKQIAKKLALAFNELLPIIPLFERYSNAPVLDGVNVTG
FT                   WPPEGDPIYKNGSADSFLVPLIMNGTLRGVDNK"
FT   misc_feature    236216..237394
FT                   /gene="OppA3"
FT                   /locus_tag="TTE0231"
FT                   /note="Pfam match to entry SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score 36,
FT                   E-value 3.00E-09"
FT   regulatory      237798..237834
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            237887..239059
FT                   /gene="NagA"
FT                   /locus_tag="TTE0232"
FT   CDS_pept        237887..239059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NagA"
FT                   /locus_tag="TTE0232"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="Best Blastp hit = gi|10173034|dbj|BAB04140.1|
FT                   (AP001508) N-acetylglucosamine-6-phosphate deacetylase
FT                   [Bacillus halodurans], score 316, E-value 3.00E-85"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23530"
FT                   /db_xref="GOA:Q8RD18"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD18"
FT                   /protein_id="AAM23530.1"
FT                   /translation="MGRILKVKKLILKNAEIYKEEEILYNGDLLIEEGKISKLGRNISE
FT                   INAEVIDLKGKKIVPGFIDIHIHGGVGYDTMDATYEALNNISVHLAKHGVTSFCPTTMT
FT                   MDIPDILRALENVKETMKKGVEGAEVLGAYVEGPFISKEHKGAQDEKYVLDPDKELFDQ
FT                   FYEVAGGNIKVIILAPEKDPSGDFIKHVIKKGVKVSLGHTSASYEEMKRGVDYGATIAV
FT                   HTYNGMKGFHHREPGALGEVFLDDRIYGELICDFIHSHPAAVKLLVKIKGVDKIILISD
FT                   AMAACGLGDGEYSLGGQKVYVKNGEARLKNGTLAGSTLTLDKALQNMTNLGISLFDAVK
FT                   MVSTNASKAIGIYDKKGSIAVGKDADIVVLDSDLSVYMTIVGGKIVYSKE"
FT   misc_feature    238550..239050
FT                   /gene="NagA"
FT                   /locus_tag="TTE0232"
FT                   /note="Pfam match to entry NagA,
FT                   N-acetylglucosamine-6-phosphate deacetylase, score 238.2,
FT                   E-value 1.10E-67"
FT   gene            238987..239249
FT                   /locus_tag="TTE0233"
FT   regulatory      238987..238991
FT                   /locus_tag="TTE0233"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239031..239249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD17"
FT                   /protein_id="AAM23531.1"
FT                   /translation="MGKLYIQKNEGENYYLKKGTPYEVEMSKEILGKIDKIVLKAIERW
FT                   YYSWGSCFGCQGWSYSQRKSIWMAAKI"
FT   gene            239280..239972
FT                   /gene="AmpC2"
FT                   /locus_tag="TTE0234"
FT   CDS_pept        239280..239972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AmpC2"
FT                   /locus_tag="TTE0234"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /note="Best Blastp hit = gi|3915467|sp|P77619|YFEW_ECOLI
FT                   HYPOTHETICAL 47.8 KDA PROTEIN IN UCPA-AMIA INTERGENIC
FT                   REGION PRECURSOR, score 147, E-value 1.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23532"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD16"
FT                   /protein_id="AAM23532.1"
FT                   /translation="MKVDTIFDLASVTKVMGTTQAIMKLVYENRLKVADKVVEFIPEFG
FT                   QNGKEDITISDLLTHTSGLPAWKPIYYHASNSKDSLKYICALHLEYKPGTNRKYSDIGF
FT                   MVLGYVIEIITGKRLDVYLREEIYLPLGMKNTLFNPFKYLENPRDKVAATSWGNPYEYK
FT                   MIKEKNVYQVEENINEWNKWRNYTLIGEANDGNCFYANEGIAGHAGLFSTVSDLAVLGQ
FT                   LMLNGAFL"
FT   repeat_region   complement(239958..240070)
FT                   /note="TLR006, identity:100%, copy 2"
FT   repeat_region   complement(240069..241886)
FT                   /note="TLR004, identity:99%, copy 2"
FT   gene            240074..241371
FT                   /locus_tag="TTE0235"
FT   regulatory      240074..240078
FT                   /locus_tag="TTE0235"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240088..241371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0235"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 411, E-value 1.00E-113"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23533"
FT                   /db_xref="GOA:Q8RD15"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD15"
FT                   /protein_id="AAM23533.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMDIKERLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVADFIAEVGDIEKYEHPKQIQKLRGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    240871..241200
FT                   /locus_tag="TTE0235"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 77.6, E-value 2.60E-19"
FT   gene            241881..242253
FT                   /locus_tag="TTE0236"
FT   regulatory      241881..241885
FT                   /locus_tag="TTE0236"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        241894..242253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0236"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp hit = gi|7474457|pir||A69744
FT                   beta-lactamase homolog ybbE - Bacillus subtilis
FT                   gi|2632434|emb|CAB11943.1| (Z99104) similar to
FT                   beta-lactamase [Bacillus subtilis], score 51.2, E-value
FT                   5.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23534"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD14"
FT                   /protein_id="AAM23534.1"
FT                   /translation="MGIKLYSKEVIEEFTSPKSAPSSWNAYKYGYGWEIARKDYMGDFT
FT                   SSRTYGHSGFTGTQVIFDPEYNLQIIVLTNRQNNGLNEKGEYFSTFNLSREISNVVYES
FT                   LKRLTVICQYLKIGK"
FT   repeat_region   242210..243920
FT                   /note="TLR048, identity:100%, copy 1"
FT   gene            complement(242351..243584)
FT                   /locus_tag="TTE0237"
FT                   /note="authentic frameshift, transposase; Best Blastx hit =
FT                   dbj|BAB04153.1| (AP001508) transposase (03) [Bacillus
FT                   halodurans] dbj|BAB04712.1| (AP001510) transposase (03)
FT                   [Bacillus halodurans] dbj|BAB04926.1| (AP001511)
FT                   transposase (03) [Bacillus halodurans] dbj|BAB05020.1|
FT                   (AP001511) transposase (03) [Bacillus halodurans]
FT                   dbj|BAB05267.1| (AP001512) transposase (03) [Bacillus
FT                   halodurans] dbj|BAB07180.1| (AP001518) transposase (03)
FT                   [Bacillus halodurans] dbj|BAB07423.1| (AP001519)
FT                   transposase (03) [Bacillus halodurans], score 70.9, E-value
FT                   2.00E-16"
FT   repeat_region   243905..245647
FT                   /note="TLR028, identity:100%, copy 2"
FT   gene            244004..245302
FT                   /locus_tag="TTE0239"
FT   regulatory      244004..244008
FT                   /locus_tag="TTE0239"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        244019..245302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0239"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 338, E-value 6.00E-92"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23535"
FT                   /db_xref="GOA:Q8R6J5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J5"
FT                   /protein_id="AAM23535.1"
FT                   /translation="MNKVQKLLLVHSSDIIFVGVDVAKKTHYARIINHIGLEVIKPFKF
FT                   NNSIDGYERLVSKILEAKEKSKATKILIGFEPSGHYWKPLAWFLKEKGYTVVIVNPYHV
FT                   KQRKEEEDNSPSKNDRKDALIIARLIKEGKFLNCLLPQNTYADLRNLSVARKQLIKKLN
FT                   SVKNKIIAILDEYFPEFEEVFKNLWGKAALWILRNCPFPSIILKLSKEEIAEQLKKATN
FT                   NRVGMKRAEKLIEAAKKSIGVKEGIKGAQIRLNIYLDELEFLKTQLETIEKAMEELLKK
FT                   IDIAEYLLSIPGIGVITVAGFLAEVGDIGKYTHYKQIQKLGGLNITDNQSGKHRGKTKI
FT                   SKRGRPELRNLLYKASLTLVAKNKEFKALYNYFLRRRENPLEKKQALIAISIKLIRVMF
FT                   TLAKKKEKYDSQKVLGEYRMKQIKELVA"
FT   misc_feature    244283..244576
FT                   /locus_tag="TTE0239"
FT                   /note="Pfam match to entry Transposase_9, Transposase,
FT                   score 52.6, E-value 8.50E-12"
FT   misc_feature    244799..245128
FT                   /locus_tag="TTE0239"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 87.4, E-value 3.00E-22"
FT   gene            245645..246719
FT                   /locus_tag="TTE0240"
FT   regulatory      245645..245649
FT                   /locus_tag="TTE0240"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245658..246719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7450524|pir||H70030 conserved
FT                   hypothetical protein yvbX - Bacillus subtilis
FT                   gi|2635915|emb|CAB15407.1| (Z99121) similar to hypothetical
FT                   proteins [Bacillus subtilis], score 117, E-value 2.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23536"
FT                   /db_xref="GOA:Q8RD13"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD13"
FT                   /protein_id="AAM23536.1"
FT                   /translation="MFKLGWVVPEVKESINSFVKYGQKLTHVSPTWLRFDSNADLHLTV
FT                   TEEEIHRFLEIAKEKKVKVVPLVVNERFDEGVAGSILGNKKMQEKAAEQLVKFAEKYQV
FT                   DGVNLDFEGVFGLWRYEYTEFVGKVSEELHRLGKEVSVDVVCQTAPPKSIDDLKENMSG
FT                   NFEEIKKMLSWADSYDYEGLGKLVDQFILMGYDYHAMGSEPGPVGPLWWIRDVLDYTLK
FT                   IVDKNKVVLGLPFYGRGWTSIDKMRVEDWEPRNPMSREPMKTAFEAGFELGKAYDYREI
FT                   KEKSRYFIKSGINPEENSPWGVWELEDGKMTIVYYDDLESLKKKISLVREYELLGIAFW
FT                   RLGHEDERIWDVL"
FT   gene            246704..248479
FT                   /gene="BglX2"
FT                   /locus_tag="TTE0241"
FT   CDS_pept        246704..248479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BglX2"
FT                   /locus_tag="TTE0241"
FT                   /product="Beta-glucosidase-related glycosidases"
FT                   /note="Best Blastp hit = gi|10173289|dbj|BAB04394.1|
FT                   (AP001509) beta-hexosamidase A precursor [Bacillus
FT                   halodurans], score 481, E-value 1.00E-134"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23537"
FT                   /db_xref="GOA:Q8RD12"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD12"
FT                   /protein_id="AAM23537.1"
FT                   /translation="MGCSVSRRNSMRKVIIVFLVLITLLFLFLYLHPADKRNHSEKDPI
FT                   DELIKNMTVEEKIGQMLMPAIDGTKATPQLEKMIKDYHLGGVILFSENIQSIEQIVKLT
FT                   NDIQSLSLQIPLFISTDQEGGLVYRLSQGTKFPGNMALGATFSEDLAYKVGKVIGSELK
FT                   AVGINWDLAPVMDVNVNPYNPVIGIRSFGGNPDVVAKLGVAFMKGLQENKIASCVKHFP
FT                   GHGDVDVDSHLGLGTVNKNRETLEKIELKPFEEAIQAGTDALMTAHLSFPALDDTKVIA
FT                   KTSEGVQKEITIPATLSHKILTDLVRKTWGYEGVIITDAMNMKAISDNFGPVDAVVRAV
FT                   KAGADIILMPVDLNGAFNELVLETKKGIISEKRIDDSVRRILKLKYKLGLMETKDIDLE
FT                   NMIQQARAIVGNEKNLLVEKEVAERSITLLRNSGNLLPLGKETLNKKILIIGGTKDLVN
FT                   GFVNELKKYHPGNNAFLVINNGTLRGSGSLTSDLKKAIDGSDIVILMTNNIMSPNSLAE
FT                   KIVNYGGDKVIGIAVRNPYDIMYYPQVKVYLVQYGWNPCSIKAMVDVLFGAVNPTGKLP
FT                   VEIPGLYPIGYGLSY"
FT   misc_feature    246824..247795
FT                   /gene="BglX2"
FT                   /locus_tag="TTE0241"
FT                   /note="Pfam match to entry Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3 N terminal domain, score 321.5, E-value
FT                   9.70E-93"
FT   gene            248553..248810
FT                   /gene="FeoA"
FT                   /locus_tag="TTE0242"
FT   regulatory      248553..248557
FT                   /gene="FeoA"
FT                   /locus_tag="TTE0242"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248565..248810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FeoA"
FT                   /locus_tag="TTE0242"
FT                   /product="Protein, probably involved in Fe2+ transport"
FT                   /note="Best Blastp hit = gi|7450533|pir||D69126 iron
FT                   repressor - Methanobacterium thermoautotrophicum (strain
FT                   Delta H) gi|2621260|gb|AAB84720.1| (AE000808) iron
FT                   repressor [Methanothermobacter thermautotrophicus], score
FT                   49.7, E-value 7.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23538"
FT                   /db_xref="GOA:Q8RD11"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD11"
FT                   /protein_id="AAM23538.1"
FT                   /translation="MMVENEVINLLELRENEEGEIVFIDAGRMAAQRLSDMGLVPGTRV
FT                   RLIRRGPLRGPVELEVRNSHLVIGYGLASKIYVKIA"
FT   gene            248818..250803
FT                   /gene="FeoB"
FT                   /locus_tag="TTE0243"
FT   regulatory      248818..248822
FT                   /gene="FeoB"
FT                   /locus_tag="TTE0243"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248833..250803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FeoB"
FT                   /locus_tag="TTE0243"
FT                   /product="Ferrous ion uptake system protein FeoB (predicted
FT                   GTPase)"
FT                   /note="Best Blastp hit = gi|7429946|pir||C69126 ferrous
FT                   iron transport protein B - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)
FT                   gi|2621259|gb|AAB84719.1| (AE000808) ferrous iron transport
FT                   protein B [Methanothermobacter thermautotrophicus], score
FT                   524, E-value 1.00E-147"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23539"
FT                   /db_xref="GOA:Q8RD10"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD10"
FT                   /protein_id="AAM23539.1"
FT                   /translation="MKKEIVVALAGNANVGKSVIFNQLTGMTQIIGNWPGKTVERAEGT
FT                   LRYKGRIIKIIDLPGIYSLSAYSQEEIVSREFIAFEKPDVVINVVDASNLERNLFLTLQ
FT                   LLELHVPMVMALNQIDYAIKKGIDINVEKLEKLLGIPVVETVATKGKGLQELIDKVLEV
FT                   VDSYKGEDVFAYDIESEKVLKYRPEIKEYVMKIYKILMRYNVPLVKSFHPLWISLKVME
FT                   EDEDVIEKLKSTSSGEQAYKEIEKVLGDLKAKFESPIGTLVTADRYDIASYIASETVSE
FT                   IHHRITWTDLIDNVVLHKIWGYVSMAIIVFLSFYGIFKFGEYFSGILEDFFDQFKPLVY
FT                   NLHISEMYKDFIWNGLAEGVISAVTIVLPYIFPFYVFLSILENTGYLARIAFLMDEVMH
FT                   KVGLHGKALIPVLMGFGCNVPAVLGTKILETDREIFIASFMSTLVPCSARIVIILGTIG
FT                   VFMGPQYALAVFVLDVLVVYVAAYFANKIAPGKPYDLIMELPGYRMPALKPTLKQIWLR
FT                   IKDFLYVALPIIVAGSLVLEILKYSGIFKYVSYVMDPIVVKWLGLPSIVGIVLIFGILR
FT                   KELTLIMLLTLAGTTQVSQILTPKQMIVFGIVTMLYFPCIATIAALKKTIGWKKTWWVV
FT                   FANIIIAILVGGIVNQILNFI"
FT   misc_feature    248857..250791
FT                   /gene="FeoB"
FT                   /locus_tag="TTE0243"
FT                   /note="Pfam match to entry FeoB, Ferrous iron transport
FT                   protein B, score 650.1, E-value 1.20E-191"
FT   gene            250822..251179
FT                   /locus_tag="TTE0244"
FT   regulatory      250822..250826
FT                   /locus_tag="TTE0244"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        250835..251179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0244"
FT                   /product="predicted nucleotidyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23540"
FT                   /db_xref="GOA:Q8RD09"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD09"
FT                   /protein_id="AAM23540.1"
FT                   /translation="MPYIMPQKEREKLLLEELNRAINSIIHLNPEKIVLFGSLVRGDIN
FT                   SKSDIDLLIIWETELPFLKRLEVFYNAIQPNVAMDILVYTLEEIEKLYGKNKFITKALD
FT                   EGRVLYEKRK"
FT   gene            complement(251127..251606)
FT                   /locus_tag="TTE0245"
FT   CDS_pept        complement(251127..251594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23541"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD08"
FT                   /protein_id="AAM23541.1"
FT                   /translation="MLMLRSCKATKLRLTFRAPAGSRPIRPSGSGGRSLRSPRLRPSSS
FT                   PSLVTALTTSRIYTQNATFKLCQQSESRLLRLLILFSLLQNLSPYELFQLQTKHPLLQK
FT                   LQKVYHQAIHFPFFCKNSIIQVPFSLYKPSLGFTFTFSSHIIHALHLKPLL"
FT   repeat_region   251383..251635
FT                   /note="TLR027, identity:100%, copy 6"
FT   regulatory      complement(251602..251606)
FT                   /locus_tag="TTE0245"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(251668..252411)
FT                   /gene="CbiO"
FT                   /locus_tag="TTE0246"
FT   CDS_pept        complement(251668..252396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiO"
FT                   /locus_tag="TTE0246"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|11499426|ref|NP_070667.1|
FT                   cobalt transport ATP-binding protein (cbiO-2)
FT                   [Archaeoglobus fulgidus] gi|7445783|pir||H69479 cobalt
FT                   transport ATP-binding protein (cbiO-2) homolog -
FT                   Archaeoglobus fulgidus gi|2648707|gb|AAB89412.1| (AE000976)
FT                   cobalt transport ATP-binding protein (cbiO-2)
FT                   [Archaeoglobus fulgidus], score 179, E-value 2.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23542"
FT                   /db_xref="GOA:Q8RD07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RD07"
FT                   /protein_id="AAM23542.1"
FT                   /translation="MDKVFELKNVSYFYTPKVPALIDISFDVKLKEKLFILGANGSGKS
FT                   TLLKLMDGLIYPHEGQIRFFGKVIGDKRTFDEYEFRRRVGFVFQDSDVQLFNTTVFDEI
FT                   AFAPLQMGVKKEEVEKLVNEILISFGIEKLKDRPPHRLSGGEKKKVALASIIVINPDVL
FT                   LLDEPTNGLDPRSKKWLLSKLEELNQKGATLVIATHDLEMAKKFSDRIIILNEEHKIET
FT                   IGSPEEILNDEKLLLKANLI"
FT   misc_feature    complement(251746..252306)
FT                   /gene="CbiO"
FT                   /locus_tag="TTE0246"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   204.5, E-value 1.60E-57"
FT   regulatory      complement(252407..252411)
FT                   /gene="CbiO"
FT                   /locus_tag="TTE0246"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(252423..253247)
FT                   /gene="CbiQ"
FT                   /locus_tag="TTE0247"
FT   CDS_pept        complement(252423..253238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiQ"
FT                   /locus_tag="TTE0247"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /note="Best Blastp hit = gi|2128946|pir||B64496
FT                   hypothetical protein MJ1571 - Methanococcus jannaschii
FT                   gi|1592192|gb|AAB99588.1| (U67597) cobalt transport protein
FT                   (cbiQ) [Methanococcus jannaschii], score 145, E-value
FT                   8.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23543"
FT                   /db_xref="GOA:Q8RD06"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD06"
FT                   /protein_id="AAM23543.1"
FT                   /translation="MDRFLEKTIQGIYGIFEDLFYSDEIAAKKGLMQSLDPRVKLLSIL
FT                   LLIVIANFGKSILFLSVFAIYTVVLAFLSKIPLKAYIKRVAVISIIFTGIILLPSTFNF
FT                   FEKGSPLIYFGKNLYITKEGALASLTLMMRSFVSLSFVYILSLSTKWTDILKAFRSFHL
FT                   PQVFTTTLEMAFRYIFLFLEVSLNTFLARKSRNVGKIKGKDGRKFVASVIGSILIRSNE
FT                   LTEEVYKAMVSRGYRGEYKTFSSFKMTPWDYIWISSNLIFIIALFNAKL"
FT   misc_feature    complement(252519..253157)
FT                   /gene="CbiQ"
FT                   /locus_tag="TTE0247"
FT                   /note="Pfam match to entry CbiQ, Cobalt transport protein,
FT                   score 95.4, E-value 1.10E-24"
FT   gene            complement(253231..253562)
FT                   /locus_tag="TTE0248"
FT   CDS_pept        complement(253231..253548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|2128945|pir||A64496
FT                   hypothetical protein MJ1570 - Methanococcus jannaschii
FT                   gi|1500464|gb|AAB99594.1| (U67597) M. jannaschii predicted
FT                   coding region MJ1570 [Methanococcus jannaschii], score
FT                   50.4, E-value 7.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23544"
FT                   /db_xref="GOA:Q8RD05"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD05"
FT                   /protein_id="AAM23544.1"
FT                   /translation="MKKLYIIALIIILLTPLGLLASGSAWGEWSLDEVKEMIGYVPEGM
FT                   SKFAELVKGILPDYSIPGFDANFFQQAIGYVFSAVIGIAAILITFAILGRVMGRVKKKN
FT                   G"
FT   regulatory      complement(253243..253247)
FT                   /gene="CbiQ"
FT                   /locus_tag="TTE0247"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(253545..254249)
FT                   /gene="CbiM"
FT                   /locus_tag="TTE0249"
FT   CDS_pept        complement(253545..254237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiM"
FT                   /locus_tag="TTE0249"
FT                   /product="Cobalamin biosynthesis protein CbiM"
FT                   /note="Best Blastp hit = gi|2127816|pir||H64495 cobalamin
FT                   biosynthesis protein M - Methanococcus jannaschii
FT                   gi|1592191|gb|AAB99587.1| (U67597) cobalamin biosynthesis
FT                   protein (cbiM) [Methanococcus jannaschii], score 192,
FT                   E-value 4.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23545"
FT                   /db_xref="GOA:Q8RD04"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD04"
FT                   /protein_id="AAM23545.1"
FT                   /translation="MHIPDGYLSPQTCAVMGAAMVPVLYKSVKEVNKELDKKDIPTMAI
FT                   GSAFSFTVMMFNVPIPGGTTAHAIGSTLLAIVLGPWAAVISVTVALIIQALLFGDGGVL
FT                   ALGANTFNMAFLAPFVGYGVYKLMMRLKLKKVLSSAIGAYAGINAAAFATAVELGIQPM
FT                   LFHTATGKALYFPYGLNISIPAMMFAHLTVAGFVEAIVTALVIYYLEKVGEDNILYQYS
FT                   YRLRGEKR"
FT   regulatory      complement(253558..253562)
FT                   /locus_tag="TTE0248"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(253593..254171)
FT                   /gene="CbiM"
FT                   /locus_tag="TTE0249"
FT                   /note="Pfam match to entry CbiM, CbiM, score 171, E-value
FT                   2.00E-47"
FT   regulatory      complement(254245..254249)
FT                   /gene="CbiM"
FT                   /locus_tag="TTE0249"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(254251..254715)
FT                   /gene="NikR"
FT                   /locus_tag="TTE0250"
FT   CDS_pept        complement(254251..254715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NikR"
FT                   /locus_tag="TTE0250"
FT                   /product="predicted Transcriptional regulator containing
FT                   the CopG/Arc/MetJ DNA-binding domain and a metal-binding
FT                   domain"
FT                   /note="Best Blastp hit = gi|7447627|pir||E71175
FT                   hypothetical protein PH0601 - Pyrococcus horikoshii
FT                   gi|3257007|dbj|BAA29690.1| (AP000002) 138aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 168,
FT                   E-value 4.00E-41"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23546"
FT                   /db_xref="GOA:Q8R5U7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5U7"
FT                   /protein_id="AAM23546.1"
FT                   /translation="MLLFSKKIAQHKGGICLEGIVRFGVSMESKLLKQFDELIKKKNYN
FT                   NRSEAIRDLIRDFIVENQWEAEDVETIGTITYVFNHEVREINDKLTDMQHKHYKNIIST
FT                   MHVHLDEHNCIEVMIVRGKAKEIVKIADEIISTRGVKHGKLVMTTTGENL"
FT   gene            254774..255412
FT                   /locus_tag="TTE0251"
FT   regulatory      254774..254778
FT                   /locus_tag="TTE0251"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        254786..255412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23547"
FT                   /db_xref="GOA:Q8RD03"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD03"
FT                   /protein_id="AAM23547.1"
FT                   /translation="MKLKVDGRPSTKNNERVVRMSKKLISYMVAGAMALGLIGGATYQG
FT                   IAKAQTSPSTPPAVTATKAATSNDQQNVEEQQPVYQGTIKVANPQDNGKGSEAVKDNEA
FT                   QESAQLSFLAKITPDEAKTAALKVVPGTVEKVSLDNENGYLVYSVEIKTNSGVVDVKVD
FT                   AGNGAVLAQDKGQDNEKHEKEKAGEVEKANTSDNDTVQLEQQGEN"
FT   regulatory      255416..255433
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      255576..255614
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            255638..256761
FT                   /gene="OadB"
FT                   /locus_tag="TTE0252"
FT   regulatory      255638..255642
FT                   /gene="OadB"
FT                   /locus_tag="TTE0252"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255652..256761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OadB"
FT                   /locus_tag="TTE0252"
FT                   /product="Na+-transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase, beta subunit"
FT                   /note="Best Blastp hit = gi|13622317|gb|AAK34050.1|
FT                   '(AE006559) putative decarboxylase, beta subunit
FT                   [Streptococcus pyogenes]', score 363, E-value 2.00E-99"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23548"
FT                   /db_xref="GOA:Q8RD02"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD02"
FT                   /protein_id="AAM23548.1"
FT                   /translation="MKAFIEGISNLTLSHVVMFIIGGILIYLAIKKEYEPMLLLPIGFG
FT                   IILANIPFSSAIGENGFLTILYNAGIKTELFPILIFIAVGAMIDFSPLLQQPFMIFFGA
FT                   AAQLGIFLTIIFAYILGFDLKEAASIGIIGAADGPTSIYVANLFAPKLLGPISVAAYSY
FT                   MALVPIIQPPVIRILTTKEERKIRMDLRMNKVSKTAKILFPIAVTFVAGVLVPSSVPLV
FT                   GSLMFGNLIRESGVVERLSKAAQNELANLVTLLLGITIGSTMTADKFLTPTTLLIFGMG
FT                   LIAFIFDTAGGVLFAKFLNLFLKNKVNPMVGAAGISAFPMSSRVVQKMAQEEDPTNFIL
FT                   MQAAGANVAGQIGSIIAGGIVIALVSSIV"
FT   gene            257030..257513
FT                   /gene="CspR"
FT                   /locus_tag="TTE0253"
FT   regulatory      257030..257034
FT                   /gene="CspR"
FT                   /locus_tag="TTE0253"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257043..257513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CspR"
FT                   /locus_tag="TTE0253"
FT                   /product="predicted rRNA methylase (SpoU class)"
FT                   /note="Best Blastp hit = gi|7474350|pir||S71440
FT                   hypothetical protein 3 - Bacillus circulans (fragment)
FT                   gi|563845|emb|CAA86559.1| (Z46432) orf [Bacillus circulans
FT                   subsp. alkalophilus], score 163, E-value 1.00E-39"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23549"
FT                   /db_xref="GOA:Q8RD01"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RD01"
FT                   /protein_id="AAM23549.1"
FT                   /translation="MPLNVVLVEPEIPQNTGNIARTCVLTGSRLHLVKPLGFSIDEKDV
FT                   RRAGLDYWPLLDLTVYENLQEFLEKHKGKKFYLATTRANKYYHEVKYEDEAFLIFGKET
FT                   TGLPQWLIDEYYEDCIRIPMHEKILWRSLNLSNSVAIIVYEALKQLGFPNMR"
FT   misc_feature    257046..257474
FT                   /gene="CspR"
FT                   /locus_tag="TTE0253"
FT                   /note="Pfam match to entry SpoU_methylase, SpoU rRNA
FT                   Methylase family, score 154.1, E-value 2.50E-42"
FT   gene            257515..258682
FT                   /gene="DinP"
FT                   /locus_tag="TTE0254"
FT   regulatory      257515..257519
FT                   /gene="DinP"
FT                   /locus_tag="TTE0254"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257528..258682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DinP"
FT                   /locus_tag="TTE0254"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /note="Best Blastp hit = gi|13701688|dbj|BAB42981.1|
FT                   '(AP003135) ORFID:SA1711.; hypothetical protein, similar to
FT                   DNA-damage inducible protein P [Staphylococcus aureus]'
FT                   gi|13876209|dbj|BAB46815.1| (AP003363) hypothetical protein
FT                   [Staphylococcus aureus], score 279, E-value 5.00E-74"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23550"
FT                   /db_xref="GOA:P58965"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58965"
FT                   /protein_id="AAM23550.1"
FT                   /translation="MKRKIIHVDMDAFFASIEQQDNPEYRGKPVIVGGLSGRGVVSTCS
FT                   YEARKYGIHSAMPMYMAKKLCPQGIFLPVRRKRYEEVSEQIFRILYDITPFVEPVSIDE
FT                   AYLDVTHVDKNPEDIALEIKKRVKDATGLTVSVGISYNKFLAKLASDWNKPDGLMVITE
FT                   DMVPEILKPLPVTKVHGIGEKSAEKLRSIGIETVEDLLKLPQENLIELFGKTGVEIYNR
FT                   IRGIDERPVETMREIKSIGKEKTLEKDTKNKELLIQHLKEFSEIVSEELIKERLYCRTV
FT                   TVKIKTADFAVHTKSKTVDKYIRFSEDIYEVAKGILEEWKLEQYVRLIGLSVSNLSPVK
FT                   YEQLSFLDKRLVKVIKAGNLAEEINKRIGKKIIKKGSELLKDNK"
FT   misc_feature    257549..258541
FT                   /gene="DinP"
FT                   /locus_tag="TTE0254"
FT                   /note="Pfam match to entry IMS, impB/mucB/samB family,
FT                   score 397.1, E-value 1.70E-115"
FT   gene            258691..260073
FT                   /gene="NorM"
FT                   /locus_tag="TTE0255"
FT   regulatory      258691..258695
FT                   /gene="NorM"
FT                   /locus_tag="TTE0255"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        258703..260073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NorM"
FT                   /locus_tag="TTE0255"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="Best Blastp hit = gi|7462346|pir||H72331 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981345|gb|AAD35897.1|AE001748_13 (AE001748) conserved
FT                   hypothetical protein [Thermotoga maritima], score 206,
FT                   E-value 5.00E-52"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23551"
FT                   /db_xref="GOA:Q8RCZ9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ9"
FT                   /protein_id="AAM23551.1"
FT                   /translation="MEAKEEERRNVAKEVMEIAWPSIAEQMLVMAVGMISTIFVGRISA
FT                   AALAAVGLINMVIFFLQAVFAGLSTGVTVVVARLVGEEDIEGVKTATSQSFIMAVFLTL
FT                   LFTLLGYAFDIPIIKTLFGKIEPEVFEFAILYYRIALIGFPFMVIALILGGALRGAGDT
FT                   KTPMYVTAVVNIINLILNALLVFGVPYKGRYLIPPFGVKGAAFSVTAARIVGGILLPYL
FT                   IYSGKNQAGIAIRGPFKLDFDMMKRIIKIGVPASLEQLVMQGGFLVVQIIVSTMGTTAI
FT                   AVYQIGMNANSLAFMPIFGFSIAATALVGRSLGAEEFDMAETYAKVSRNISVVVISVIG
FT                   VFMFVFSKQLAALYTTDPEVIRVSASILKIFAVVEPFLAIMVVMAGVLRAAGDISYVVI
FT                   TTVVGLWLFRIVLGSFLAKNFGMDIYGIWIGVFTDFIVRSIMYIFRFRAGKWKYIKV"
FT   misc_feature    258760..259251
FT                   /gene="NorM"
FT                   /locus_tag="TTE0255"
FT                   /note="Pfam match to entry UPF0013, Uncharacterized
FT                   membrane protein family UPF0013, score 135.5, E-value
FT                   9.70E-37"
FT   misc_feature    259459..259947
FT                   /gene="NorM"
FT                   /locus_tag="TTE0255"
FT                   /note="Pfam match to entry UPF0013, Uncharacterized
FT                   membrane protein family UPF0013, score 144.1, E-value
FT                   2.40E-39"
FT   regulatory      260075..260097
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            260181..261750
FT                   /gene="AcrA"
FT                   /locus_tag="TTE0256"
FT   regulatory      260181..260185
FT                   /gene="AcrA"
FT                   /locus_tag="TTE0256"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260191..261750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcrA"
FT                   /locus_tag="TTE0256"
FT                   /product="Membrane-fusion protein"
FT                   /note="Best Blastp hit = gi|12721480|gb|AAK03218.1|
FT                   (AE006154) unknown [Pasteurella multocida], score 78.6,
FT                   E-value 2.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23552"
FT                   /db_xref="GOA:Q8RCZ8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ8"
FT                   /protein_id="AAM23552.1"
FT                   /translation="MKRKYAYVIVAILLIAGIATFYFLNKTKTSTSSQIPYVTVTRGNI
FT                   SMTITGTGNLTGDVRAITLKNGVVKKVYFNVGDSVKKGDLLYELEDDNLNNQLEQAKLN
FT                   LDLATQQLNQDTKNYNSAVAKLSITSPVDGVVEILVKEGQDVTPGMPVAVVNVNKSNGS
FT                   EEGQPSGNSGTNVTAQVSGTVEKIYVSSGQNVRKGEVLIKLSSSNISDAQIQSDKIKVM
FT                   QAQNNYNQILKQIESLKIYSPIDGKILSQNIKEGDVLGNFSSNAGNNNLNASYVQTGFV
FT                   PVLDITQLSSYESQPDTAVIVGNSGYIVNLSVDETDIKNIKIGQKVQLTTDDLPGKVFS
FT                   GTVSQVSQLPTIQNGVASYNVTIQVDPSEDLMLGMSMDVAITVAEKNDVLLLPIQAVQT
FT                   LGNRQYVILYTDDMKNQNLSDANANNMRNLFRNNIRFIETGIHNNNFVEIVSGLQEGDR
FT                   VLIPLNSSLANSNNRNPQGFNFMMRPQGGFNRNTERPSGSFQGGSFNRSWQNNSSSGGN
FT                   NR"
FT   gene            261732..262445
FT                   /gene="PhnL"
FT                   /locus_tag="TTE0257"
FT   regulatory      261732..261736
FT                   /gene="PhnL"
FT                   /locus_tag="TTE0257"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261747..262445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PhnL"
FT                   /locus_tag="TTE0257"
FT                   /product="ABC-type transport systems, involved in
FT                   lipoprotein release, ATPase components"
FT                   /note="Best Blastp hit = gi|11498623|ref|NP_069851.1| 'ABC
FT                   transporter, ATP-binding protein [Archaeoglobus fulgidus]'
FT                   gi|7445942|pir||B69377 'ABC transporter, ATP-binding
FT                   protein homolog - Archaeoglobus fulgidus'
FT                   gi|2649576|gb|AAB90224.1| '(AE001033) ABC transporter,
FT                   ATP-binding protein [Archaeoglobus fulgidus]', score 260,
FT                   E-value 1.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23553"
FT                   /db_xref="GOA:Q8RCZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ7"
FT                   /protein_id="AAM23553.1"
FT                   /translation="MNSDKVLIKMRNLTKIYRIGQNEVRALDGIDLDIREGEFVSIVGQ
FT                   SGSGKTTLMNIIGCLDTKTSGEYFLNGIDTSKLTDNQLADLRCSEIGFVFQNFNLLQRM
FT                   TALENVELPMIYKGVPAKERRERAEMLLELVGLKDRMKHRPNELSGGQQQRVAIARALA
FT                   NNPRIILADEPTGNLDSKSGNEIMKIITELNERGNTVVVVTHDPNIAAQAKRIVRIKDG
FT                   RILGDEVKAQ"
FT   misc_feature    261855..262412
FT                   /gene="PhnL"
FT                   /locus_tag="TTE0257"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   202.2, E-value 8.10E-57"
FT   gene            262429..263617
FT                   /locus_tag="TTE0258"
FT   regulatory      262429..262433
FT                   /locus_tag="TTE0258"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        262442..263617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0258"
FT                   /product="ABC-type transport systems, involved in
FT                   lipoprotein release, permease components"
FT                   /note="Best Blastp hit = gi|7469821|pir||S76946
FT                   hypothetical protein - Synechocystis sp. (strain PCC 6803)
FT                   gi|1653948|dbj|BAA18858.1| (D90917) hypothetical protein
FT                   [Synechocystis sp.], score 185, E-value 8.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23554"
FT                   /db_xref="GOA:Q8RCZ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ6"
FT                   /protein_id="AAM23554.1"
FT                   /translation="MRYVQALKIAIRSILSNKLRSFLTMLGIIIGVTAVIALVSIGQGS
FT                   TKSVTSQIQSMGSNLIMVSVMGRGSQASLTYEQAMTLKDGNYIKAVSPVISSNVTAKYG
FT                   NNSVDSAMVNGVNSDYQAIRSIQVAEGRFISPMDDEGRNKVAVLGHNVATELFGFTDPV
FT                   GKTIKLNGQAFTVVGVLALKGSSIAGSDDDAIFIPIKTMFYFAKNKNIRQIYIGASNPD
FT                   TVEIAKNMINNHLLEVFKGDTSAFTIIDQSQILSTVNSVTTTLSLLLGGIAGISLLVGG
FT                   IGIMNIMLVSVTERTREIGIRKALGAKKRDILLQFIIESLTLSGLGGILGIIAGYILAV
FT                   TLGKAMNIDANPTLSTILISFSFSVLVGLFFGVYPANKAANLNPIEALRYE"
FT   misc_feature    262931..263605
FT                   /locus_tag="TTE0258"
FT                   /note="Pfam match to entry DUF214, Predicted permease,
FT                   score 196.8, E-value 3.40E-55"
FT   gene            263671..264087
FT                   /locus_tag="TTE0259"
FT   regulatory      263671..263675
FT                   /locus_tag="TTE0259"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263686..264087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0259"
FT                   /product="Hemerythrin"
FT                   /note="Best Blastp hit =
FT                   gi|6685084|gb|AAF23777.1|AF210632_1 (AF210632)
FT                   hemerythrin-like domain protein DcrH [Desulfovibrio
FT                   vulgaris], score 98.2, E-value 4.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23555"
FT                   /db_xref="GOA:Q8RCZ5"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ5"
FT                   /protein_id="AAM23555.1"
FT                   /translation="MIKWTESLSVGNETIDSQHKELIQKINDVLEACNRQHGKEKVVEV
FT                   MQFLKDYTVKHFKDEENLMKKYQYPMYEEHKKIHEDLVKKVEDLDERIKREGVSLSVVM
FT                   TVNKTLVDWFVNHISKEDKKVGEYIKNRK"
FT   misc_feature    263689..264084
FT                   /locus_tag="TTE0259"
FT                   /note="Pfam match to entry Hemerythrin, Hemerythrin, score
FT                   101.6, E-value 1.60E-26"
FT   gene            264151..264893
FT                   /gene="MhpD"
FT                   /locus_tag="TTE0260"
FT   regulatory      264151..264155
FT                   /gene="MhpD"
FT                   /locus_tag="TTE0260"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        264165..264893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MhpD"
FT                   /locus_tag="TTE0260"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /note="Best Blastp hit = gi|11499807|ref|NP_071050.1|
FT                   '2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (hpcE-2)
FT                   [Archaeoglobus fulgidus]' gi|9789822|sp|O28058|YM25_ARCFU
FT                   HYPOTHETICAL PROTEIN AF2225 gi|7448784|pir||A69528
FT                   '2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (hpcE-2)
FT                   homolog - Archaeoglobus fulgidus' gi|2648302|gb|AAB89031.1|
FT                   '(AE000952) 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
FT                   (hpcE-2) [Archaeoglobus fulgidus]', score 275, E-value
FT                   3.00E-73"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23556"
FT                   /db_xref="GOA:Q8RCZ4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ4"
FT                   /protein_id="AAM23556.1"
FT                   /translation="MRIVRVDKEPDSYGILENDKVILLKEGETFLYGLNEVKLLPPCIP
FT                   SKAICVGLNYKDHIEEMGDKIPEEPTLFIKPSTAVIGPDDYIILPEMSRRVDYEGELAV
FT                   VIGRKAKNVSIEEAKNYILGYTIANDVTARDLQAKDGQWTRAKSFDTFLPIGPWIVTDL
FT                   DPTSLNITTYVNGEVKQKSNTKYLIFNVFKLVSFISHIMTLNPGDVILTGTPSGVGPLK
FT                   SGDVVTIEIEGIGKLTNRVK"
FT   misc_feature    264348..264833
FT                   /gene="MhpD"
FT                   /locus_tag="TTE0260"
FT                   /note="Pfam match to entry FAA_hydrolase,
FT                   Fumarylacetoacetate (FAA) hydrolase family, score 325.1,
FT                   E-value 8.00E-94"
FT   gene            complement(264896..266071)
FT                   /locus_tag="TTE0261"
FT   CDS_pept        complement(264896..266071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|11498393|ref|NP_069621.1|
FT                   hypothetical protein [Archaeoglobus fulgidus]
FT                   gi|7483483|pir||C69348 hypothetical protein AF0787 -
FT                   Archaeoglobus fulgidus gi|2649827|gb|AAB90458.1| (AE001050)
FT                   A. fulgidus predicted coding region AF0787 [Archaeoglobus
FT                   fulgidus], score 186, E-value 4.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23557"
FT                   /db_xref="GOA:Q8RCZ3"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ3"
FT                   /protein_id="AAM23557.1"
FT                   /translation="MASLMTCSRTSGFLGGKLILKVSFPLFILQNNTNNNIKGGCIVVI
FT                   AALLVILLMILILPLVNRYIEHNIEYFLFSMGVAAAFVSGVFSYDLIIHIFKNHLLYLV
FT                   TVAVFLSGLLFEIFKDKFKTLIEITIARIPLKVFVFLVIVILGLTASIITAIIASIILV
FT                   EIIHLLPLKHKDKVVITVIASLSIGMGAALTPIGEPLATIATSKLNESFLYLFTTLGIY
FT                   IIPAVLALGFLGLLYINKLEKNSLIIEENYVEEAEEIKKIERFQFIFIQAFKIFVFILA
FT                   LELLGAGFKPVIDNYIIHLDSRLLYWINVTSAVLDNATLAAAEISPHMTTEQIRAILMG
FT                   LLISGGMLIPGNIPNIISAGKLNIKSREWALVGIPLSLIGLIIYFIVLFVI"
FT   repeat_region   266118..266259
FT                   /note="TLR054, identity:100%, copy 1"
FT   gene            complement(266488..267495)
FT                   /gene="Ecm27"
FT                   /locus_tag="TTE0262"
FT   CDS_pept        complement(266488..267483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Ecm27"
FT                   /locus_tag="TTE0262"
FT                   /product="Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23558"
FT                   /db_xref="GOA:Q8RCZ2"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCZ2"
FT                   /protein_id="AAM23558.1"
FT                   /translation="MIQDVIMLILSLAFILISCIFFTNSVEWLGKKLNLNQGVVGSILA
FT                   AVGTALPETIIPIIAIIFYSGKEASQIATGAILGAPFMLSTLGFLMTGVAVILYSSANK
FT                   RSIKMNADPNVFRRDLAYFILIYTLAIFTSVFNQFNEVRLASVVLLLTLYLLYVRATFN
FT                   SEGKIEQNVEELLFSRIFSLPPTLSWIIIQLFISLSGIIFSSHLFVGYVKDLSHLMGVS
FT                   PLILSLVITPIATELPEKFNSIVWVGQKKDTLALGNITGAMVFQSSIPVIIGILLTPWN
FT                   ITGIAFLSATLALTSATLNLIWINMKKSVNPFILMSGGILYGIFLLTAIH"
FT   regulatory      complement(267491..267495)
FT                   /gene="Ecm27"
FT                   /locus_tag="TTE0262"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            267708..271200
FT                   /locus_tag="TTE0263"
FT   regulatory      267708..267712
FT                   /locus_tag="TTE0263"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        267721..271200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0263"
FT                   /product="ATP-dependent nuclease"
FT                   /note="Best Blastp hit = gi|113346|sp|P23477|ADDB_BACSU
FT                   ATP-DEPENDENT NUCLEASE SUBUNIT B gi|98242|pir||A39432
FT                   ATP-dependent deoxyribonuclease chain B - Bacillus subtilis
FT                   gi|142439|gb|AAA22200.1| (M63489) ATP-dependent nuclease
FT                   [Bacillus subtilis] gi|2226191|emb|CAA74481.1| (Y14081)
FT                   ATP-dependent nuclease [Bacillus subtilis]
FT                   gi|2633398|emb|CAB12902.1| (Z99109) ATP-dependent
FT                   deoxyribonuclease (subunit B) [Bacillus subtilis], score
FT                   597, E-value 1.00E-169"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23559"
FT                   /db_xref="GOA:Q8RCZ1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCZ1"
FT                   /protein_id="AAM23559.1"
FT                   /translation="MSIRFIYGRAGSGKTYFCLEEIKHKLNDGANHPLILLVPEQFTFE
FT                   AEKYLLDMIERDEKMRAQVLSFKTLANRVFVEVGGLARQHMKACGKSMVIYKVLEENKE
FT                   KLKVYSKASRQQGFVKKISEAITEFKRFDVTPFQLIDASEKIEKLGLKEKLEDLALIYS
FT                   SFEEVLHKNYIDEEDELDLLSKKLEKSLQFEGAEFWIDGFTGFTPKQYKVIEKLLKKAS
FT                   RVSVTLTLDPSIDSIDPTHLFYTTKKTEEKLIKICETNGISVEEPVNLNKGIPKRFEHN
FT                   KELAFLEKNFFSHPYEIYNEETKNISIFKATNMYSEVEEVARDIARLIRDEHMRYSDIV
FT                   VATKDLKRYYKLVKAIFSHYGIPHFIDLKINITNNPIIVYVISIFEIYLKNWSYESVFR
FT                   YLKTGFTGIDKEEINLLENYVLANGIKGNKWKERWEYRIDYKTDSLLMEEREKQIINKV
FT                   NEVRERVYLPLEKFYTRFSHSKNVKEACEVLYDFLVENKLPEKIEKFIEEFKNRGEFDT
FT                   ANQYAQIWDIVVDVLDQMVEVLGEEKISLEQFARLISIGFDEYQIASIPPALDEVLVTS
FT                   VDRMKSHNSKVLYLLGANDGVFPASSFEEGIFSDEERNLLSSLDLELDRDTKAKVFEEQ
FT                   FLVYTALTSASEFLKISYPIADHEGRSLRPSIIISRLRRIFPKIKVSTNIVEMDTDEEN
FT                   LNRVTVPLPTFNEMIKSFKKWNITGKIHPIWLEVYKWYRTKDEWKKKLEDTLEGFVYDN
FT                   QIKRIPPLKIKKLYGEEMEFSVSRLEKYAACPFAYFVQYGLKAKERKIYGFEPPDLGIF
FT                   MHNVLNEIAKALEKEELTWQEIDKEWCNDAVDIIVEEMVDKIPGYILKSSSRYRYLANR
FT                   LKRVLSKAVWIISEHMKRSSFVPLGHEVAFGENQKYPPIKIVLSNGEEIKLIGRIDRVD
FT                   VLEKEGETYVRIIDYKSGDKTLDLSDVLYGLELQLLVYLDAILESAFEGKANLSPAGIF
FT                   YFKIDDPIVRADKDISDEELYKEIMKRLRLEGFVLKSLDIIREMDKLIEGTSYVIPASI
FT                   NKDGTIGKNTKGLTEEQFEILRKFVKKKSKKLAEEMLQGDISILPYKKEKETACQYCPY
FT                   SSICKFETNFKGNDYRRIESKEEKLWSIFEEEVKEDGSQVDGRTEGSDNNEG"
FT   gene            271133..274762
FT                   /gene="RecB"
FT                   /locus_tag="TTE0264"
FT   regulatory      271133..271137
FT                   /gene="RecB"
FT                   /locus_tag="TTE0264"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        271148..274762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecB"
FT                   /locus_tag="TTE0264"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /note="Best Blastp hit = gi|113345|sp|P23478|ADDA_BACSU
FT                   ATP-DEPENDENT NUCLEASE SUBUNIT A gi|98241|pir||B39432
FT                   ATP-dependent deoxyribonuclease chain A addA - Bacillus
FT                   subtilis gi|142440|gb|AAA22201.1| (M63489) ATP-dependent
FT                   nuclease [Bacillus subtilis] gi|2226192|emb|CAA74482.1|
FT                   (Y14081) ATP-dependent nuclease [Bacillus subtilis]
FT                   gi|2633399|emb|CAB12903.1| (Z99109) ATP-dependent
FT                   deoxyribonuclease (subunit A) [Bacillus subtilis], score
FT                   808, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23560"
FT                   /db_xref="GOA:Q8RCZ0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCZ0"
FT                   /protein_id="AAM23560.1"
FT                   /translation="MEVKWTEEQREAITTRGKNVLVAAAAGSGKTAVLVERIINIVTDP
FT                   EKPVDIDRLLVVTFTNAAASEMRERIAERLISLLDQHPEDKRLADQLTLLNKATITTIH
FT                   SFCLDVVRKHFFLLDLDPSFRVGDDTETLLLKLEAMEELFEELYEKNDEGFLLLVESYG
FT                   GTKGDQYLQDVLLKLYGFIRSLPWPEKWLNNVLEAFEVKEDFSFEDSKWAEVILDSIKV
FT                   EILGLLNGMSVAIEKLREERGLEGYLSLFQSEAHHLKELIDSKSWNEFKKKIEAISFER
FT                   LPKASKEADAEVKEEVRKLREDVKKRIREIRDKFFIDEEEEIKREIKKLYPVMKALADL
FT                   ILMFDKKYGEKKKEKGVIDFEDIEHFALKILSNEEVVSYYREKFEEIFIDEYQDSSLIQ
FT                   EAILSLIARDNPPNRFMVGDVKQSIYRFRQANPYIFFEKYTSYSQEGENKKILLYKNFR
FT                   SRKEIIDAVNYIFEKIMSKNIGEVDYSEEEKLNYGANYESNPFEKENERTVEVHLIERE
FT                   REEEFEEDEEILDDMQVEAHVVGERIKGLFREGFKVYDKEIGGYRPVEYRDICVLLRAT
FT                   EKWAYAFEEEFVKMGIPVFADTNAGYFDTAEIKTMLSLLQVIDNPMQDIPLLAVLRSPI
FT                   FSFTEEELVDIRLEDADGTIYEALKKASLREDELGEKVRNFLDSLKRWQEKSIYMPVDE
FT                   FLWYLYEETGFYSYVGAMPQGVERQANLRVLFERAKEYEETSFKGLFNFVNFINRLRTT
FT                   STDMGSAKTVGENENVVRVMSIHKSKGLEFPIVIVAGLGKQFNTKDLNEKILYHHFLGI
FT                   GPEFVDYRRRLSYPSIVKEAIKYKIKLESLSEEMRVLYVALTRAKEKLILVASVKDIKE
FT                   RAKKWGKAKLLGKKISEYDVLKSRSYIDWIGSALIRHRDLKLLREFAEISPELEQDSSK
FT                   WEVKIWNKRDVIIERKKDEGIEVLERLNALNLEGLHTEFRKEVEERLNYVYPYDRSSKL
FT                   PAKLSVTEIKRILNDEVIDEETTSIFERRVLKTPLFLEKKRGLTPAERGIAMHLVMQKL
FT                   DLSKDLSYRGIKEQIKDMVKNEILTEEQAKEVDANKIERFFKTPLGKRLLKAKEVRREV
FT                   PFHIKISSREIYRDLPEVYQEEFIAVQGIIDCFFEEEGELVLIDYKTDYVENGKIEEIR
FT                   DKYRVQIDLYGKALEEITGKKVKEKYIYLFFNDTIIKY"
FT   misc_feature    271160..273262
FT                   /gene="RecB"
FT                   /locus_tag="TTE0264"
FT                   /note="Pfam match to entry UvrD-helicase, UvrD/REP
FT                   helicase, score 364, E-value 1.50E-105"
FT   gene            274761..275975
FT                   /gene="SbcD"
FT                   /locus_tag="TTE0265"
FT   regulatory      274761..274765
FT                   /gene="SbcD"
FT                   /locus_tag="TTE0265"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        274773..275975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SbcD"
FT                   /locus_tag="TTE0265"
FT                   /product="DNA repair exonuclease"
FT                   /note="Best Blastp hit = gi|548899|sp|P23479|SBCD_BACSU
FT                   EXONUCLEASE SBCD HOMOLOG, score 240, E-value 3.00E-62"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23561"
FT                   /db_xref="GOA:Q8RCY9"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY9"
FT                   /protein_id="AAM23561.1"
FT                   /translation="MRILHTSDWHLGKTLENFSRLAEQEKFLDDFVKIAEENDVDLVII
FT                   AGDVYDSSNPPAKAEMLFYNTLKRLANGERVILAIAGNHDNPERLSAASPLAYEQGVIL
FT                   LGSTKTIVPTGDFGRFKIHNSGEGFFEVEIKGERAVVIALPYPSEKRLNEIFSESLEEE
FT                   ERQKSYSERVGRLFEELSKNYREDTINIAVSHIFVAGGEEAGSERPIQLGGSFTVELRH
FT                   LPEKAQYIALGHLHKPQRVSDVLPVYYSGSPLQYSKSEMNQSKCAYLVDLKAGEKAYVK
FT                   EIYFKNYKPIEVFRCDGIDEALKICEEYKDKDVWAYFEIKTESPLPSSQIREMKRLMPD
FT                   IVEIRPILPEEEDVFEEIEVEDKDIRELFQEFYLKEKKVPPSEEMVELFMSIIGKEDEG
FT                   A"
FT   misc_feature    274773..275660
FT                   /gene="SbcD"
FT                   /locus_tag="TTE0265"
FT                   /note="Pfam match to entry DNA_repair, DNA repair
FT                   exonuclease, score 224.6, E-value 1.40E-63"
FT   gene            275966..279505
FT                   /gene="SbcC"
FT                   /locus_tag="TTE0266"
FT   regulatory      275966..275970
FT                   /gene="SbcC"
FT                   /locus_tag="TTE0266"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        275972..279505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SbcC"
FT                   /locus_tag="TTE0266"
FT                   /product="ATPase involved in DNA repair"
FT                   /note="Best Blastp hit = gi|7474813|pir||A69836 DNA
FT                   exonuclease homolog yirY - Bacillus subtilis
FT                   gi|2633401|emb|CAB12905.1| (Z99109) similar to DNA
FT                   exonuclease [Bacillus subtilis], score 237, E-value
FT                   7.00E-61"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23562"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY8"
FT                   /protein_id="AAM23562.1"
FT                   /translation="MKPIRLKISGVNSFTEEQVINFELLTEKGLFGIFGPTGSGKSTII
FT                   DAITLSMYGKIPRNSKDFINTDSLSTSVVYEFEIGVGTERRRYIVERNIKKDLKNGGYK
FT                   TTLARLREITAEGEKVLAEKEREVHQKIVEIIGLTAEDFTRSVVLPQGKFSEFLKLSGR
FT                   ERRDMLERIFGLERYGNDLMEKVRKVKNEKALLLGMVNGELSRYEGVTEEALKEALAKL
FT                   ELLKEEEKNLSAEREELLKEREKLKEIWERQKELNQFLEKKRLLDEKASEIEVKRGKIE
FT                   KARKALSVKPYIDSVEETEKKLLLNKKELEKHAKELEEVSAQLEKIEKDYEITFREKEE
FT                   KIPLLIEKEERLKRAVQIEDEIKRLSEEREKLLTEYKNLESNIKRLEEEKEKLFLSIEN
FT                   LKKNIAEKEEKIVSIRISTEEKENVFKAFELEKEFERVKREREEKAYKIEEIEKLVEKQ
FT                   KGEYERIKVELTEKEEELQKEESSFNLLEVQKPLSSEELFNFQKELESKRLKLIEAQRN
FT                   KELEEKLEKTLKEVLEEREKLVGELEKTEREYVEKGKALDALQKEIEEIVRKNMAGELA
FT                   EGLEEGMPCPVCGSFHHINLAKKVDEKLIEEKKKLERGLRTEREVLQEKLIMLKSQLSG
FT                   FTAKEEISRAELEKAKENLRGIDLEILRKEIEEMEVKFKEEKEKLEDWAKEKEEKEKVL
FT                   KRLKEEKGQLALEEARIKERLQKDLKLLEEYKLSFEGIEREYQSLLKELENWKEKLGYA
FT                   NFSEKVEEINQKEKLIEKLREEVESLKKNLEELNIKREKVLEDLNQLIVRKTQVVEVGK
FT                   EKRSVLEKMQKELYSYSEGKDVKKYLEDVQKERAEILQRESFLKNRLEEERRKKQEIES
FT                   KKVSTLENQILLTNMLKEQIEKLELSLSKEGFKTKEEALSFVISSEEMSEIEIEVKRFE
FT                   NEYTSLVANIERLEGFLKGRQIEEEHWNRLEERIRELEEILTGKRKEIGATEKAIHDMK
FT                   ENLKKVEELTKKKKELEHVIDMLEELDKLFQGNKFVDFIASKQLKYITFSASKRLKEIS
FT                   RGRYALEIDSENNFVMRDDFNGGVRRSVDTLSGGETFLTSLSLALALSSHIQLKGKAPL
FT                   EFFFLDEGFGSLDSELLDVVMTSLERLKKDKMVVGIISHVEELKDRVPVKLIVTPPTVS
FT                   GEGSKVRIEYT"
FT   regulatory      279509..279527
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(279529..280585)
FT                   /gene="Gly1"
FT                   /locus_tag="TTE0267"
FT   CDS_pept        complement(279529..280569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Gly1"
FT                   /locus_tag="TTE0267"
FT                   /product="Threonine aldolase"
FT                   /note="Best Blastp hit = gi|7462865|pir||C72215
FT                   L-allo-threonine aldolase - Thermotoga maritima (strain
FT                   MSB8) gi|4982322|gb|AAD36809.1|AE001813_1 (AE001813)
FT                   L-allo-threonine aldolase [Thermotoga maritima], score 402,
FT                   E-value 1.00E-111"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23563"
FT                   /db_xref="GOA:Q8RCY7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY7"
FT                   /protein_id="AAM23563.1"
FT                   /translation="MKYIDLRSDTVTQPTPEMREAMYKAEVGDDVYGEDPTVRKLEEMA
FT                   AEMLGKEAAMLVTSGTQGNQVSIMTHTHPGEEIILEENSHIITYEVGGIGYLAGVQAKT
FT                   LKGNKGVLNPEDVEKAIRPKNIHFPETSLICLENTHNRAGGTVTPIEVMKKIYEIAQKH
FT                   GIPVHLDGARIFNAATYLKVDVKEIAKYADSVMFCLSKGLCAPIGSIVVGTKEFIERAR
FT                   KYRKMLGGGMRQAGFIAAAGIVALEKMTKRLQEDHDNARLLAEGLKNIPGIDLDMETVQ
FT                   TNIVMTDISGTGMTGREFSLKLKEHGVLVNGGDDFSVRFVTHYYITKEDVKKALSAIEK
FT                   VVREKH"
FT   regulatory      complement(280581..280585)
FT                   /gene="Gly1"
FT                   /locus_tag="TTE0267"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(280611..282389)
FT                   /gene="PspF6"
FT                   /locus_tag="TTE0268"
FT   CDS_pept        complement(280611..282389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PspF6"
FT                   /locus_tag="TTE0268"
FT                   /product="NtrC family Transcriptional regulator, ATPase
FT                   domain protein"
FT                   /note="Best Blastp hit = gi|10174497|dbj|BAB05598.1|
FT                   (AP001513) transcriptional regulator (sigma-L-dependent)
FT                   [Bacillus halodurans], score 315, E-value 1.00E-84"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23564"
FT                   /db_xref="GOA:Q8R5U6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U6"
FT                   /protein_id="AAM23564.1"
FT                   /translation="MWYSIIKALLRGGEIMDNILEEIKNDLQSIAETIKAITNVDVTIV
FT                   DEKLKRIAGTGPFKEKIGRYAPKNSAFEKALKTGRQYFIVNPGKHPICASCEEHQNCKE
FT                   ELELCIPIRNGEKIIGILGMSIFDKNTKIDFLNKQEDFKNFEKRFSELITTKINEKKLG
FT                   VMIEYRSSELMTLINSINEGIIILDSQNRVVTVNKYLKEKLNVSEKTPVKSIFPVKLLQ
FT                   ELEKKDFEGEVGPVEIKGIKFVINSSPIAVKGQRVGTVLVFSDFSKMQESVYKASKMSE
FT                   IVTFDDIVGESDAIKYAKSQAIQIADSEVPVLLLGESGTGKELFARAIHFQSSRKNEIF
FT                   MPINCGAIPETLIESELFGYEKGSFTGANVTGKIGKFELAKDGTIFLDEIGDLPLSMQV
FT                   KLLRALEEKEIVRIGGYTPIKVNPRIISATHKDLYQMVLEGKFREDLFYRLNVVPIVIP
FT                   PLRERGYDIIILANYFLEKFNKIYGKNIKGFSKESEKLLLSYPFPGNIRELRNLIEYAV
FT                   NFESKDYISPETINQRLHRKTLEEGKTLAEMVKNYEKNVIKEYMLRYGSDVESKKLIAK
FT                   KLGISIATLYRKMAEE"
FT   misc_feature    complement(280830..281528)
FT                   /gene="PspF6"
FT                   /locus_tag="TTE0268"
FT                   /note="Pfam match to entry sigma54, Sigma-54 interaction
FT                   domain, score 432, E-value 5.40E-126"
FT   gene            282590..283861
FT                   /locus_tag="TTE0269"
FT   CDS_pept        282590..283861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|9911121|sp|P42626|YHAM_ECOLI
FT                   HYPOTHETICAL 45.5 KDA PROTEIN IN EXUR-TDCC INTERGENIC
FT                   REGION, score 215, E-value 8.00E-55"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23565"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCY6"
FT                   /protein_id="AAM23565.1"
FT                   /translation="MRKDLLILTDILKANVAPALGCTEPGAVAYAVSKAREILGEEPRE
FT                   VYVAVDRDILKNGMFVSIPGTKEKGLVFAAALALVCGKSEYKLEALREATEEDIKKAHK
FT                   IVNRKAVKIVLEKDAEGLYIKASVVGDKHRATVIVKDAHDNIVYEERDGVVLKAKEENL
FT                   KEDKSWLKAKIKEFTIEDFLDYCDSVDFKEIEFIGEGIEMNKKIAYAGLNEEVGVGIGK
FT                   MLKRQIRDEESLAKALTAAASEARMSGYPLPVMSSAGSGNHGLVAILPIAIIGEERGYD
FT                   REKIIRAITLSHLLTAYVKAYIGVLSPICGCGVAAGVGMSAGLTYLLGGSRKQIKGAVS
FT                   NMLAGLSGMICDGAKIGCAYKLSISVTAALEASKFAMENIFIPSDNGILGNTAEESIKN
FT                   LGRISVEGMKNADDVILDIMLKKQ"
FT   regulatory      283864..283888
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(283923..284600)
FT                   /gene="AhpC"
FT                   /locus_tag="TTE0270"
FT   CDS_pept        complement(283923..284585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AhpC"
FT                   /locus_tag="TTE0270"
FT                   /product="Peroxiredoxin"
FT                   /note="Best Blastp hit = gi|7432678|pir||H72330
FT                   hypothetical protein TM0807 - Thermotoga maritima (strain
FT                   MSB8) gi|4981337|gb|AAD35889.1|AE001748_5 '(AE001748) alkyl
FT                   hydroperoxide reductase, putative [Thermotoga maritima]',
FT                   score 301, E-value 7.00E-81"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23566"
FT                   /db_xref="GOA:Q8RCY5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCY5"
FT                   /protein_id="AAM23566.1"
FT                   /translation="MEEIRMKLLGEKFPSMEVMTTHGVKRLPEDYAGKWFVLFSHPADF
FT                   TPVCTTEFVEFARKAEEFKQLNTELIGLSVDQVFSHIKWVEWIKDNTGVQIPFPVIADE
FT                   LGRVSNQLGMIHPGKGTNTVRAVFIVDDKGVIRLIMYYPQEVGRNVDEILRALKALQTA
FT                   DQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKAKEIEAFDWWFVHKPLK"
FT   misc_feature    complement(284121..284561)
FT                   /gene="AhpC"
FT                   /locus_tag="TTE0270"
FT                   /note="Pfam match to entry AhpC-TSA, AhpC/TSA family, score
FT                   167.8, E-value 1.90E-46"
FT   gene            complement(284587..285063)
FT                   /gene="Fur"
FT                   /locus_tag="TTE0271"
FT   CDS_pept        complement(284587..285063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fur"
FT                   /locus_tag="TTE0271"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /note="Best Blastp hit = gi|13701654|dbj|BAB42947.1|
FT                   (AP003135) ORFID:SA1678.; transcription regulator Fur
FT                   family homolog [Staphylococcus aureus]
FT                   gi|13876175|dbj|BAB46781.1| (AP003363) transcription
FT                   regulator Fur family homolog [Staphylococcus aureus], score
FT                   92, E-value 4.00E-18"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23567"
FT                   /db_xref="GOA:Q8RCY4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY4"
FT                   /protein_id="AAM23567.1"
FT                   /translation="MQQNNLKKEVMKMTYKVEELKDYLKKHGIRPSTIRLKILQYLLEN
FT                   RIHPTAEDIYKSLVNDIPTLSKTSVYNTLDLFLEKGVVNTLSLKEKELRYDINTYLHGH
FT                   FKCEVCGKVYDFPVTDKILEVNELEGFTIKSIDINAYGICKKCNEKIKNNKEEE"
FT   regulatory      complement(284596..284600)
FT                   /gene="AhpC"
FT                   /locus_tag="TTE0270"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(284641..284988)
FT                   /gene="Fur"
FT                   /locus_tag="TTE0271"
FT                   /note="Pfam match to entry FUR, Ferric uptake regulator
FT                   family, score 95.1, E-value 1.40E-24"
FT   gene            complement(285050..285236)
FT                   /locus_tag="TTE0272"
FT   CDS_pept        complement(285050..285226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|4760828|dbj|BAA77456.1|
FT                   (D87215) orf3dG [Clostridium histolyticum], score 74.3,
FT                   E-value 2.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23568"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY3"
FT                   /protein_id="AAM23568.1"
FT                   /translation="MEVKELVLKTLKESPQPLRPGDIAEKANLDKKEVDKAIKELKKEN
FT                   LIISPKRCYYAAK"
FT   regulatory      complement(285232..285236)
FT                   /locus_tag="TTE0272"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            285514..286504
FT                   /gene="GalT"
FT                   /locus_tag="TTE0273"
FT   regulatory      285514..285518
FT                   /gene="GalT"
FT                   /locus_tag="TTE0273"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        285527..286504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GalT"
FT                   /locus_tag="TTE0273"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /note="Best Blastp hit = gi|7434860|pir||A72322
FT                   hypothetical protein TM0896 - Thermotoga maritima (strain
FT                   MSB8) gi|4981431|gb|AAD35977.1|AE001754_14 '(AE001754)
FT                   galactose-1-phosphate uridylyltransferase, putative
FT                   [Thermotoga maritima]', score 260, E-value 2.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23569"
FT                   /db_xref="GOA:Q8RCY2"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY2"
FT                   /protein_id="AAM23569.1"
FT                   /translation="MSEIRFDLVTGKMVIIAVERAKRPHDFAIAHQEKKGSKDCPFCPR
FT                   NENMTPPSLVEIKDGQGKWLVRGFTNKFAALNTEVKEIDVPSLYRGEYGYGVAEVIVES
FT                   PYHDVTFGNLTLEQMKRVFHAIIERYRSIVKDEKIKYVQVFKNFGPRGGASLEHGHWQV
FT                   IAIPFIPELVNREVEGTQEYIKKERKCPYCEIIEYEREAGVRLIGENEKFVAIAPYASQ
FT                   YPYESWIIPKEHQEKFEEIDEDSLSKFVEILKPLIEKYEKEFEMPPYNIVLHTLPPRDI
FT                   RNYHWHIEIAPRLTIAAGFELGTGVHINPVSPELAASILKLQNL"
FT   gene            286501..288003
FT                   /gene="Ble"
FT                   /locus_tag="TTE0274"
FT   CDS_pept        286501..288003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Ble"
FT                   /locus_tag="TTE0274"
FT                   /product="uncharacterized protein, probably involved in
FT                   trehalose biosynthesis"
FT                   /note="Best Blastp hit = gi|11352313|pir||G83376 probable
FT                   trehalose synthase PA2152 [imported] - Pseudomonas
FT                   aeruginosa (strain PAO1)
FT                   gi|9948170|gb|AAG05540.1|AE004642_7 (AE004642) probable
FT                   trehalose synthase [Pseudomonas aeruginosa], score 129,
FT                   E-value 9.00E-29"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23570"
FT                   /db_xref="GOA:Q8RCY1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY1"
FT                   /protein_id="AAM23570.1"
FT                   /translation="MKERSGVMEKIISQIKGENLKKFRWFQEKAHEILNLFVKDYLIVY
FT                   ERKEEILAVIILGIMLKTPLSFNPFTAFYYLPVFISKNFKKADLIDEVEVEGERYFIYD
FT                   AVDSLPYVKWLNEVLTTRKAVEFRSGAKLVPYVVKDEDIYKVKRLSNKSTNSLTYLRKD
FT                   EIIKTYRKFAEGINPDLEMTFELKKAGFENVQDIRGYFLYELPTGEKYTVAMVVEYIKN
FT                   EGDMWQYTQQYLKDVIYRRTEGIDFTEYVREVKEIARIIGEMHSKLSFTKIDISQENVE
FT                   KILESIKGNFSKLLAFVEGKQFDEGTTSLLDTIKDFGQFIFEGLDEFSHISLGKYMRCH
FT                   GDLHLEQILKTERGYVIIDFEGEPTKPIEVRREKISPLKDVAGMLRSFNYAAYAAYFNY
FT                   LEKEMKREDEEVEKLLISWEKEVEEAFIEGYLKAVSEEASDVLPKEENFLKVLALFKLD
FT                   KALFEGIYEVNNRPTWFKIPLKGILECIEELKKPQEMGVSYG"
FT   gene            287957..289171
FT                   /gene="RfaG2"
FT                   /locus_tag="TTE0275"
FT   CDS_pept        287957..289171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG2"
FT                   /locus_tag="TTE0275"
FT                   /product="predicted glycosyltransferases"
FT                   /note="Best Blastp hit = gi|5459433|emb|CAB50741.1|
FT                   (AJ243803) putative glycosyl transferase [Streptomyces
FT                   coelicolor A3(2)] gi|6522847|emb|CAB61928.1| (AL133278)
FT                   putative glycosyl transferase [Streptomyces coelicolor
FT                   A3(2)], score 303, E-value 2.00E-81"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23571"
FT                   /db_xref="GOA:Q8RCY0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCY0"
FT                   /protein_id="AAM23571.1"
FT                   /translation="MKSSKNRRKWGLAMDNLKVTVFTNEYPPNIYGGAGVHVDYLTREL
FT                   SKLMKVDVRCFGDQKFFSENLTVKGYKEWEELKEGLDPRYQKVLGPFSIDLAMVKDPVD
FT                   SDVLHCHTWYTFMAGFLAKKLYDKPLVVTIHSLEPLRPWKEEQLGNGYKLSSWMEKTGI
FT                   KAADRIIAVSQGSKEDILKYYDVPEEKIEVIYNGIDLKEYKKIDRNVARKKYGIEGRYI
FT                   LFVGRISRQKGITHLIDAVKYLPKDVKVVLCASSPDTPEVLEEVEQKVKLHDNIIWINK
FT                   MVEKEDIVELYSNAEVFVCPSIYEPFGIINLEAMACETPVVASATGGIKEVVVHEETGF
FT                   LVEPGNSEELAKYINILLENRELAKKFGINGRKRVEEMFSWGSIAKKTYEMYRKVVQEY
FT                   KKAKK"
FT   misc_feature    288575..289078
FT                   /gene="RfaG2"
FT                   /locus_tag="TTE0275"
FT                   /note="Pfam match to entry Glycos_transf_1, Glycosyl
FT                   transferases group 1, score 180.6, E-value 2.50E-50"
FT   repeat_region   289214..289381
FT                   /note="TLR027, identity:87%, copy 7"
FT   gene            289506..290136
FT                   /gene="DedA"
FT                   /locus_tag="TTE0276"
FT   regulatory      289506..289510
FT                   /gene="DedA"
FT                   /locus_tag="TTE0276"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        289516..290136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DedA"
FT                   /locus_tag="TTE0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|13816130|gb|AAK42900.1|
FT                   '(AE006872) Membrane protein, putative [Sulfolobus
FT                   solfataricus]', score 114, E-value 8.00E-25"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23572"
FT                   /db_xref="GOA:Q8RCX9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX9"
FT                   /protein_id="AAM23572.1"
FT                   /translation="MESQSFLYNAVVNYGYIALFLVLAYEGTGLPGPVEILFFAAAYLA
FT                   VKGEMNLVAIVLVAALGNVTGNVIAYLVGYYKGRPVVEKYGKYLKITVKDLEAMDKWFA
FT                   KYGGFTVLLGRLVGLPRTPAIWASGITRMNFTVYVIFSAIADLIWSSFWTLISYLAAKQ
FT                   LIKVDFLTKSQPLWVYFVSTIGFIIFLYVVWRVVLWMKERYLT"
FT   misc_feature    289564..290037
FT                   /gene="DedA"
FT                   /locus_tag="TTE0276"
FT                   /note="Pfam match to entry DedA, DedA family, score 41.2,
FT                   E-value 2.40E-08"
FT   gene            290095..291218
FT                   /locus_tag="TTE0277"
FT   regulatory      290095..290099
FT                   /locus_tag="TTE0277"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        290109..291218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0277"
FT                   /product="cellulose biosynthesis protein"
FT                   /note="Best Blastp hit = gi|2120775|pir||I39710 cellulose
FT                   biosynthesis protein celD - Agrobacterium tumefaciens
FT                   gi|710488|gb|AAC41431.1| (L38609) celD [Agrobacterium
FT                   tumefaciens] gi|1094041|prf||2105261B celD gene
FT                   [Agrobacterium tumefaciens], score 70.9, E-value 3.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23573"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX8"
FT                   /protein_id="AAM23573.1"
FT                   /translation="MDERKISHMTVERITNISGLLEIEDIWHELEEEGKVYPFNTFEWV
FT                   LNWWKYFGHGKNLEIIVVYEGTMPIGIAPFMITYFEKGLFAKRIKFIGSTNSDYLDFIV
FT                   RSGYEKQFYTAIVDFLEKRIDSLTVLDLEHIPEDSEFFPYIMGSNLYYDYEVQDICPYI
FT                   ELPDTWEEYLEGLEGKFRRNLNYEVRRFFKEYDASFYVVKDFELVDRAMDTLINLHQKR
FT                   WRQKHMPGVFYSKRIRDFHKDVAKDMFLKGELSLFELKDGVKTVASLLSYHVGGIRYYY
FT                   ISGYDIEYSKRSVGNIAVGLAIKHSIEEGDRVFDFLRGDEEYKRNWTSLKKRNMRFVAS
FT                   KPTFLGKLLCKWVIVENGIIKKIKDRFNG"
FT   regulatory      291201..291225
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(291230..291987)
FT                   /locus_tag="TTE0278"
FT   CDS_pept        complement(291230..291982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|1075848|pir||C43727 conserved
FT                   hypothetical protein ylxW - Bacillus subtilis
FT                   gi|1129091|gb|AAA83971.1| (M31827) ORF4; putative [Bacillus
FT                   subtilis] gi|2633896|emb|CAB13398.1| (Z99111) similar to
FT                   hypothetical proteins [Bacillus subtilis], score 124,
FT                   E-value 9.00E-28"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23574"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX7"
FT                   /protein_id="AAM23574.1"
FT                   /translation="MEKLKGKLLQILSLFLVFVTMGFMISMQIKTVQGGIKQPLPPVSS
FT                   TNYARVEELTQQLKKVQEEKQNLEQQLAELTKRFQEYEEAASKNDAALKNLQKDVEKYK
FT                   ALAGFTDMVGPGVIVTVSDSDLQPREGEDPNLYLVHDEDLLNIVNELKAGGAEAIAIND
FT                   QRLIATSEIRCVGPTININSTRYAPPYVIKAIGNPETLVASLKLKGGIIETLEFYGIKV
FT                   DIQTSDKVVVPGYSEPVKFFYAKPINNP"
FT   regulatory      complement(291983..291987)
FT                   /locus_tag="TTE0278"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(292066..292598)
FT                   /locus_tag="TTE0280"
FT   CDS_pept        complement(292066..292587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX6"
FT                   /protein_id="AAM23575.1"
FT                   /translation="MGNLDEIKKLMEELIKSEKNREMASKEMEEVLEKSISEIKNILLT
FT                   IKKYIGSKNIKLRSYSGKIFEVGEGIVIFDKSIDEKIILKPDNNFYHYKVEGEELTATP
FT                   IPDLKIHDYITYDTLFETVKNSLKRCIQKNEEEIRLYKSTVYKIDKYNKELEEILSLKK
FT                   SVEGKMESDL"
FT   regulatory      complement(292594..292598)
FT                   /locus_tag="TTE0280"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            292673..293144
FT                   /locus_tag="TTE0279"
FT   regulatory      292673..292677
FT                   /locus_tag="TTE0279"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        292686..293144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23576"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX5"
FT                   /protein_id="AAM23576.1"
FT                   /translation="MQKITQQEMILSSFVEARKLENILLEKVKEYKTGGFDSQIKALLK
FT                   QMETMVKNHHQDIKRAQKELNITSTVKKNMSQEPLDMLQDLLKNLVNLQAFYNETVVNI
FT                   PNPYVRQLFTQMRDDVMRFISLLQIEIESLESKPSIPNNKVLNRPEMS"
FT   gene            293131..294246
FT                   /gene="FixC"
FT                   /locus_tag="TTE0281"
FT   regulatory      293131..293135
FT                   /gene="FixC"
FT                   /locus_tag="TTE0281"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        293146..294246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC"
FT                   /locus_tag="TTE0281"
FT                   /product="Dehydrogenases (flavoproteins)"
FT                   /note="Best Blastp hit = gi|7450119|pir||C71240
FT                   hypothetical protein PH0181 - Pyrococcus horikoshii
FT                   gi|3256567|dbj|BAA29250.1| (AP000001) 393aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 55.5,
FT                   E-value 1.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23577"
FT                   /db_xref="GOA:Q8RCX4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX4"
FT                   /protein_id="AAM23577.1"
FT                   /translation="MKIAIIGAGPSGLAAAITFQRYKVMPSIFERKDKVGELFNHVGGL
FT                   LKVINRPVRDPLVYLKKKCGIEILPNSVIKKIVMKGPSVEGVVSGNNLGYMTLRGQSED
FT                   SLENQLYKKLVVPVNFNVEADYKDLKDKYDYVIIATGNSQIPKELGCWQELVSTWVRVA
FT                   SVIGNFEVNTLIMWINTLYTKSGYVYLMPYNEKRAVLAMVIPYISKEELQYYWDTFLKV
FT                   EKLDVDIINMVDLTHDSGNCFPHQYENLLFVGNAGGAIEPFLGFGTFNSILSGVIAAES
FT                   VLKGRNFEQEIKPLSEANIKMLEFRKALDLMDNDSLDKFIKVLTFPPVKRLIYHTNFNA
FT                   IKYGAFFMKHTFNRERNKPYNQRKKV"
FT   gene            294236..295313
FT                   /gene="FixC2"
FT                   /locus_tag="TTE0282"
FT   regulatory      294236..294240
FT                   /gene="FixC2"
FT                   /locus_tag="TTE0282"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        294243..295313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC2"
FT                   /locus_tag="TTE0282"
FT                   /product="Dehydrogenases (flavoproteins)"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23578"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX3"
FT                   /protein_id="AAM23578.1"
FT                   /translation="MRLKIAIIGAGISGLSCALALERHGIYCDIYERKHTIGNLFPFGE
FT                   IILQIMTRPCKDPLDFFKKFGLVLRPLNEITRIVIKSPTRKVEIRGRLGYIFERGQGEN
FT                   SIENQLAQQIKSKIFFNVNANYEDLKKSYDYVVIATGNEMAAKQLTEWESVVSARVKGG
FT                   ILLGDFEPHSVYVWFDRSYAKSGFAYLVPLSNKKASLILVATYTLKEEIEDLWQTFLFK
FT                   ESLKYKMIETFETELESGMIKEHQVGNVYLVGNAGGFLEPAFGFGLVNSIKTSFYCADS
FT                   IVKGGIYEGKVKDVLKGIEKMVELRKEIDDMRDEDYDRLLRIIGNPFIKGLIYKTNFNI
FT                   MKHMPFFIKLIKKPGQ"
FT   regulatory      295301..295321
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(295322..295763)
FT                   /locus_tag="TTE0283"
FT   CDS_pept        complement(295322..295750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0283"
FT                   /product="predicted DNA-binding proteins with PD1-like
FT                   DNA-binding motif"
FT                   /note="Best Blastp hit = gi|11497724|ref|NP_068945.1|
FT                   hypothetical protein [Archaeoglobus fulgidus]
FT                   gi|7483360|pir||H69262 hypothetical protein AF0104 -
FT                   Archaeoglobus fulgidus gi|2650552|gb|AAB91134.1| (AE001099)
FT                   A. fulgidus predicted coding region AF0104 [Archaeoglobus
FT                   fulgidus], score 109, E-value 2.00E-23"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23579"
FT                   /db_xref="GOA:Q8RCX2"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX2"
FT                   /protein_id="AAM23579.1"
FT                   /translation="MGYKEVTPKRRLMGRFPHGSDLLQEINKVITEENILSGEVRIIGA
FT                   VTKAVFGYYDSESKNYIYISKDEHMEILNCIGNISVKDGKPFPHVHITLADKNGNAYGG
FT                   HLMEGTKVFAAEFVIVDYGDSKLERVYDETTGLQLWDI"
FT   regulatory      complement(295759..295763)
FT                   /locus_tag="TTE0283"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(295775..297923)
FT                   /locus_tag="TTE0284"
FT   CDS_pept        complement(295775..297910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0284"
FT                   /product="vacuolar-type H+-translocating inorganic
FT                   pyrophosphatase"
FT                   /note="Best Blastp hit =
FT                   gi|6901676|gb|AAF31163.1|AF182813_1 (AF182813)
FT                   vacuolar-type H+-translocating inorganic pyrophosphatase
FT                   [Arabidopsis thaliana] gi|6901678|gb|AAF31164.1|AF184917_1
FT                   (AF184917) vacuolar-type H+-translocating inorganic
FT                   pyrophosphatase [Arabidopsis thaliana], score 608, E-value
FT                   1.00E-173"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23580"
FT                   /db_xref="GOA:Q8RCX1"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCX1"
FT                   /protein_id="AAM23580.1"
FT                   /translation="MGAYLTLIYGVIVIAALVIIGLIKFIFAQDKGNEKMQQISDAIKE
FT                   GAMAFLNRQYKTIASLALIVAVIIVVANYYGHLSEGSSQALSFALHVGFAFITGAFCSA
FT                   LSGYIGMYMAVNSNIRAAAGARSGLNRALQIALKGGAVTGLAVTALSLFGVATLFLAYG
FT                   GLSGQDELIKEAPSLIVGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDD
FT                   PRNPAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGVGLYPIFGWKGILFPLVAR
FT                   AIGIIASIIGIFFVNTKDESKDPMIALNKGYFVTTVVNLIALFFAVKVMLSGHLPDGRP
FT                   VNYLLLYGAVVTGVILSYIFVFLTDYYTSVNKRPVQEIAKASTTGAATNIITGTSVGME
FT                   STALPVIFISAAIYIAYKLGEMAIPHIGTAGLYGTAIATMGMLSTTAYILAMDTFGPIT
FT                   DNAGGITEMSGAPEEIRRVTDRLDACGNTTKALTKGYAIGSAALATFLLFSAYLDEVKK
FT                   ILGKPIDSWFPVDIGKPEVFIGAFIGAMIVYLFSSTAIRAVGKAAQYVILEVRRQFREI
FT                   PGIMEGTAKPDYARAVDIVTKGALKEMVIPGLIVVVTPILVGVILGKEAAAAFLMIGTI
FT                   SGVILALYLNNGGGAWDNAKKFIELGNYGGKGSDAHKASVVGDTVGDPFKDTAGPSLHV
FT                   LIKLISTITLVFVALFR"
FT   regulatory      complement(297919..297923)
FT                   /locus_tag="TTE0284"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            298105..299206
FT                   /locus_tag="TTE0285"
FT   regulatory      298105..298109
FT                   /locus_tag="TTE0285"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        298118..299206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7518148|pir||F75039
FT                   hypothetical protein PAB1515 - Pyrococcus abyssi (strain
FT                   Orsay) gi|5458724|emb|CAB50211.1| (AJ248287) hypothetical
FT                   protein [Pyrococcus abyssi], score 493, E-value 1.00E-138"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23581"
FT                   /db_xref="GOA:Q8RCX0"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCX0"
FT                   /protein_id="AAM23581.1"
FT                   /translation="MSKITLSVIKADIGGYVGHTDVHPDLLEIAKKMLKEKGDMLIDFH
FT                   VTRVGDDIQLIMTHREGVDSEKIHKLAWDTFLACTERARELKLYGAGQDLLKDSFSGNI
FT                   KGMGPGVAEMEFEERKSEPVVIFIADKTEPGAWNLPLYKMFADPFNTAGLIIDPSMHQG
FT                   FKFEVYDMYEGKKIVFNTPEELYDMLVFIGATGRYCIRKVYTKNNEIAAVSSTQRMNLM
FT                   AGKYIGKDDPVLIVRCQNGLPAVGEVLEAFANPHLVFGWMRGSHTGPMIPVSLEDAVPT
FT                   RFDGPPRVCALGFQLKEGKLIGPQDLFKDIAFDSARKKALEIADYMRTLGPFEPHRLPL
FT                   QELEYTTLPHLMEKLKDRWEKD"
FT   misc_feature    298121..299203
FT                   /locus_tag="TTE0285"
FT                   /note="Pfam match to entry DUF100, Protein of unknown
FT                   function DUF100, score 742.2, E-value 2.30E-219"
FT   regulatory      299207..299222
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            299304..300324
FT                   /gene="RbsB2"
FT                   /locus_tag="TTE0286"
FT   regulatory      299304..299308
FT                   /gene="RbsB2"
FT                   /locus_tag="TTE0286"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        299317..300324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsB2"
FT                   /locus_tag="TTE0286"
FT                   /product="Periplasmic sugar-binding proteins"
FT                   /note="Best Blastp hit = gi|10176465|dbj|BAB07559.1|
FT                   (AP001520) sugar ABC transporter (sugar-binding protein)
FT                   [Bacillus halodurans], score 168, E-value 1.00E-40"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23582"
FT                   /db_xref="GOA:Q8RCW9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW9"
FT                   /protein_id="AAM23582.1"
FT                   /translation="MKTLKEKFFKLLDKVIIVSIIAISISAFLLYKFQTAQKPIFAKVP
FT                   EYHFYMVGQNSVDPFWKEIKMGAMEAAKYYNVALEFNAPKFNNIQEELKYLEIAIFSKV
FT                   DGIITHVANNEEFVNLIEEAYKEGIPVITVENDAKDSKRQAFIGTNSFHLGEEAARLMA
FT                   KATKGKANIAIIVSNDYQLDSVNQNLKINGFLDAIKNYPEMKVVRVYTSKLGTLSAEEI
FT                   TQSIISGKDKINAIYVTDSVDTIGTAQVVVDFNKVGEITVVGYGDTPDILRYIEKGVIY
FT                   GTVMSDPYKIGYESIKAMVEFKKKNTVSTFVDIGVNVITKENVNEYFKRIQSLD"
FT   gene            300327..301819
FT                   /gene="LytS"
FT                   /locus_tag="TTE0287"
FT   regulatory      300327..300331
FT                   /gene="LytS"
FT                   /locus_tag="TTE0287"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        300338..301819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LytS"
FT                   /locus_tag="TTE0287"
FT                   /product="predicted ATPase"
FT                   /note="Best Blastp hit = gi|10176466|dbj|BAB07560.1|
FT                   (AP001520) two-component sensor histidine kinase [Bacillus
FT                   halodurans], score 264, E-value 2.00E-69"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23583"
FT                   /db_xref="GOA:Q8RCW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW8"
FT                   /protein_id="AAM23583.1"
FT                   /translation="MLRDLWKAGGIRKKLIIYYLIVTVLMGMTSFYSYYNAKVAIEKLK
FT                   SIFVDYVYLNNLNSDVNMLETEVERYLATKSSDALLNYYSLYNKLENKASDILSQNYYD
FT                   TDSLMLKDIANMINKLLEEADAAVNAKRGRITSEYIDHFTKSIKISDYIKFYMTNLLNN
FT                   KLQEGSAKYASITKNMEYLSYLNIFLILISIGFSIFLAFLFTYKITKPIIDLSHLAVRV
FT                   SKGDFEVRPIELKTNDEIKVLSEAFNKMVVNIKKYIGEIKKQAEMERKIKEAELKALQS
FT                   QINPHFLFNTLNAAAQLAMMEGAEKSAEFIENVANLFRYNLKKLDSTVTLKDEIENVKR
FT                   YIYILKTRFGDKIDFKLDVEEEVLDLEMPCMILQPVVENAFIHGLEDVERDGLIVLKAY
FT                   KEGEKVLVEIADNGVGMEQEKIKAILALDSPDVDKKHVTGIGMHNIIHRLLVFYDISSV
FT                   EDVIEIKSEIGKGTKVTLKIPDKKGERNYGQVVNS"
FT   misc_feature    300893..301105
FT                   /gene="LytS"
FT                   /locus_tag="TTE0287"
FT                   /note="Pfam match to entry HAMP, HAMP domain, score 42.4,
FT                   E-value 9.90E-09"
FT   misc_feature    301439..301783
FT                   /gene="LytS"
FT                   /locus_tag="TTE0287"
FT                   /note="Pfam match to entry HATPase_c, Histidine kinase-,
FT                   DNA gyrase B-, phytochrome-like ATPase, score 35.9, E-value
FT                   1.50E-08"
FT   gene            301783..303386
FT                   /gene="CheY2"
FT                   /locus_tag="TTE0288"
FT   regulatory      301783..301787
FT                   /gene="CheY2"
FT                   /locus_tag="TTE0288"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        301797..303386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CheY2"
FT                   /locus_tag="TTE0288"
FT                   /product="CheY-like receiver domains"
FT                   /note="Best Blastp hit = gi|10176467|dbj|BAB07561.1|
FT                   (AP001520) two-component response regulator [Bacillus
FT                   halodurans], score 226, E-value 4.00E-58"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23584"
FT                   /db_xref="GOA:Q8RCW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW7"
FT                   /protein_id="AAM23584.1"
FT                   /translation="MVKLLIADDEQIVLDSIKFIIEKNNVQAEIVGTAKSGREAIEKAD
FT                   LLKPDLIFMDIRMPGIDGIEAIRQIKERHKEMIFVIITAYEYFNYAKEAIDLGVMDYLL
FT                   KPLNKNKIIEVIEKASKVIEERRKAVLTEIELREKINKIMPYLEEQFLYTVLFGGYVGG
FT                   SLDFYEEIFDMKLEKGYIMIFLMRSDTSNEREKSIEVNLKRQSLYEHLRIFLKGVSKCI
FT                   LGPFFMDKICVYFPVEEKTPFEVKNSSVKIANKVLESLQGSEKENLRVGIGREYSFNNI
FT                   VKSYYEAEMALKLFPDDTIVHFDDAVGTSTISHFPYPLDKEKLFIERLVEGDLARAFKV
FT                   FDEIYEWMILEYDKDAGKIKSKLIELVGIIRRSFYYYLEEGSFKEEIAQIEELLKIEDL
FT                   RELKLVFIKMLKDIVENIRVVNKKKWDNITMKVINFLEENFSKDISLEDAAREVNMSYH
FT                   YFSKFFKEQVGENFVDYLTNLRIRKAKELLKNSSLSVKEVSYKVGYSDPNYFSKIFKKV
FT                   TGVTPTEFKEGV"
FT   misc_feature    301800..302168
FT                   /gene="CheY2"
FT                   /locus_tag="TTE0288"
FT                   /note="Pfam match to entry response_reg, Response regulator
FT                   receiver domain, score 127.2, E-value 3.00E-34"
FT   misc_feature    303123..303383
FT                   /gene="CheY2"
FT                   /locus_tag="TTE0288"
FT                   /note="Pfam match to entry HTH_AraC, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 114.1,
FT                   E-value 2.70E-30"
FT   gene            303376..304472
FT                   /gene="RbsB3"
FT                   /locus_tag="TTE0289"
FT   regulatory      303376..303380
FT                   /gene="RbsB3"
FT                   /locus_tag="TTE0289"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        303390..304472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsB3"
FT                   /locus_tag="TTE0289"
FT                   /product="Periplasmic sugar-binding proteins"
FT                   /note="Best Blastp hit = gi|3098494|gb|AAC38794.1|
FT                   (AF043466) D-xylose-binding protein [Thermoanaerobacter
FT                   ethanolicus], score 281, E-value 7.00E-75"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23585"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW6"
FT                   /protein_id="AAM23585.1"
FT                   /translation="MKVGEMVKLVIAVILTIIAVFLGFLTVKQVVAYHSAKNLYREEDK
FT                   SKKVKIGFSLGTLKEERWVKDRDIVMAKLKELGAEVLVQNANNDDEDQLKQVKYLLEQK
FT                   IDVLIIVPNDLEKASYAVSLAQKEGVKVISYDRLVTRSNVDLYISFDNVKVGKFMAEYL
FT                   VKRVPKGNYLIVNGATTDNNTKMIKEGYDSVLKPFIDRGDIKIVKEDWAPNWMAEYAFN
FT                   VTDEVLQKGIKVDAIIAGDDALAGGIIEALALHRLAGKIPVVGQDADLAACQRIVEGTQ
FT                   AMTVYKPIDKLAEATARMAMKLARGEKLDVKNTIYDGKYYVPYYVIEPIPVDRSNLDDT
FT                   VIKDGFHTRDQVYRNISVSR"
FT   gene            304630..305782
FT                   /gene="RbsB4"
FT                   /locus_tag="TTE0290"
FT   regulatory      304630..304634
FT                   /gene="RbsB4"
FT                   /locus_tag="TTE0290"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        304646..305782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsB4"
FT                   /locus_tag="TTE0290"
FT                   /product="Periplasmic sugar-binding proteins"
FT                   /note="Best Blastp hit = gi|1706206|sp|P25548|CVE1_AGRTU
FT                   MULTIPLE SUGAR-BINDING PERIPLASMIC RECEPTOR CHVE PRECURSOR
FT                   gi|471095|dbj|BAA04267.1| (D17457) ChvE [Agrobacterium
FT                   tumefaciens], score 169, E-value 7.00E-41"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23586"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW5"
FT                   /protein_id="AAM23586.1"
FT                   /translation="MSRKGKIFLVLTALLLVVSAFLGGCSSSKQPASSSNSSGKQLAIG
FT                   IVLPTKDEPRWIQDETRFQDALKDTPYAAEILFSQGDPAKEKANVETLLSKGIKVLILC
FT                   PHDANAAAASAEAAKKAGVKVISYDRLILNTDAVDYYVTFDSVQVGQQQGQYLVDHATG
FT                   KGNPLYLYAGALSDNNSFLFFQGAWEVLQPKIADGTFVIANSDKANALKDKKDLTRQEM
FT                   ADIIGQITTNWDFNTAKNLAQANLAKAPKDLKGNVFILAPNDGTARSIADTFAADPDIK
FT                   SYVITGQDAEKPSIQYIIDGKQSMTVFKDVRILVKDAINVALTYLKGGTPESTKTYNNG
FT                   VKDVPSKPSPVQVVDKNNVKQVLIDSGYYKESDFKWSK"
FT   gene            305786..307322
FT                   /gene="MglA2"
FT                   /locus_tag="TTE0291"
FT   regulatory      305786..305790
FT                   /gene="MglA2"
FT                   /locus_tag="TTE0291"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        305799..307322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MglA2"
FT                   /locus_tag="TTE0291"
FT                   /product="ABC-type sugar (aldose) transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit =
FT                   gi|5616304|gb|AAD45713.1|AF160811_1 '(AF160811) L-arabinose
FT                   transport, ATP binding protein [Bacillus
FT                   stearothermophilus]', score 453, E-value 1.00E-126"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23587"
FT                   /db_xref="GOA:Q8RCW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW4"
FT                   /protein_id="AAM23587.1"
FT                   /translation="MGAPLIELVNVNKSFSGVQVLFNVNFRVYPKEIHCLVGENGAGKS
FT                   TLMKILSGVYPYGEYEGEILIEGNPVRFFSIKDSERAGISIIHQELSLVPEMTVYENVF
FT                   LGNEIRKGAVVDVMEEIVRTKELLKKVKGEEISPTAKAKDLSVSMQQLVEIAKALSKNP
FT                   KVLILDEPTSALSETESENLLSLLKELKEQGVTIILISHRLKEVLKVADSITVLRDGRT
FT                   VAYFDCKKEEVDEQKIIKHMVGREITNLYPPPLSKPSDEVVMEVKNWSVVDPKTGRYLV
FT                   KDVNLKVRKGEIVGLFGLVGAGRTELGLSLFGNPYRYFVQGEIFLNGQRVHFRKPADAI
FT                   RYKLLYLTEDRKQKGLILINTVKENITLSNLKTLTKQMVIDELEEIAVAQNFQKKLGIK
FT                   ARHVEVKVSTLSGGNQQKVLVAKGLFVEPEVIILDEPTRGVDVGAKYEIYTLIRQLAME
FT                   GKAILLISSELPEILGLSDRIYVMSKGRITGELKGDEANQEKVMAYAVI"
FT   misc_feature    305889..306458
FT                   /gene="MglA2"
FT                   /locus_tag="TTE0291"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   194.9, E-value 1.30E-54"
FT   misc_feature    306669..307253
FT                   /gene="MglA2"
FT                   /locus_tag="TTE0291"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   89.5, E-value 6.70E-23"
FT   gene            307323..308528
FT                   /gene="AraH2"
FT                   /locus_tag="TTE0292"
FT   regulatory      307323..307327
FT                   /gene="AraH2"
FT                   /locus_tag="TTE0292"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        307338..308528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AraH2"
FT                   /locus_tag="TTE0292"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Best Blastp hit =
FT                   gi|5616305|gb|AAD45714.1|AF160811_2 (AF160811) L-arabinose
FT                   membrane permease [Bacillus stearothermophilus], score 297,
FT                   E-value 2.00E-79"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23588"
FT                   /db_xref="GOA:Q8RCW3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCW3"
FT                   /protein_id="AAM23588.1"
FT                   /translation="MRSFYGHLKEFLRENVRDYAMFIALLVIMIVFAILSGGDFLLPVN
FT                   ISNLVDQTGYIAVLSIGETLIIVIRHIDLSVGFLSGFLGAIAAILMQFHHFSAFTAILI
FT                   VLILGTLAGLLNGSLVAYLRIPAFVATLAGWLAYRGALLLATKGPGTIIITNKTFNAIG
FT                   NDFIPDLPFLKNFMPGYHKLTLLIGIIGVVLIVYFSLKNRNEQARRGFDVLPWDMFLLK
FT                   MVFISGLLLYLTFTLARYRGISWTFVIVLIVTAVYSFITNRTVLGRHIYAVGGNPEAAA
FT                   LSGIDVNKITLIVFASMGFLSGLSGVLFASRLQSATTTAGTLFELYAIAGAFIGGVSAS
FT                   GGVGKVVNSLIGAFVMSTLTNGMNLLGVDISLQYIILGLVLATAVIFDVATRSRGR"
FT   regulatory      308532..308550
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(308588..310057)
FT                   /gene="GcvP"
FT                   /locus_tag="TTE0293"
FT   CDS_pept        complement(308588..310045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GcvP"
FT                   /locus_tag="TTE0293"
FT                   /product="Glycine cleavage system protein P
FT                   (pyridoxal-binding), C-terminal domain protein"
FT                   /note="Best Blastp hit = gi|1730257|sp|P54377|GCS2_BACSU
FT                   PROBABLE GLYCINE DEHYDROGENASE [DECARBOXYLATING] SUBUNIT 2
FT                   (GLYCINE DECARBOXYLASE) (GLYCINE CLEAVAGE SYSTEM P-PROTEIN)
FT                   gi|7451546|pir||B69959 glycine dehydrogenase homolog yqhK -
FT                   Bacillus subtilis gi|1303892|dbj|BAA12548.1| (D84432) YqhK
FT                   [Bacillus subtilis] gi|2634889|emb|CAB14386.1| (Z99116)
FT                   similar to glycine dehydrogenase [Bacillus subtilis], score
FT                   625, E-value 1.00E-178"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23589"
FT                   /db_xref="GOA:Q8RCW2"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCW2"
FT                   /protein_id="AAM23589.1"
FT                   /translation="MLKEYNSLIFELSKEGKKAYTLPPLDVEEKPLEDMLPKEMLREKE
FT                   VDLPEVSEVDVIRHYTLLSQKNYGVDIGFYPLGSCTMKYNPKINEDMASLPGFTELHPY
FT                   QPEETVQGALKLMYELEKALCEITGMDRFSLHPAAGAHGELTGLMIIKAYHEHRNDKKR
FT                   KKIIVPDSAHGTNPASAAVAGFDVIEIKSNKEGAIDLEALKAVLNDEVAGLMLTNPSTL
FT                   GLFEENIVEIARLVHEAGGLLYYDGANLNAIMGISRPGDMGFDVVHLNLHKTFSTPHGG
FT                   GGPGSGPVGVKKELADFLPVPTVEEKDGRYFLDYDRPLSIGKVRSFYGNFNVMIKAYSY
FT                   ILTMGAEGLKRASELAVLNANYLKEKLKGYYKVAVDKTCMHEFVLAGLAEKSGDVRTLD
FT                   VAKRLIDYGFHPPTIYFPLIVEEALMIEPTETETKETLDAFAETLIKIAKEAKENPELL
FT                   KEAPHNTPVRRLDEVLAARNPVIRWTK"
FT   misc_feature    complement(308714..309982)
FT                   /gene="GcvP"
FT                   /locus_tag="TTE0293"
FT                   /note="Pfam match to entry GDC-P, Glycine cleavage system
FT                   P-protein, score -230.4, E-value 7.30E-06"
FT   gene            complement(310047..311396)
FT                   /gene="GcvP2"
FT                   /locus_tag="TTE0294"
FT   CDS_pept        complement(310047..311396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GcvP2"
FT                   /locus_tag="TTE0294"
FT                   /product="Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain protein"
FT                   /note="Best Blastp hit = gi|1730256|sp|P54376|GCS1_BACSU
FT                   PROBABLE GLYCINE DEHYDROGENASE [DECARBOXYLATING] SUBUNIT 1
FT                   (GLYCINE DECARBOXYLASE) (GLYCINE CLEAVAGE SYSTEM P-PROTEIN)
FT                   gi|7451835|pir||A69959 glycine dehydrogenase homolog yqhJ -
FT                   Bacillus subtilis gi|1303891|dbj|BAA12547.1| (D84432) YqhJ
FT                   [Bacillus subtilis] gi|2634890|emb|CAB14387.1| (Z99116)
FT                   similar to glycine dehydrogenase [Bacillus subtilis], score
FT                   471, E-value 1.00E-131"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23590"
FT                   /db_xref="GOA:Q8RCW1"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCW1"
FT                   /protein_id="AAM23590.1"
FT                   /translation="MIVMFPYLPISSEDEKEMLKTIGKNSIEELFEVIPKEVRLNRPLN
FT                   LGKPMSELEVRKRLGSYADENKNLSQLVSFLGAGVYDHYIPSVVKHIISRSEFYTAYTP
FT                   YQPEISQGTLQAIFEYQTMITNLTGMEVTNASMYDGASACAEAAMMACDATKRKSIIVS
FT                   KTVNPETRKVLKTYMHFKEVEVVEIEDADGVTDIEKLKEVIGPNTAAVIVQYPNFFGII
FT                   ENLQEIEKITHEQKAMLITYVHPIPLGILKSPGEIGADIAVGDGQSLGNGLHYGGPYLG
FT                   FLATTQKLLRRMPGRIVGQTKDVDGKRGFVLTLQAREQHIRREKATSNICSNHSLNALT
FT                   AAVYLATIGKKGIKEVAYQCLQKAHYAYTVLTESGKYKPAFNKPFFMEFALKTDKDVAE
FT                   INKKLLEEGILGGYDLQRDYEKYKNVMLLAFTEKRTKEEIDRLKSLLEVM"
FT   regulatory      complement(310053..310057)
FT                   /gene="GcvP"
FT                   /locus_tag="TTE0293"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(310059..311378)
FT                   /gene="GcvP2"
FT                   /locus_tag="TTE0294"
FT                   /note="Pfam match to entry GDC-P, Glycine cleavage system
FT                   P-protein, score 648, E-value 5.00E-191"
FT   gene            complement(311393..311787)
FT                   /gene="GcvH2"
FT                   /locus_tag="TTE0295"
FT   CDS_pept        complement(311393..311773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GcvH2"
FT                   /locus_tag="TTE0295"
FT                   /product="Glycine cleavage system H protein
FT                   (lipoate-binding)"
FT                   /note="Best Blastp hit = gi|12585225|sp|Q9K786|GCSH_BACHD
FT                   PROBABLE GLYCINE CLEAVAGE SYSTEM H PROTEIN
FT                   gi|10176107|dbj|BAB07203.1| (AP001518) glycine cleavage
FT                   system protein H [Bacillus halodurans], score 142, E-value
FT                   1.00E-33"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23591"
FT                   /db_xref="GOA:Q8RCW0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCW0"
FT                   /protein_id="AAM23591.1"
FT                   /translation="MEVLEGLYYSKDHEWVKVEGDKVYIGITDYAQHSLGNIVYVELPE
FT                   VGSELSAGDVLGVVESVKAASDVYTPVDIKVLEVNNSLVEDPSLINNDPYGSWMVIAEL
FT                   KDKSQLDKLMKADEYRKFLEEE"
FT   misc_feature    complement(311396..311755)
FT                   /gene="GcvH2"
FT                   /locus_tag="TTE0295"
FT                   /note="Pfam match to entry GCV_H, Glycine cleavage
FT                   H-protein, score 201.6, E-value 1.20E-56"
FT   regulatory      complement(311783..311787)
FT                   /gene="GcvH2"
FT                   /locus_tag="TTE0295"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(311786..312910)
FT                   /gene="GcvT"
FT                   /locus_tag="TTE0296"
FT   CDS_pept        complement(311786..312910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GcvT"
FT                   /locus_tag="TTE0296"
FT                   /product="Glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /note="Best Blastp hit = gi|11132403|sp|Q9K934|GCST_BACHD
FT                   PROBABLE AMINOMETHYLTRANSFERASE (GLYCINE CLEAVAGE SYSTEM T
FT                   PROTEIN) gi|10175437|dbj|BAB06535.1| (AP001516)
FT                   aminomethyltransferase [Bacillus halodurans], score 447,
FT                   E-value 1.00E-125"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23592"
FT                   /db_xref="GOA:Q8RCV9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCV9"
FT                   /protein_id="AAM23592.1"
FT                   /translation="MKGCDSLDNLKKTPLYEIYPKYNAKIIDFAGWAMPVQFESIISEH
FT                   EAVRNAAGLFDVSHMGEIIVKGKDAFPFLQNLLTNDLSKLNDNQVLYTFMCNHNGGVID
FT                   DLLVYKYSNNYYLLVVNAANIEKDYKWMLNNAGIYKVEIENVSDKIAELAIQGPKAEEI
FT                   LQKLTDEDLSQIKFFYFKDKVKIAGVECLVSRTGYTGEDGFEIYMPNEHAVTLWEKILE
FT                   AGKDYGLKPAGLGARDTLRFEAGLPLYGNELGEDITPLEAGLGFFVKFDKGNFIGKDAL
FT                   LKQKEQGLKRKLVGFEMIGNGIPRHGYEVQADNQKIGYVTTGYFSPTLKKNIGLALIDS
FT                   KYAQIGNQIEVIIRNKPLKAVIVDKNFYKKNYKK"
FT   misc_feature    complement(311801..312751)
FT                   /gene="GcvT"
FT                   /locus_tag="TTE0296"
FT                   /note="Pfam match to entry GCV_T, Glycine cleavage
FT                   T-protein (aminomethyl transferase), score 558.5, E-value
FT                   4.40E-164"
FT   gene            313264..314257
FT                   /gene="LplA"
FT                   /locus_tag="TTE0297"
FT   regulatory      313264..313268
FT                   /gene="LplA"
FT                   /locus_tag="TTE0297"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        313277..314257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LplA"
FT                   /locus_tag="TTE0297"
FT                   /product="Lipoate-protein ligase A"
FT                   /note="Best Blastp hit = gi|7428506|pir||G69830
FT                   lipoate-protein ligase homolog yhfJ - Bacillus subtilis
FT                   gi|2226243|emb|CAA74531.1| (Y14083) hypothetical protein
FT                   [Bacillus subtilis] gi|2633361|emb|CAB12865.1| (Z99109)
FT                   similar to lipoate-protein ligase [Bacillus subtilis],
FT                   score 329, E-value 4.00E-89"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23593"
FT                   /db_xref="GOA:Q8RCV8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV8"
FT                   /protein_id="AAM23593.1"
FT                   /translation="MLYIYNKNTNPYFNLAAEEYVLKEFKDECFMLWRNEPSIIVGKNQ
FT                   NTLAEINLDYVREHKIPVVRRLSGGGAVFHDLGNLNFTFIVNADEGGFTDFKRFAQPII
FT                   DVLRKLGVEAEFSGRNDITIDGKKISGNAQYYYKNRILHHGTLLFSSNITDLSAALKVR
FT                   PVKFEDKGVKSVSKRVANISEYLKEPITIEEFINLIMEHIKEQTGGGEMYEFTEEDLKK
FT                   INKLVEEKYGTWEWNFGSSPDYKMKHEKKFPGGTVEVNLNVEKGIIKDVKIYGDFFGKY
FT                   DISEVEDLLKGVKHSEEEVRKALSKINLQDYMANITIDNLIEVMF"
FT   misc_feature    313319..313990
FT                   /gene="LplA"
FT                   /locus_tag="TTE0297"
FT                   /note="Pfam match to entry Lipoate_A, Lipoate-protein
FT                   ligase A, score 247.7, E-value 1.60E-70"
FT   repeat_region   314278..315870
FT                   /note="TLR008, identity:92%, copy 2"
FT   gene            314372..315788
FT                   /locus_tag="TTE0298"
FT   regulatory      314372..314376
FT                   /locus_tag="TTE0298"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        314385..315788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23594"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCV7"
FT                   /protein_id="AAM23594.1"
FT                   /translation="MKKHIFEDIILQNALNFTEEVVEIFGDLLNKGMNITELVARIKEL
FT                   TDKLGRGAIEAIIEELDRIIKEDKRRKEKWVVERKDKKRLTTVLGDIEYERTYYKSKED
FT                   GRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEESYERSSKKACPEELSKQTVLNAIRE
FT                   IGEVEVKREIKEKKEVRGLYIEADEDHVPLQDGRDETPRLVYIHEGREEKNGRNVLKNV
FT                   YYKAYVGEKPEDIWIDVANYIEDNYKEEKIEKIYIAGDGAPWIKEGLKWILKSRFVLDR
FT                   YHLNKYVLKATSKEPKYRDKIWRAINEGDKEGVKKVFDELIKAAEEEREKEKIKEAKKY
FT                   ILNNWEGIKIYSEDEDVIGCSAEGHISHVFSARLSRNPLGWSREGLKLMAKLRVFSKNG
FT                   GDLREVEWGKKKNINAGSYKLTKKQIKEAVRRVKTSTNEKINNITVLNIGKVTPIYRVL
FT                   RALKYAQVI"
FT   gene            316041..316386
FT                   /locus_tag="TTE0299"
FT   regulatory      316041..316045
FT                   /locus_tag="TTE0299"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        316054..316386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|140169|sp|P27749|YAC7_ALCEU
FT                   HYPOTHETICAL 11.9 KD PROTEIN IN ACOC 3'REGION (ORF 7)
FT                   gi|141897|gb|AAA21951.1| (M66060) ORF 7 [Ralstonia
FT                   eutropha], score 80.5, E-value 6.00E-15"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23595"
FT                   /db_xref="GOA:Q8RCV6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV6"
FT                   /protein_id="AAM23595.1"
FT                   /translation="MANLDMKDLERIMGEMGKEIPEVMRAFNQLHHAATKNGALSAKEK
FT                   ELIALGIAVAIRCSYCILAHVNSALQAGATKEEIMETLGVAVLMSGGPGVAYATEAIKV
FT                   LEQAVK"
FT   misc_feature    316078..316365
FT                   /locus_tag="TTE0299"
FT                   /note="Pfam match to entry CMD, Carboxymuconolactone
FT                   decarboxylase, score 112.2, E-value 9.80E-30"
FT   gene            316436..316893
FT                   /locus_tag="TTE0300"
FT   regulatory      316436..316440
FT                   /locus_tag="TTE0300"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        316450..316893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7518295|pir||C75173
FT                   hypothetical protein PAB2001 - Pyrococcus abyssi (strain
FT                   Orsay) gi|5457976|emb|CAB49466.1| (AJ248284) hypothetical
FT                   protein [Pyrococcus abyssi], score 55.8, E-value 3.00E-07"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23596"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV5"
FT                   /protein_id="AAM23596.1"
FT                   /translation="MAIETFKAVSRKLPEGLAVESEVRGFKIVLDEPKELGGTNKGMNP
FT                   VEALLCALGSCQTIVASAFAKAKGIDLQDFWVELEGDLDTDGFMGKPGVRPGFQEIRFK
FT                   MHIKSNSPKEKIEEFVKFIENTCPVGDSLANPVRLVLSDVVIE"
FT   gene            316984..318163
FT                   /gene="AvtA"
FT                   /locus_tag="TTE0301"
FT   regulatory      316984..316988
FT                   /gene="AvtA"
FT                   /locus_tag="TTE0301"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        316997..318163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AvtA"
FT                   /locus_tag="TTE0301"
FT                   /product="PLP-dependent aminotransferases"
FT                   /note="Best Blastp hit = gi|10175973|dbj|BAB07069.1|
FT                   (AP001518) aspartate aminotransferase [Bacillus
FT                   halodurans], score 398, E-value 1.00E-110"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23597"
FT                   /db_xref="GOA:Q8RCV4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV4"
FT                   /protein_id="AAM23597.1"
FT                   /translation="MNFEDRIAKRAKAIEISTIRYFFNMAREVEGAISLAIGEPDFITP
FT                   EHIRNAAKKALDEGMTGYTVNAGLIELRREIADYLKRRYSLYYDPEKEILVTIGATEAI
FT                   YVTLSTLAEEGDEVLIPEPSFVAYHPCTVIAGAKSVFVPTYEEDDFILRADVLEKYITE
FT                   RSKVLILPYPNNPTGAVMPKEALEEIAKVVEKHDLIVVTDEIYSELVYGGFKHTSFASL
FT                   PGMWERTITINGFSKSYAMTGWRLGYIAAPEHFTKHIAKLHQYAVTAAATMCQYAGIEA
FT                   MRNGDEDIIKMREEYDKRRKFLLESVREMGLSCFEPKGAFYIFPSIKTTGLTSMEFAKR
FT                   LLYEAKVAVVPGNAFGEHGEGYVRLAYATSMENLEEAVKRMKEFMAKL"
FT   misc_feature    317006..318157
FT                   /gene="AvtA"
FT                   /locus_tag="TTE0301"
FT                   /note="Pfam match to entry aminotran_1, Aminotransferase
FT                   class-I, score 255.6, E-value 6.80E-73"
FT   gene            318306..320402
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT   regulatory      318306..318310
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        318321..320402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /note="Best Blastp hit = gi|10172832|dbj|BAB03939.1|
FT                   (AP001507) BH0220; unknown conserved protein [Bacillus
FT                   halodurans], score 308, E-value 1.00E-82"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23598"
FT                   /db_xref="GOA:Q8RCV3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV3"
FT                   /protein_id="AAM23598.1"
FT                   /translation="MMKLINSNEPIKISELAKLFNVSSRTIRYDLDAIDEFLKYNNLPQ
FT                   LIRKPNVGVKFSELLEHRNKALSFLDTLSPYYYNLSQKERVNVILSELIQQRDYITINT
FT                   LAEKLMVSRSTVISDLKKVKEWLEERGLYLKALPKYGVKVVGDEKQLRRAAIELLTEAI
FT                   DIDKALDIVKAPFYGRSLGGSGQIAKLFEDIDIPYIEQCVQIAERELETIFSDAAFSGL
FT                   VIHIAIAIKRIQLGKDIVMPKEELKALEMTKEFAVASNIAKMLEDRFNVSIPVDEIGYI
FT                   TIHLLGSNVAKPKTYLNENWIEYQLLTEKIIRNVSERIKENLLEDQQLFEGLLDHLRPT
FT                   IYRLKHDLKLKNPILDEIKTNYRELFEIVRESLKPIEEYTGRNLNEEEIGYFVIHFGAA
FT                   IERKKTAISIKPNVLVVCSTGIGTAKLLSSRLQSVFDVHIIDTIAFHQIKEVLKDKKID
FT                   LIVSTIPLKCDEVKVVEVNPLLTDRDIEKLSKFLAKPLERRLDVVDELMEIINRHCVIK
FT                   DREKLLEDLLIFFNIASYENRRGVVHPVLKDLLTKDTIKLNVEAKDWEEAVRIGGELLV
FT                   KNGFAEPQYVEAMINTVKEMGPYIVIAPGIAMPHARPEAGARKIGMSLITLKNPVNFGN
FT                   KENDPVKIVVSLCAIDHSSHLKALSELVELLGDEEFVEAVLNANDVDRVLKLLGKEKV"
FT   misc_feature    318906..319184
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT                   /note="Pfam match to entry BglG_antitermin, Transcriptional
FT                   antiterminator bglG family, score 63.3, E-value 5.10E-15"
FT   misc_feature    319224..319517
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT                   /note="Pfam match to entry BglG_antitermin, Transcriptional
FT                   antiterminator bglG family, score 44.8, E-value 1.90E-09"
FT   misc_feature    319962..320393
FT                   /gene="PtsN4"
FT                   /locus_tag="TTE0303"
FT                   /note="Pfam match to entry PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 186.5, E-value 4.30E-52"
FT   gene            320411..321702
FT                   /gene="SgaT"
FT                   /locus_tag="TTE0304"
FT   regulatory      320411..320415
FT                   /gene="SgaT"
FT                   /locus_tag="TTE0304"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        320425..321702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SgaT"
FT                   /locus_tag="TTE0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10172835|dbj|BAB03942.1|
FT                   (AP001507) BH0223; unknown conserved protein [Bacillus
FT                   halodurans], score 273, E-value 3.00E-72"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23599"
FT                   /db_xref="GOA:Q8RCV2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV2"
FT                   /protein_id="AAM23599.1"
FT                   /translation="MWLIDFLVKNIFNQVAVLIGLVTLIGLVLQKKSFEDTISGTIKSM
FT                   VGILIMLAGVDVFIGGLVSFQTIVSSAFHISPPTAQNTLQNFTNNFGSVAVSIMALGFL
FT                   IHLLIVRIFNTGFVYLTGHLMWWISLVISASLLEVFPRINQGVLILVGSILIALYWTFQ
FT                   PMYVHKYMKKVTNSDEIGYGHTSSIAAYLAGRFGHLLGKPEESTEKMKVPKKIEFMKDI
FT                   TVGTAFIITIIMLIASFFAEREVVVKQAGDLNFVMWSIIQGFKFAAGITILLYGVRLFL
FT                   AEIIPAFRGISQKLIPGARPALDVPVVFPYAPTAVLIGFISSTLVFLIFMVIFGLTGFA
FT                   TIVPSMIMLFFPAAGAAVFGNAVGGWKGAVLGGAINGLFLAFGQALTWPMLGNTAPELA
FT                   VLADPDWYVIIWLIIGVGKLIKLVIG"
FT   gene            321716..322041
FT                   /gene="SgaB"
FT                   /locus_tag="TTE0305"
FT   regulatory      321716..321720
FT                   /gene="SgaB"
FT                   /locus_tag="TTE0305"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        321730..322041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SgaB"
FT                   /locus_tag="TTE0305"
FT                   /product="Phosphotransferase system component IIB of
FT                   unknown specificity"
FT                   /note="Best Blastp hit = gi|13469797|gb|AAK27336.1|
FT                   (AF286670) unknown [Escherichia coli], score 66.2, E-value
FT                   1.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23600"
FT                   /db_xref="GOA:Q8RCV1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCV1"
FT                   /protein_id="AAM23600.1"
FT                   /translation="MSEKIKIVTACGVGMGSSLILKMMIEDILKELGISAIVEHSDIGS
FT                   VKATGADILVVQTFHKEKVEGDAKVVVAIDDFFNKEKLKEKIVNALDELRKFGNKGEV"
FT   gene            322031..322785
FT                   /locus_tag="TTE0306"
FT   regulatory      322031..322035
FT                   /locus_tag="TTE0306"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322045..322785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10172839|dbj|BAB03946.1|
FT                   (AP001507) BH0227; unknown [Bacillus halodurans], score
FT                   196, E-value 2.00E-49"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23601"
FT                   /db_xref="GOA:Q8RCV0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR022951"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCV0"
FT                   /protein_id="AAM23601.1"
FT                   /translation="MLDLYIEEIYKRIEKIKSTQLEKIKQAAHLITESLISEDSVFHVF
FT                   GCGHSHMAAEELFYRAGGLACVNAILPSELMLHEGALKSSYYERNEEIIKLIFDRYELR
FT                   KGECIIIVSHSGRNGAPVEAAIDAKRRGLHVVALTSTEYKQKTFSRHSSGKFLEDVADI
FT                   VIDNCGPYGDAVLTVEKEDIKISFSPLSTVLNTVILNMLEAEIITNMLEKNMSPPVFLS
FT                   GNIEGAEEHNLKLIEKYKKRLRHL"
FT   regulatory      322845..322862
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            322975..324296
FT                   /locus_tag="TTE0307"
FT   regulatory      322975..322979
FT                   /locus_tag="TTE0307"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322989..324296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0307"
FT                   /product="predicted acetamidase/formamidase"
FT                   /note="Best Blastp hit = gi|7518945|pir||E71097
FT                   hypothetical protein PH1041 - Pyrococcus horikoshii
FT                   gi|3257456|dbj|BAA30139.1| (AP000004) 389aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 421,
FT                   E-value 1.00E-116"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23602"
FT                   /db_xref="GOA:Q8RCU9"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU9"
FT                   /protein_id="AAM23602.1"
FT                   /translation="MEARNVVYVDEFTDGILDPEKEMIKAVKDGGYIIANTAPGCWGPM
FT                   LTPKLKGGHEVTRPVFVENAEVGDAVAIYIEDIQVTSIATASGKEKVIEGRYISDPFVA
FT                   AKCPNCGTVYPETVIEGVGPDSIRCANCGADVVPFKFEHGYTMVLDKEENIGVTVGKEA
FT                   AEKIAANGREYMRIPHNSAQNPAVTLAPHDLVGVISRMRPFLGQLGTLPSIKMPDSHNA
FT                   GDFGTFLIGAEHEYAITKEELERHRTDGHMDINRVRKGAVVIAPVKVKGAGVYMGDMHA
FT                   MQGDGEIAGHTTDVAGIVTLRVKVLKGLKIEGPILLPNFEDLPYLARPFTEEELEKAKK
FT                   LANQWGADSLEKSYPLSFIGTGANLNEAVNNGLERAAKFLELPLPEVLNRATITGSIEI
FT                   GRLPGVVTVTFLVPVEILEKKGILDIVKKHYTKAEN"
FT   repeat_region   324398..327958
FT                   /note="TLR028, identity:99%, copy 3"
FT   gene            complement(324553..325793)
FT                   /locus_tag="TTE0309"
FT                   /note="authentic frameshift, transposase; Best Blastx hit =
FT                   dbj|BAB07760.1| (AP001520) BH4041; unknown conserved
FT                   protein in others [Bacillus halodurans], score 68.6,
FT                   E-value 2.00E-19"
FT   gene            325958..326157
FT                   /locus_tag="TTE0311"
FT   regulatory      325958..325962
FT                   /locus_tag="TTE0311"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        326005..326157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23603"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I8"
FT                   /protein_id="AAM23603.1"
FT                   /translation="MVMLLYQHATGVSQKYLSKLKRDLLLLSLSETKDHLNKNEKFNYE
FT                   IVLPG"
FT   gene            326315..327613
FT                   /locus_tag="TTE0312"
FT   regulatory      326315..326319
FT                   /locus_tag="TTE0312"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        326330..327613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0312"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 335, E-value 5.00E-91"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23604"
FT                   /db_xref="GOA:Q8RCU8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU8"
FT                   /protein_id="AAM23604.1"
FT                   /translation="MNKVQKLLLVHSSDIIFVGVDVAKKTHYARIINHIGLEVIKPFKF
FT                   NNSIDGYERLVSKILEAKEKSKATKILIGFEPSGHYWKPLAWFLKEKGYTVVIVNPYHV
FT                   KQRKEEEDNSPSKNDRKDALIIARLIKEGKFLNCLLPQNTYADLRNLSVARKQLIKKLN
FT                   SVKNKIIAILDEYFPEFEEVFKNLWGKAALWILRNCPFPSIILKLSKEEIAEQLKKATN
FT                   NRVGMKRAEKLIEAAKKSIGVKEGIKGAQIRLNIYLDELEFLKTQLETIEKAMEELLKK
FT                   IDIAEYLLSIPGIGVITVAGFLAEVGDIGKYTHYKQIQKLGGLNITDNQSRKHRGKTKI
FT                   SKRGRPELRNLLYKASLTLVAKNKEFKALYNYFLRRRENPLEKKQALIAISIKLIRVMF
FT                   TLAKKKEKYDSQKVLGEYRMKQIKELVA"
FT   misc_feature    326594..326887
FT                   /locus_tag="TTE0312"
FT                   /note="Pfam match to entry Transposase_9, Transposase,
FT                   score 52.6, E-value 8.50E-12"
FT   misc_feature    327110..327439
FT                   /locus_tag="TTE0312"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 77.9, E-value 2.10E-19"
FT   gene            327957..329142
FT                   /locus_tag="TTE0313"
FT   regulatory      327957..327961
FT                   /locus_tag="TTE0313"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        327970..329142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0313"
FT                   /product="uncharacterized oxidoreductases, Fe-dependent
FT                   alcohol dehydrogenase family"
FT                   /note="Best Blastp hit = gi|421547|pir||A47013 butanol
FT                   dehydrogenase (EC 1.1.1.-) I - Clostridium acetobutylicum,
FT                   score 365, E-value 1.00E-100"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23605"
FT                   /db_xref="GOA:Q8RCU7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU7"
FT                   /protein_id="AAM23605.1"
FT                   /translation="MKDFIFSSPTKIIFGKGTEEQVGKEVKNYSNKVLLCYGGGSIKKY
FT                   GLYDKVVKALKEEGVEFVELSGVKPNPRLGLVQEGIKLVRENNINFILAVGGGSVIDTA
FT                   KAIAMGVPYEGNVWDFFEGKAELKEALPVGVILTIPATGSEASDATVITNEDGWYKIGF
FT                   HHELLRPKFAIMNPELTYTLPPYQTACGVADIMAHIMERYFVNEEGVELTDRLCEATLK
FT                   TVINNARIVLKDPANYNARAQIMWAGTIAHNDLLNTGRGRGDWASHRIEHELSAIYDIA
FT                   HGAGLAIVFPAWMKYVYKNNINRFVQFAVKVWDVDLPYENLEEIALEGIRRTEEFFKEI
FT                   GLPVRLKEAGISDDRFEEMADKCTKGGTRTIGDFVKLNKEDIIKIYELAR"
FT   misc_feature    327994..329115
FT                   /locus_tag="TTE0313"
FT                   /note="Pfam match to entry Fe-ADH, Iron-containing alcohol
FT                   dehydrogenase, score 284.1, E-value 1.80E-81"
FT   gene            329248..331790
FT                   /gene="MrcA"
FT                   /locus_tag="TTE0314"
FT   regulatory      329248..329252
FT                   /gene="MrcA"
FT                   /locus_tag="TTE0314"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        329259..331790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MrcA"
FT                   /locus_tag="TTE0314"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /note="Best Blastp hit = gi|10174319|dbj|BAB05421.1|
FT                   (AP001512) penicillin-binding proteins 1A/1B [Bacillus
FT                   halodurans], score 353, E-value 7.00E-96"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23606"
FT                   /db_xref="GOA:Q8RCU6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU6"
FT                   /protein_id="AAM23606.1"
FT                   /translation="MDKNSDLNLKRSRRKKNSEKKKKSSIKLFFKWVGIAFLILFFAAV
FT                   GAIGGKVLAIIKNTPPISQEALTSQAQSSVVYAKDENGNWQRVAILHGADNRLWVPIEK
FT                   IPKNLQNAFVAIEDQRFYKNKLGIDPKRIIGALIADIMAGGKPVEGASTITQQLVKNTM
FT                   LSSEKTITRKIQEMVLAWRLEQIYSKQQILEAYLNTIYLGGPNVNAYGVQAASLAYFGK
FT                   DVSQLDLAECAMIAGITKNPSRYSPYADLEAATERQHLVLKKMLEQGYITKEEYEKAIS
FT                   EKLVFKKTNFTTYEHKYFIDQVINDVADALSQHLNISHDEAIKKIYNGGLRIYSTMDLQ
FT                   IQKTMEEAFKNPKLFPPDIKDRSGNTRIVQGAMVVMDWKTGEVKGIVGGRETEETKGKT
FT                   RIFNYATQGGRPAGSSIKPLTVYGPALEKGYTAATVVDDVPVFYKQWNWEPHNYESGKY
FT                   RGLMTFREALTYSENVPAARIVVEMIGLHTAAEYGKKFGLTVTKDVASSPAALALGAGG
FT                   AVTPLQEAAAYGAIANGGVYTTPITFTKVTDSKGKVILENKPSQHMVLTPQNAYILTSM
FT                   MQDVVKYGTGTNARLPNMPVAGKTGTNESYNDAWFTGFTPYYVGSVWMGTGENIPMIYG
FT                   GRGVVGGSYPAMLWRTVMAEIHKSLPYKDFERPPGIISVTVCKDSGELPTDLCHQDLRG
FT                   DRTYTEIFAEGTQPTTYCTVHVLAKINSQNGKLATEFTPPDLVKEAVFIDPPGRTPEQN
FT                   AVALDGKYVVPKDYDDTPPPAQPPSGEVLPPENTQNPPSQPPNEIQQPPGNTPPNNGGN
FT                   NGTTQNPPQNNNNNTSSNPLEKIFPPKNSKP"
FT   misc_feature    329478..330014
FT                   /gene="MrcA"
FT                   /locus_tag="TTE0314"
FT                   /note="Pfam match to entry Transglycosyl, Transglycosylase,
FT                   score 266.5, E-value 3.60E-76"
FT   misc_feature    330273..331211
FT                   /gene="MrcA"
FT                   /locus_tag="TTE0314"
FT                   /note="Pfam match to entry Transpeptidase, Penicillin
FT                   binding protein transpeptidase domain, score 98.4, E-value
FT                   1.50E-25"
FT   gene            331873..333059
FT                   /locus_tag="TTE0315"
FT   regulatory      331873..331877
FT                   /locus_tag="TTE0315"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        331887..333059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|13881463|gb|AAK46089.1|
FT                   (AE007041) hypothetical protein [Mycobacterium tuberculosis
FT                   CDC1551], score 68.9, E-value 1.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23607"
FT                   /db_xref="GOA:Q8RCU5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU5"
FT                   /protein_id="AAM23607.1"
FT                   /translation="MKDSRKYLEELVQFRHRGSATKNERQAAEYILRELERMGYKVERQ
FT                   TFKTTRDNLYMLPLQVAILLFISALLSLMYGGIVNALAFFLSIFGIMLLLLEVSGIPVE
FT                   TSIMPRFLSQNIFTKFDESKEKRIIVSAHYDTQRASVMFHPKIVDYLGLIYNISYVGFG
FT                   LVPIGILFNVFKFQPLGTVFLIIGLIIVTANIIFMALCEITGKYTQGANDNGTGVALAL
FT                   ALAEYYINHKDEFPGNVDVVFLFTGSEETGERGMKHFIKRYAKSLPKDTQFIILDNLGT
FT                   GKITYLEGEGMIFYKKAGKMLLDIAEEMQKGYSGKVQRMKNLLLPTDALPVMAAGFDAI
FT                   AFLAKDEKGRLGNYHWHTDTIENVDIDLLLYEEEFFKEYLMKVARELEKR"
FT   gene            333248..333842
FT                   /gene="AcrR2"
FT                   /locus_tag="TTE0316"
FT   regulatory      333248..333252
FT                   /gene="AcrR2"
FT                   /locus_tag="TTE0316"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        333258..333842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcrR2"
FT                   /locus_tag="TTE0316"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|10174583|dbj|BAB05684.1|
FT                   (AP001513) transcriptional regulator (TetR/AcrR family)
FT                   [Bacillus halodurans], score 107, E-value 1.00E-22"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23608"
FT                   /db_xref="GOA:Q8RCU4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU4"
FT                   /protein_id="AAM23608.1"
FT                   /translation="MGDSVKEKIVVSTLKLISEKGYRSTTTRNIAEEAGVNEVTIFRCF
FT                   RSKKDIVLYALKELELLKPMDKKILEKCKWDLKEDLLMLAEEYHKNFTEDKAKIMIGLR
FT                   SPEIFEEVKEYLIRIPKGFKDVLIEYFKIMYQKGMLNNDDFELLAFSFLSLNFGFILMK
FT                   ASYGRKLIGFSNDEFVRRSIEIFVKGIAKSS"
FT   misc_feature    333282..333422
FT                   /gene="AcrR2"
FT                   /locus_tag="TTE0316"
FT                   /note="Pfam match to entry tetR, Bacterial regulatory
FT                   proteins, tetR family, score 54.3, E-value 1.80E-12"
FT   gene            333881..334877
FT                   /locus_tag="TTE0317"
FT   regulatory      333881..333885
FT                   /locus_tag="TTE0317"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        333894..334877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7462035|pir||A72369
FT                   (R)-2-hydroxyglutaryl-CoA dehydratase activator-related
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   gi|4980993|gb|AAD35567.1|AE001726_1 (AE001726)
FT                   (R)-2-hydroxyglutaryl-CoA dehydratase activator-related
FT                   protein [Thermotoga maritima], score 97.8, E-value
FT                   2.00E-19"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23609"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU3"
FT                   /protein_id="AAM23609.1"
FT                   /translation="MKIGIPKALMYYFYYPFWKTLFESLGFEVVTSDDTSKSILDIGVK
FT                   EAVAEICLPMKVYTGHVLNLLEKGVDYIYVPRFVSLRKGIFMCPKFMGLPDMIKGLFDR
FT                   IEDKILTHHIVSKTLDISEFHNYTIFIEKFGIGKKDLKKALAKAREEWLKFRRLNKEGY
FT                   DINELLTSNKPQKYDGDITIGLLGYVYNVYDRFVNMDIFSVFRRLNVKVVTFDMMDEKV
FT                   IYKNLRNFGKNMFWEFTNMLLGTAYEFMKRDDIDGIIHLTAFGCGPDSILEPFLTIDSE
FT                   KNKKPFMTIRIDEQTGESHVITRVEAFTDLIRMKKYKAEEKAKGVV"
FT   gene            334865..335976
FT                   /locus_tag="TTE0318"
FT   regulatory      334865..334869
FT                   /locus_tag="TTE0318"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        334879..335976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit =
FT                   gi|12725306|gb|AAK06336.1|AE006452_9 (AE006452) conserved
FT                   hypothetical protein [Lactococcus lactis subsp. lactis],
FT                   score 66.6, E-value 5.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23610"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU2"
FT                   /protein_id="AAM23610.1"
FT                   /translation="MKITFPYMGSPYMYEKLFTLLGHEVITPPRPSQKTVDYGVKYSPE
FT                   FACFPLKVILGTYLEALEMGADTIVTSGGNGPCRAGYYGEAQKKILKNMGYDVEFIIFD
FT                   EPKKDIKTFMDNVKKIKGKNSWGKVLKVAKIVYDMAKSMDKVEKIVEVKRAYECNRGEF
FT                   TRAWHEIMEEYRKIESSEDVRRVEKEAIERLNSIKVCEVPEEEKIRIGIVGEIYVVMEP
FT                   SINGNIEEVLNTYGAEVERSHYISEWIDFNLIPLPSYKEKEHQILKKGEKYIEIIIGGH
FT                   AKQSVGAIIDFMDRGFDGVIHLKPFGCLPELITESAINKIKREYDYPILTLSIDEQMAI
FT                   ANTLTRIEAFLDVIRLKKRKKRIVR"
FT   gene            335983..336945
FT                   /locus_tag="TTE0319"
FT   CDS_pept        335983..336945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0319"
FT                   /product="Activator of 2-hydroxyglutaryl-CoA dehydratase
FT                   (HSP70-class ATPase domain)"
FT                   /note="Best Blastp hit = gi|7462035|pir||A72369
FT                   (R)-2-hydroxyglutaryl-CoA dehydratase activator-related
FT                   protein - Thermotoga maritima (strain MSB8)
FT                   gi|4980993|gb|AAD35567.1|AE001726_1 (AE001726)
FT                   (R)-2-hydroxyglutaryl-CoA dehydratase activator-related
FT                   protein [Thermotoga maritima], score 182, E-value 7.00E-45"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23611"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCU1"
FT                   /protein_id="AAM23611.1"
FT                   /translation="MEKVYIGVDVGSVSIKVVAIDNDNNILFRSYVRNVGQPIDIVKEE
FT                   LKKLHNELPDKEIGGVGVTGSGRQLIGYVLGADVVKNEITAHATATIYFHPDVSTIFEI
FT                   GGQDSKLIIINDGTIADFAMNTVCAAGTGSFLDHQAQRLGIKIEEFGEIALTAKREVRI
FT                   AGRCTVFAESDMISKQQYGFSKAEILKGLSKALVRNYMNNLVRGRELKPAFVFQGGVAA
FT                   NIAIRKAFEEEVGHEVIVPKHYDIMGAIGIAMIAKEEVKRTGRPTKFKGFDVSGEKFET
FT                   TTFICKACPNECEIIQIKANGKIIAMTGDRCGRYSNSVI"
FT   misc_feature    335992..336747
FT                   /locus_tag="TTE0319"
FT                   /note="Pfam match to entry BcrAD_BadFG, BadF/BadG/BcrA/BcrD
FT                   ATPase family, score 218.1, E-value 1.30E-61"
FT   gene            337036..337768
FT                   /gene="PstB"
FT                   /locus_tag="TTE0320"
FT   regulatory      337036..337040
FT                   /gene="PstB"
FT                   /locus_tag="TTE0320"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337049..337768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PstB"
FT                   /locus_tag="TTE0320"
FT                   /product="ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|11277302|pir||G81409 probable
FT                   phosphate transport ATP-binding protein Cj0616 [imported] -
FT                   Campylobacter jejuni (strain NCTC 11168)
FT                   gi|6968083|emb|CAB75252.1| (AL139075) putative phosphate
FT                   transport ATP-binding protein [Campylobacter jejuni], score
FT                   189, E-value 4.00E-47"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23612"
FT                   /db_xref="GOA:Q8RCU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCU0"
FT                   /protein_id="AAM23612.1"
FT                   /translation="MEIELKNVNYFRDGKYILKNVYFKFEKNGIYTVVGPSGAGKSTML
FT                   KLINRLIEPTEGAIFINGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLRG
FT                   EKNIDALFYLEAVGLSKDYLFKDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDP
FT                   TSTSIIEELIKRLNREGIMVILVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFENPV
FT                   SEVSKLFLEGKLKEMIK"
FT   misc_feature    337130..337666
FT                   /gene="PstB"
FT                   /locus_tag="TTE0320"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   219.2, E-value 6.10E-62"
FT   gene            337752..338517
FT                   /locus_tag="TTE0321"
FT   regulatory      337752..337756
FT                   /locus_tag="TTE0321"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337765..338517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0321"
FT                   /product="predicted permease"
FT                   /note="Best Blastp hit = gi|3915949|sp|P77307|YBBM_ECOLI
FT                   HYPOTHETICAL 28.2 KDA PROTEIN IN USHA-TESA INTERGENIC
FT                   REGION, score 236, E-value 2.00E-61"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23613"
FT                   /db_xref="GOA:Q8RCT9"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT9"
FT                   /protein_id="AAM23613.1"
FT                   /translation="MSTSSLIFASSLVFVAIFISYYQKLGIEKEIIIGTARAVFQLMVV
FT                   GYILHYIFSANNALFTLAMVAVMILVAGHNASKRGKEIPGIFYYVTFSIAVSAAVTLSL
FT                   LILFGNIKFEPQQVIPVSGMIIGNSMVASGLSVSRLKDEIKNRQEEIEAYLALGATSRQ
FT                   AAQKVIKMSIKTGMMPTVDSMKTLGIVQLPGMMTGLILGGVDPITAVKYQIMVTFMLAS
FT                   TVAISCFTVTFLTYRTFFTKQHQLRQAF"
FT   gene            complement(338530..340480)
FT                   /gene="TolB"
FT                   /locus_tag="TTE0322"
FT   CDS_pept        complement(338530..340467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TolB"
FT                   /locus_tag="TTE0322"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /note="Best Blastp hit = gi|12721292|gb|AAK03051.1|
FT                   (AE006136) TolB [Pasteurella multocida], score 60.1,
FT                   E-value 8.00E-08"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23614"
FT                   /db_xref="GOA:Q8RCT8"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT8"
FT                   /protein_id="AAM23614.1"
FT                   /translation="MDEKRIEENLNRLKELIPVNYQLKESLKKRFKRNRWKKIGVAIIA
FT                   AAAILLMVFSFGIKNLQDNLITKVNAEELKIINQISFISLGNINAGKIAEYNGTIYIPL
FT                   YDKGIYKYDNKGFKKIIDKTSGEVGISPDGTKLVFTTRTSDGKNAIYIKDLKTGKETKI
FT                   IESKDRDTYYSDPGFSPDGNKVIYTEQIIVPRETHGFEVKESNINAIDLKSLKVTKLAD
FT                   GSCGSFVKTEDAIVFERDNKIIYKNLKDGSEKIIDEGKNPSVSPNGYYIAYEKYEPKKE
FT                   KVEDMNVTVSMNNIWIADAASFTTKKQVTLNVPKRIPPEVLKEKIQNYVTSSLYTYYWP
FT                   VWSSDSKSIFVLKNLNEDIRGNTMQLMKIELSREELTPEEVVKKFLQAIIVRDEDFARV
FT                   LMKNPPQMMTMSNPHPVAYEILGSGTEDGKPYVDASLTYGYIMNGYCSVNKSRYYLSPD
FT                   SNGYIIDSIKDLGTVEFIEKNGTFYKIENNVETKLFDSGEIPKEILPDNLNTHSTTLTY
FT                   SPKTNTIFFTMQTNDRSQSRIISYDISHRAFKLIDSLENTIIPDIKVDSSGKYLAVLAY
FT                   NDTSQQSNTYVYNLKTGEREDLRSRFEDTKIEEISPQFWQQDKLIFQISLKEGFLYYVY
FT                   DPYKGQVLIP"
FT   gene            complement(340470..340972)
FT                   /gene="RpoE"
FT                   /locus_tag="TTE0323"
FT   CDS_pept        complement(340470..340958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoE"
FT                   /locus_tag="TTE0323"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunits, sigma24 homologs"
FT                   /note="Best Blastp hit = gi|3025463|gb|AAC12856.1| (U58131)
FT                   SigX [Clostridium acetobutylicum], score 84, E-value
FT                   1.00E-15"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23615"
FT                   /db_xref="GOA:Q8RCT7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT7"
FT                   /protein_id="AAM23615.1"
FT                   /translation="MPESFIEFYEKNFDDVYRYVYFKVGNKWDADDIVSETFQKAFEKY
FT                   NTVKSNSKAWIFSIARNTVTDYYRMRKNLVSEELIMEHFYPDVFEDKLEREVELDCLKK
FT                   SLYSLSKEEIEIVNLKYFANMTHREISQLIEKTEEAVKAQAYRIIQKLKNLVIKCLEG"
FT   regulatory      complement(340476..340480)
FT                   /gene="TolB"
FT                   /locus_tag="TTE0322"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(340746..340907)
FT                   /gene="RpoE"
FT                   /locus_tag="TTE0323"
FT                   /note="Pfam match to entry Sigma70_ECF, Sigma-70 factor
FT                   (ECF subfamily), score 35.5, E-value 1.20E-06"
FT   regulatory      complement(340968..340972)
FT                   /gene="RpoE"
FT                   /locus_tag="TTE0323"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            341338..343797
FT                   /gene="LeuS"
FT                   /locus_tag="TTE0324"
FT   CDS_pept        341338..343797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuS"
FT                   /locus_tag="TTE0324"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /note="Best Blastp hit = gi|6919980|sp|Q9WY15|SYL_THEMA
FT                   LEUCYL-TRNA SYNTHETASE (LEUCINE--TRNA LIGASE) (LEURS)
FT                   gi|7437543|pir||F72408 leucine--tRNA ligase (EC 6.1.1.4) -
FT                   Thermotoga maritima (strain MSB8)
FT                   gi|4980663|gb|AAD35261.1|AE001702_1 (AE001702) leucyl-tRNA
FT                   synthetase [Thermotoga maritima], score 840, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23616"
FT                   /db_xref="GOA:Q8RCT6"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCT6"
FT                   /protein_id="AAM23616.1"
FT                   /translation="MEDMAYSVEIDRKWQKIWEETKLYKFNPENVDKKLYCLEMFPYPS
FT                   GAKLHIGHWYNYGPTDSWARMKRMQGYEVFHPMGFDAFGLPAENYAIKTGIHPYDSTME
FT                   NIRTMERQLREMGVTFDWDYEIITCLPEYYKWTQWIFLKLYEAGLAYRKKAPVNWCPSC
FT                   QTVLANEQVIDGKCERCGTEVTKKELTQWFFKITAYAEELLEKLDDLDWPEKTKMMQRN
FT                   WIGKSEGAEIEFKIDGKDLSFRVFTTRADTLFGATYVVLAPEHELVDLITTEEYKEAVE
FT                   EYKEYAKKQSEIERLSTEKEKTGVFTGAYAIHPLTGEKLPIWIADYVLVTYGTGCVMGV
FT                   PGHDERDYEFATKYNLPIKRVIKGVGDVDDSLPFVEYGILVNSEEFTGMTSEEARVKIV
FT                   EKLKAEGKAEFKVNYRMRDWLVSRQRYWGAPIPIIHCERCGIVPVPEEDLPVLLPYDVE
FT                   FEPTGESPLKKHAGFMNVTCPKCGGPALRDPDTLDTFVDSSWYYLRYPDNKNDKEPFNK
FT                   EWINKMLPVDKYVGGAEHATMHLLYSRFITKVLRDLGYLNFDEPFLSLVHQGTILGPDG
FT                   SRMSKSRGNVISPDDYIKQYGSDVFRLYLMFGFSYSEGGPWSDEGIKAIARFVNRVERF
FT                   IEKFIETRQNPGKTKEEMEDAEKELNYVRHYTIKHVTLDADKFEFNTAIARIMELVNAL
FT                   YKYENEVEVKNMKFYEDVVRDFVKILAPFAPHFSEEMWERLGYEYSVFNQKWPEWDEKA
FT                   LERDMIEIAIQVNGKVRSKAQVPSNATDEELKQIALSDERVKSYLDGKEIKKVIIVKNR
FT                   LVNIVVN"
FT   misc_feature    341374..343374
FT                   /gene="LeuS"
FT                   /locus_tag="TTE0324"
FT                   /note="Pfam match to entry tRNA-synt_1, tRNA synthetases
FT                   class I (I, L, M and V), score 516.3, E-value 2.20E-151"
FT   regulatory      343794..343820
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            343843..344198
FT                   /locus_tag="TTE0325"
FT   regulatory      343843..343847
FT                   /locus_tag="TTE0325"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        343857..344198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0325"
FT                   /product="predicted nucleotidyltransferases"
FT                   /note="Best Blastp hit = gi|11499885|ref|NP_071129.1|
FT                   conserved hypothetical protein [Archaeoglobus fulgidus]
FT                   gi|7483238|pir||H69537 conserved hypothetical protein
FT                   AF2304 - Archaeoglobus fulgidus gi|2648220|gb|AAB88956.1|
FT                   (AE000945) conserved hypothetical protein [Archaeoglobus
FT                   fulgidus], score 55.8, E-value 2.00E-07"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23617"
FT                   /db_xref="GOA:Q8RCT5"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT5"
FT                   /protein_id="AAM23617.1"
FT                   /translation="MKAEAVIDSIVKKLVETIDPKAIILFGSLAKGKNHENSDIDLLIV
FT                   WDEEEGLNNTQRRIKLRKLLGFVEVPIDILTCTSEELKEAMKDDKSFTANIVKEGKVIY
FT                   GRLNPKVSC"
FT   misc_feature    343875..344168
FT                   /locus_tag="TTE0325"
FT                   /note="Pfam match to entry NTP_transf_2,
FT                   Nucleotidyltransferase domain, score 49.6, E-value
FT                   6.90E-11"
FT   gene            344366..345477
FT                   /gene="RbsK2"
FT                   /locus_tag="TTE0326"
FT   regulatory      344366..344370
FT                   /gene="RbsK2"
FT                   /locus_tag="TTE0326"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        344380..345477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RbsK2"
FT                   /locus_tag="TTE0326"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /note="Best Blastp hit = gi|2507177|sp|P33020|YEII_ECOLI
FT                   HYPOTHETICAL SUGAR KINASE IN NFO-FRUA INTERGENIC REGION
FT                   gi|7449503|pir||G64984 yeiI protein - Escherichia coli
FT                   (strain K-12) gi|1788484|gb|AAC75221.1| (AE000305) putative
FT                   kinase [Escherichia coli K12], score 223, E-value 4.00E-57"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23618"
FT                   /db_xref="GOA:Q8RCT4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT4"
FT                   /protein_id="AAM23618.1"
FT                   /translation="MALTQREKEILRLIKKNPMISQEELAKMLGISRSAVAGHIANLMK
FT                   KGFILGRGYVVRDLKGVTVIGGANIDIKGKPYKELRQHTSNPGHINIAPGGVGRNIAHN
FT                   LAQLNVPVTFLSVVGNDDEGRRLLEETRQAGVNVEQVVISNTRRTGIYLAILNAIGDMD
FT                   IALSGMDILEELNIQYLESKTEVIKNSEIVVFDANIPEESIRYITELCYNNNIPVVVEP
FT                   VSIDKAKKLKNVLDKIDYITPNKEELESITEIKILDDEDMKKAVKYLRDKGIKNVIVTL
FT                   GERGVYVSSEELEKFIEPYQTEIVDATGAGDALTAGLVYGIFNGYSLEVSAKLGLAAAS
FT                   LTISSPYTVNPFLNENQLKNIVKEI"
FT   misc_feature    344554..345444
FT                   /gene="RbsK2"
FT                   /locus_tag="TTE0326"
FT                   /note="Pfam match to entry pfkB, pfkB family carbohydrate
FT                   kinase, score 230.3, E-value 2.80E-65"
FT   gene            345467..346404
FT                   /gene="IndA"
FT                   /locus_tag="TTE0327"
FT   regulatory      345467..345471
FT                   /gene="IndA"
FT                   /locus_tag="TTE0327"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        345481..346404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IndA"
FT                   /locus_tag="TTE0327"
FT                   /product="uncharacterized enzyme involved in pigment
FT                   biosynthesis"
FT                   /note="Best Blastp hit = gi|13700227|dbj|BAB41525.1|
FT                   (AP003130) conserved hypothetical protein [Staphylococcus
FT                   aureus] gi|13874627|dbj|BAB45873.1| (AP003359) conserved
FT                   hypothetical protein [Staphylococcus aureus], score 337,
FT                   E-value 9.00E-92"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23619"
FT                   /db_xref="GOA:Q8RCT3"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCT3"
FT                   /protein_id="AAM23619.1"
FT                   /translation="MNRFIDLSEEVKSALEERRPVVALESTIISHGMPYPQNIETARAL
FT                   EEIVRENGAVPATIAIIGGKIKIGLNEEELEFMGTSKEILKASKRDLPVVLAKGLNAAT
FT                   TVSATMICANLAGIKVFVTGGIGGVHRGAEETFDISADLQELANTNVAVVCAGAKAILD
FT                   LPRTLEYLETFGVPVIGFRTEEFPAFYTRESGLKVDYRVEDEVEAAKVIKTKWDLGLKG
FT                   GILIANPIPEEYALDRAYIEKAIEEAIFEADRRGIRGKALTPFLLEKIKDLTEGKSLKA
FT                   NIELVKNNARVGAKIAVQLNKLYKEA"
FT   regulatory      346389..346419
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(346389..346419)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(346436..346703)
FT                   /locus_tag="TTE0328"
FT   CDS_pept        complement(346436..346690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0328"
FT                   /product="thioredoxin-like protein tlp"
FT                   /note="Best Blastp hit = gi|7475877|pir||C69724
FT                   thioredoxin-like protein tlp - Bacillus subtilis
FT                   gi|1405455|emb|CAA97600.1| (Z73234) TlpA [Bacillus
FT                   subtilis] gi|2634186|emb|CAB13686.1| (Z99113)
FT                   thioredoxin-like protein [Bacillus subtilis], score 73.6,
FT                   E-value 3.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23620"
FT                   /db_xref="InterPro:IPR017524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCT2"
FT                   /protein_id="AAM23620.1"
FT                   /translation="MGKEERYTKKPKPDDRSDNVEKLQEMIHNTIENYREAEDYLKLHA
FT                   EELSPEEIERIKEKNRNRLISIQNMRQEIIDEVHDRERR"
FT   regulatory      complement(346699..346703)
FT                   /locus_tag="TTE0328"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            346848..347857
FT                   /gene="PitA"
FT                   /locus_tag="TTE0329"
FT   regulatory      346848..346852
FT                   /gene="PitA"
FT                   /locus_tag="TTE0329"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        346859..347857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PitA"
FT                   /locus_tag="TTE0329"
FT                   /product="Phosphate/sulphate permeases"
FT                   /note="Best Blastp hit = gi|13700555|dbj|BAB41852.1|
FT                   '(AP003131) ORFID:SA0619.; hypothetical protein, similar to
FT                   low-affinity inorganic phosphate transporter
FT                   [Staphylococcus aureus]', score 206, E-value 5.00E-52"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23621"
FT                   /db_xref="GOA:Q8RCT1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT1"
FT                   /protein_id="AAM23621.1"
FT                   /translation="MALYTLTIAVIFLYIFITGFHDEGNLIATIVCSRSIEAKKALIIA
FT                   SVAQFLGPLIVTTAVSTTIAKDIIKYSYLLNSGENISLLILSGILGAALWNFITWYYAI
FT                   PSSSSHALIGGILGPFAIEYGFHSINFYGIMTKVIIPLFFSPVIGFAAGYIITLIFWKL
FT                   LKNAQPSVNSFLKKLQYGTMFLLNIGQSANDAQKGMGLIVILMMIKGNTHNFEVPFFIK
FT                   YIAAFMISFGLLFGGFRMIKSVGGRIYRVRPFHSFNAQLSSLLVVTAATLVGAPISGTQ
FT                   LVNSSILGVGARERPSAVRWQFAKAIFAAWITTIPASFIFSSIIYMVAKLL"
FT   misc_feature    346910..347824
FT                   /gene="PitA"
FT                   /locus_tag="TTE0329"
FT                   /note="Pfam match to entry PHO4, Phosphate transporter
FT                   family, score 157.4, E-value 1.00E-49"
FT   gene            347925..348484
FT                   /locus_tag="TTE0330"
FT   regulatory      347925..347929
FT                   /locus_tag="TTE0330"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        347975..348484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0330"
FT                   /product="Phosphate transport regulator (distant homolog of
FT                   PhoU)"
FT                   /note="Best Blastp hit =
FT                   gi|6467513|gb|AAF13173.1|AF176224_1 (AF176224) Hrd4-1
FT                   [Desulfitobacterium dehalogenans], score 89.7, E-value
FT                   2.00E-17"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23622"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCT0"
FT                   /protein_id="AAM23622.1"
FT                   /translation="MFTGSEEDGKEVTRLEKLADRKREELIKELDRTFITPFDREDIFN
FT                   LSKAIDDILDYSDSTVEEMEIYELEPTPELREIVEVIRISTELIHESVCNLNKDRKEGM
FT                   RQALQAKKYENRVENLYRKNLAKLFEGDDIKYILKMREIFRHLSNCADRIDLAGDILGH
FT                   IYVKMI"
FT   gene            348573..351290
FT                   /gene="PspF7"
FT                   /locus_tag="TTE0331"
FT   regulatory      348573..348577
FT                   /gene="PspF7"
FT                   /locus_tag="TTE0331"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        348585..351290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PspF7"
FT                   /locus_tag="TTE0331"
FT                   /product="NtrC family Transcriptional regulator, ATPase
FT                   domain protein"
FT                   /note="Best Blastp hit = gi|126223|sp|P23914|LEVR_BACSU
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN LEVR
FT                   gi|98399|pir||A39160 transcription activator of levanase
FT                   operon levR - Bacillus subtilis gi|143150|gb|AAA22572.1|
FT                   (M60105) levR [Bacillus subtilis]
FT                   gi|2108261|emb|CAA63460.1| (X92868) transcriptional
FT                   regulatory protein [Bacillus subtilis]
FT                   gi|2635154|emb|CAB14650.1| (Z99117) transcriptional
FT                   regulator (NifA/NtrC family) [Bacillus subtilis], score
FT                   458, E-value 1.00E-127"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23623"
FT                   /db_xref="GOA:Q8R5U5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U5"
FT                   /protein_id="AAM23623.1"
FT                   /translation="MKRINKVYNYVQEACERQFKEKGEVTGVSAIEVAQALKIQRSNAS
FT                   SDLNTLVREGKLTKIEGKPVLYKVKELSITSNVNPLRTKDAFSEIIGAELSLKNAVQQA
FT                   KAAIIYPPHGLHTLLLGETGTGKSMFAEVMYNFAKEIGRIKKNAPFVTFNCADYASNPQ
FT                   LLMAHLFGVKKGAYTGADSDKVGLVEKADGGILFLDEVHRLPPEGQEMLFYLIDKGLYR
FT                   RLGESDVEHKANVLIICATTEDIESALLKTFIRRIPMVIKLPSLAERTYEERFELIKNF
FT                   FKAEAAIIKTDVMITSNALKALLLYDCPNNVGQLKSDIKLAIAKAYLGYMMKRDENVCV
FT                   HTEDLPEYVRKGLLKYKEKREEIDKFITGEIIRFSVDDMIPIVQRNTQIFNFYEALEEK
FT                   RKILEQKGLSEEDIKLIMSIDIDTYLKKYLLNLDKSNLEELYKVVDKKVVSLVQDFLNY
FT                   ASKKLQKEFSDKTLYGLSMHVASSIERILEGKDIVNHQLEHIKKVYPKEFEIAKVLKEE
FT                   IQREFNIVVPEDEVGFITMFLCLEEGTEEKDERVGIIVAMHGEAAATSIAEVANRLLGE
FT                   NYVIGYNMPLDQKPEIALNNLVNIVKKVNKGKGVLLLVDMGSLVFFGDMIYERTGIPVK
FT                   TVEMVSTPMVLEAARKALLNSSLDEVYDAVVNLSPYVGRIYRESVKFENPLKKNVIITA
FT                   CITGEGTAVKLKSILEKELNLKEKDIDIIPMEIESKKEFKRKLLNIKEEKNVLAVVSAI
FT                   NPEDESILYISTSDVFDKNKLSVLKNAIEAVSNVGLIDNMREVIRENVRIDAEKYISSF
FT                   KQFYSTLIAKGVKLNEDITIGLILHIACVIERIIEGKELTHVKNTQQYIRDYPKEFETI
FT                   RKTVKILEEGCDISISDEECVNIMKIIYSI"
FT   misc_feature    348936..349316
FT                   /gene="PspF7"
FT                   /locus_tag="TTE0331"
FT                   /note="Pfam match to entry sigma54, Sigma-54 interaction
FT                   domain, score 95.2, E-value 1.70E-25"
FT   misc_feature    349920..350207
FT                   /gene="PspF7"
FT                   /locus_tag="TTE0331"
FT                   /note="Pfam match to entry BglG_antitermin, Transcriptional
FT                   antiterminator bglG family, score 84.8, E-value 1.70E-21"
FT   gene            351444..352746
FT                   /gene="CelB"
FT                   /locus_tag="TTE0332"
FT   regulatory      351444..351448
FT                   /gene="CelB"
FT                   /locus_tag="TTE0332"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        351457..352746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CelB"
FT                   /locus_tag="TTE0332"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /note="Best Blastp hit = gi|2499991|sp|Q45400|PTCC_BACST
FT                   'PTS SYSTEM, CELLOBIOSE-SPECIFIC IIC COMPONENT (EIIC-CEL)
FT                   (CELLOBIOSE-PERMEASE IIC COMPONENT) (PHOSPHOTRANSFERASE
FT                   ENZYME II, C COMPONENT)' gi|541383|pir||C49898 cellobiose
FT                   phosphotransferase system celB - Bacillus
FT                   stearothermophilus gi|466474|gb|AAA17390.1| (U07818)
FT                   cellobiose phosphotransferase enzyme II'' [Bacillus
FT                   stearothermophilus], score 396, E-value 1.00E-109"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23624"
FT                   /db_xref="GOA:Q8RCS9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS9"
FT                   /protein_id="AAM23624.1"
FT                   /translation="MDTFINFLDRYFMPVAGRLAEQRHLKSIRDGIVATMPLLLIGSFF
FT                   LIIAFPPVPALEALIKPYVNDLLKIVNATFGIIAMVASFTIAYSLAGTYRIDPVASGVL
FT                   SLSTFMLSIPLTQDGNIPLNWMGSQGLFVAMILAIFTVEVQRKFIEKNLIIRMPEGVPP
FT                   SVGRAFAALIPGAVIITSIWIIHMILIKTVHLTIPEAINKLIAVPLMKLGSTLPAVILA
FT                   ILAIQFLWSVGIHGAALVGGILGPIWLTFTQENAAAKIAGEKILPHIVTQQFFDIFIYI
FT                   GGSGTTLALALLLLFATKSEQLKAVGKAAIGPGIFNINEPITFGMPIVMNPVMIIPFIL
FT                   APIAAALITYFAMALNLVARPYALIPWTTPVLISGFLTTGDWKAIILQIINFAVAGAIY
FT                   YPFLKLWDNKKYEEEQQLKKEEEEVAQTKA"
FT   repeat_region   complement(352831..352943)
FT                   /note="TLR006, identity:100%, copy 3"
FT   repeat_region   complement(352942..354756)
FT                   /note="TLR004, identity:99%, copy 3"
FT   gene            352947..354244
FT                   /locus_tag="TTE0333"
FT   regulatory      352947..352951
FT                   /locus_tag="TTE0333"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        352961..354244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0333"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 411, E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23625"
FT                   /db_xref="GOA:Q8R6I6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I6"
FT                   /protein_id="AAM23625.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMDIKERLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVAGFIAEVGDIEKYEHPKQIQKLGGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    353744..354073
FT                   /locus_tag="TTE0333"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 76.1, E-value 7.20E-19"
FT   gene            354815..355577
FT                   /locus_tag="TTE0334"
FT   regulatory      354815..354819
FT                   /locus_tag="TTE0334"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        354828..355577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|541384|pir||D49898 cellobiose
FT                   phosphotransferase system celC - Bacillus
FT                   stearothermophilus gi|466475|gb|AAA17391.1| (U07818)
FT                   putative phospho-beta-glucosidase [Bacillus
FT                   stearothermophilus], score 159, E-value 3.00E-38"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23626"
FT                   /db_xref="GOA:Q8RCS8"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCS8"
FT                   /protein_id="AAM23626.1"
FT                   /translation="MKYLIVNGDDFGLTKGVNKGIVESYKNGILRSTSIMCNMPYADEA
FT                   SQIKEICPDLGFGIHITLDAGKPLNSPYKVSTLVDEKGYFKKGFSHSLNEADIDQIKIE
FT                   IEEQIKKAFSLGVPITHMDSHHGVQSHPKVIEIFIDMAIKYNLPVRATPLDKEVILKSG
FT                   VKTIDNFVYTFYDEGVEKENLLFILKKLENGITEIMTHPAYVDDELMRVSSYNTKREIE
FT                   RKILTDPDVIQFVKENNITLVNYSIFR"
FT   gene            355597..355921
FT                   /gene="CelA"
FT                   /locus_tag="TTE0335"
FT   regulatory      355597..355601
FT                   /gene="CelA"
FT                   /locus_tag="TTE0335"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        355610..355921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CelA"
FT                   /locus_tag="TTE0335"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /note="Best Blastp hit = gi|11497017|ref|NP_046992.1| 'PTS
FT                   system, cellobiose-specific IIB component (celA) [Borrelia
FT                   burgdorferi]' gi|7450521|pir||B70217 'PTS system,
FT                   cellobiose-specific IIB component (celA) homolog - Lyme
FT                   disease spirochete plasmid B/cp26'
FT                   gi|2689898|gb|AAC66322.1| '(AE000792) PTS system,
FT                   cellobiose-specific IIB component (celA) [Borrelia
FT                   burgdorferi]' gi|4101692|gb|AAD01257.1| (AF006036) unknown
FT                   [Borrelia burgdorferi], score 86.7, E-value 8.00E-17"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23627"
FT                   /db_xref="GOA:Q8RCS7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS7"
FT                   /protein_id="AAM23627.1"
FT                   /translation="MRILLICGAGMSTSLLVEKMKKEGEKRGIKDLYINAEAADNLEKV
FT                   IDDYDVVLLGPQIRYKEKYVAELTKEKNKVYRVIPPHIYGMVDGAKTLDLAIEALKNK"
FT   misc_feature    355610..355888
FT                   /gene="CelA"
FT                   /locus_tag="TTE0335"
FT                   /note="Pfam match to entry PTS_IIB, PTS system,
FT                   Lactose/Cellobiose specific IIB subunit, score 110.2,
FT                   E-value 4.00E-29"
FT   gene            355927..356272
FT                   /gene="CelC"
FT                   /locus_tag="TTE0336"
FT   regulatory      355927..355931
FT                   /gene="CelC"
FT                   /locus_tag="TTE0336"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        355940..356272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CelC"
FT                   /locus_tag="TTE0336"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /note="Best Blastp hit = gi|1172708|sp|P46319|PTCA_BACSU
FT                   'PTS SYSTEM, CELLOBIOSE-SPECIFIC IIA COMPONENT (EIIA-CEL)
FT                   (CELLOBIOSE-PERMEASE IIA COMPONENT) (PHOSPHOTRANSFERASE
FT                   ENZYME II, A COMPONENT) (EIII-CEL)' gi|1361403|pir||S57761
FT                   probable cellobiose phosphotransferase enzyme III -
FT                   Bacillus subtilis gi|7434479|pir||D69651 PTS
FT                   lichenan-specific enzyme IIA component licA - Bacillus
FT                   subtilis gi|895750|emb|CAA90287.1| (Z49992) putative
FT                   cellobiose phosphotransferase enzyme III [Bacillus
FT                   subtilis] gi|1783268|dbj|BAA11745.1| (D83026) cellobiose
FT                   phosphotransferase enzyme III [Bacillus subtilis]
FT                   gi|2636392|emb|CAB15883.1| (Z99123) phosphotransferase
FT                   system (PTS) lichenan-specific enzyme IIA component
FT                   [Bacillus subtilis], score 120, E-value 4.00E-27"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23628"
FT                   /db_xref="GOA:Q8RCS6"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS6"
FT                   /protein_id="AAM23628.1"
FT                   /translation="MDLEQIVFTIISHAGNARSNSFEALKYAREGNFEEAEKCLEKASE
FT                   ELLEAHHVQTDMIHKEAAGEKQEITLLLVHAEDHLMNAILAKELITEMIELYKIIYQTK
FT                   GATYNV"
FT   misc_feature    355949..356236
FT                   /gene="CelC"
FT                   /locus_tag="TTE0336"
FT                   /note="Pfam match to entry PTS_IIA, PTS system,
FT                   Lactose/Cellobiose specific IIA subunit, score 170.6,
FT                   E-value 2.60E-47"
FT   gene            356250..357575
FT                   /gene="CelF"
FT                   /locus_tag="TTE0337"
FT   regulatory      356250..356254
FT                   /gene="CelF"
FT                   /locus_tag="TTE0337"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        356265..357575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CelF"
FT                   /locus_tag="TTE0337"
FT                   /product="Alpha-galactosidases/6-phospho-beta-glucosidases,
FT                   family 4 of glycosyl hydrolases"
FT                   /note="Best Blastp hit = gi|1168884|sp|P46320|CELF_BACSU
FT                   PROBABLE 6-PHOSPHO-BETA-GLUCOSIDASE gi|1361399|pir||S57762
FT                   6-phospho-beta-glucosidase (EC 3.2.1.86) licH - Bacillus
FT                   subtilis gi|895751|emb|CAA90288.1| (Z49992) putative
FT                   6-phospho-beta-glucosidase [Bacillus subtilis]
FT                   gi|2636391|emb|CAB15882.1| (Z99123)
FT                   6-phospho-beta-glucosidase [Bacillus subtilis], score 545,
FT                   E-value 1.00E-154"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23629"
FT                   /db_xref="GOA:Q8RCS5"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS5"
FT                   /protein_id="AAM23629.1"
FT                   /translation="MSKKDLKIAVIGGGSSYTPELIEGFIKRYEELPVRDIYLMDIEEG
FT                   KEKLEIVGGLAKRMVEKAGVGINIHLTLDRREAIKDADFVVTQFRVGGIDARIRDEKIP
FT                   LKYDVIGQETTGPGGFAKAQRTIPVILDVCKDIEELAPNAWLINFTNPAGVITETILKH
FT                   TNVKAIGLCNVPIGMVHGVAKMLEVDSKRVYIDFAGLNHLVWGTHIYLDGEDITEKLID
FT                   SFAGGKSLSMKNIPELPWDPEFIKSLGMYPCPYHRYYYLTDQMLKEQKKEAATVGTRGE
FT                   VVKKLEKELFELYKDPNLNVKPPQLEKRGGAHYSDAACSLISSIYNDKKDIHVVNVRNN
FT                   GTIADLPDDVVIETNAVVDKNGAHPITIGHVSPKIRGLMQVVKAYEELTIEAGVRGDYY
FT                   AALQALTIHPLVPSATIAKKILDDIIEQNKEYLPQYK"
FT   misc_feature    356283..357497
FT                   /gene="CelF"
FT                   /locus_tag="TTE0337"
FT                   /note="Pfam match to entry Glyco_hydro_4, Family 4 glycosyl
FT                   hydrolase, score 579.8, E-value 1.70E-170"
FT   gene            357634..359043
FT                   /gene="BglB"
FT                   /locus_tag="TTE0338"
FT   regulatory      357634..357638
FT                   /gene="BglB"
FT                   /locus_tag="TTE0338"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        357649..359043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BglB"
FT                   /locus_tag="TTE0338"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /note="Best Blastp hit = gi|7435434|pir||D69785
FT                   beta-glucosidase homolog ydhP - Bacillus subtilis
FT                   gi|1945100|dbj|BAA19708.1| (D88802) C. thermocellum
FT                   beta-glucosidase; P26208 (985) [Bacillus subtilis]
FT                   gi|2632897|emb|CAB12403.1| (Z99107) similar to
FT                   beta-glucosidase [Bacillus subtilis], score 705, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23630"
FT                   /db_xref="GOA:Q8RCS4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS4"
FT                   /protein_id="AAM23630.1"
FT                   /translation="MSKEYRFPEGFWWGSATSAVQIEGAADEDGKGMNVWDYWYQKEPN
FT                   RFFNGIGSQVTSDFYHRYKEDIKLMKELGHNSFRFSISWSRLIPGGTGKVNEKAVEFYN
FT                   NVINELLENGIEPFATLFHFDMPIEMQNIGGFENRKVVEYFAEYAKTCFELFGDRVKRW
FT                   ITFNEPIVPVLGGYLYNFHYPDIVDFKRAVQFGYGTVLASARAIEEFKKLKINDAKIGI
FT                   VLNLSPVYPRSNHPADLKAAELADLFHNRSFLDPSVKGEYPKELVEVLKAYNHLPEYKE
FT                   EDLELIKDNTVQYLGVNYYQPLRVKAKENMPNPYGVFTPNWFYDEYIMPGRRMNPYRGW
FT                   EIYEKGIYDLLKRIKDEYGNIECFISENGMGVEGEERFIKDGIIQDDYRIEFIKEHLKW
FT                   VHKAIEEGCNVKGYHVWTFMDNWSWLNAYKNRYGLVAIDLKTQKRTIKKSGYWFKEVAE
FT                   NNGFVD"
FT   misc_feature    357655..359034
FT                   /gene="BglB"
FT                   /locus_tag="TTE0338"
FT                   /note="Pfam match to entry Glyco_hydro_1, Glycosyl
FT                   hydrolase family 1, score 571.1, E-value 7.10E-168"
FT   regulatory      359044..359060
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            359172..360619
FT                   /gene="MtlA"
FT                   /locus_tag="TTE0339"
FT   regulatory      359172..359176
FT                   /gene="MtlA"
FT                   /locus_tag="TTE0339"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        359186..360619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MtlA"
FT                   /locus_tag="TTE0339"
FT                   /product="Phosphotransferase system, mannitol-specific IIBC
FT                   component"
FT                   /note="Best Blastp hit = gi|3025454|gb|AAC12848.1| (U53868)
FT                   MtlA [Clostridium acetobutylicum], score 544, E-value
FT                   1.00E-154"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23631"
FT                   /db_xref="GOA:Q8RCS3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS3"
FT                   /protein_id="AAM23631.1"
FT                   /translation="MQNVNAITTKGGSLRVKLQRLGGFLAGMVIPNIGAFIAWGLITAF
FT                   FIPTGWVPNEHLAKLVGPMIMYLLPILIGYTGGKLVYDVRGGVVGAVATAGVAIGSSVP
FT                   MFIGAMIMGPLGGYVIKKFDEAVEGKVPAGFEMLVNNFSAGILGGILAILAFLFVEPVM
FT                   NAISLGLGAAAQWVTDKGLLPLIALFIEPGKVLFLNNAINHGILAPLGVAQVKEFGKSI
FT                   FFLLETNPGPGLGVLLAYWLFGKGDAKQSAPGAIIIQFFGGIHEIYFPYVLMNPALLLA
FT                   VIGGGMAADATFVLTKAGLVATPSPGSIFAEIAMAPKGGLLPVLAGIAVGALVSFLIAS
FT                   PIVKRASEESMSAESMSFARSIVSGLKAQSKGEKVEMPKAEVKMDTLPKLIVFACDAGM
FT                   GSSAMGETILRKKLKEAGFDIQVKHSAVNQIPKEADVVFTQENLAERAAQVVPHAKIVT
FT                   VKNFLDNTVYDEFVKSLRK"
FT   gene            360624..362656
FT                   /locus_tag="TTE0340"
FT   regulatory      360624..360628
FT                   /locus_tag="TTE0340"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        360635..362656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0340"
FT                   /product="putative transcriptional regulator"
FT                   /note="Best Blastp hit = gi|3025455|gb|AAC12849.1| (U53868)
FT                   MtlR [Clostridium acetobutylicum], score 481, E-value
FT                   1.00E-134"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23632"
FT                   /db_xref="GOA:Q8RCS2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS2"
FT                   /protein_id="AAM23632.1"
FT                   /translation="MEDLSVRQKFILKNLIEKGPFEIADLANLMDVSERTVLREVALIN
FT                   ERLRDFNVKIVEQGRKIFIEGEEEALKRVYSSLGAIPLQWLLTPDQRQVLMTLQLLLSD
FT                   EPIKAGYFSYQFNVVEGTISLYLDKIEEWLRMRKLTLIRRRGYGIKVEGSEVDRRNAII
FT                   ELFYNYTPMEDLLQFIYDEEKGKYFKAFFDSVFGKDLVEKVKSLCEKIKEAVYEELPDL
FT                   NYFGMFVHILLSIYRSKEGKAIELDREFINDILQSEEFNFMKKVEKILEEEDFYLPESE
FT                   IAYLAIHLSPKKYVYKQHRFEELGITLEELSKEVVEEVSRIFNVNIRCDEQLLLGLAQH
FT                   LEPAFYRLRMGLVTSNPLIEEIKSYYKDLFSAVERACKIVFSKYNIIVPEEEIGYITMH
FT                   IGAAIERQKEMAKKLKVLVICPNGIGTARILSAKLKNKFKEIDQLNIGTIWEFKRKHQE
FT                   YDLIVSTIRLEEADSKVIIVSPFLTEEDEEKIRDYIQNLVEKVEQKGGQFEAKVKVEEN
FT                   FEVADEILRNFKIEEVEADSTERLIELIGQDLSKSMLAEDAEEIKELLLKREAMGNVVI
FT                   PGTRIALLHTRSDKMVLPFLGVYKVKSPLKLQSVGFAYEEVDTFLIMLARKTEKSDILE
FT                   MLGKVSISLIEDKNFSEILRLGDVKDVRNALVKILNEA"
FT   misc_feature    361556..361843
FT                   /locus_tag="TTE0340"
FT                   /note="Pfam match to entry BglG_antitermin, Transcriptional
FT                   antiterminator bglG family, score 63.7, E-value 4.00E-15"
FT   gene            362655..363108
FT                   /gene="PtsN2"
FT                   /locus_tag="TTE0341"
FT   regulatory      362655..362659
FT                   /gene="PtsN2"
FT                   /locus_tag="TTE0341"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        362668..363108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PtsN2"
FT                   /locus_tag="TTE0341"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /note="Best Blastp hit = gi|3025456|gb|AAC12850.1| (U53868)
FT                   MtlF [Clostridium acetobutylicum], score 154, E-value
FT                   7.00E-37"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23633"
FT                   /db_xref="GOA:Q8RCS1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCS1"
FT                   /protein_id="AAM23633.1"
FT                   /translation="MDREILNEKNILLNLPSESKIEAIERVGNLLVENGYVEKEYIEGM
FT                   KKREEDITTYIGNGVAIPHGVSEYVKYIKKSGIVIAQYPDGVDFGDGNRAYIVIGIAGK
FT                   GDEHLNILSKIALTCQYEENVEKLKKAKTPQEIIEILEKGDE"
FT   misc_feature    362677..363099
FT                   /gene="PtsN2"
FT                   /locus_tag="TTE0341"
FT                   /note="Pfam match to entry PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 196.7, E-value 3.70E-55"
FT   gene            363096..364270
FT                   /gene="MtlD"
FT                   /locus_tag="TTE0342"
FT   regulatory      363096..363100
FT                   /gene="MtlD"
FT                   /locus_tag="TTE0342"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        363110..364270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MtlD"
FT                   /locus_tag="TTE0342"
FT                   /product="Mannitol-1-phosphate/altronate dehydrogenases"
FT                   /note="Best Blastp hit = gi|8134573|sp|O65992|MTLD_CLOAB
FT                   MANNITOL-1-PHOSPHATE 5-DEHYDROGENASE
FT                   gi|3025457|gb|AAC12851.1| (U53868) MtlD [Clostridium
FT                   acetobutylicum], score 404, E-value 1.00E-111"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23634"
FT                   /db_xref="GOA:Q8RCS0"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCS0"
FT                   /protein_id="AAM23634.1"
FT                   /translation="MLKALHFGAGNIGRGFIGYLLNKSGYEVTFVDISKEIVDNINKYK
FT                   KYNVIILKEPVEKEEVKEVKALHLEEEDKVLDAFLEADMVTTSVGVSNLSSIGGRLKKY
FT                   LKARKEKNEKPLDIMACENALFATDVLRERVVKEEDDDFITYLNLKVGFPNTAVDRIVP
FT                   AVKIDKKLPVDVAVEEFFEWDIEKNKIKGNLQIEGVELVDDLKPYIERKLFLLNGAHAT
FT                   TAYLGYLRGYTYIHQAIKDDNIRAIVKGMQEEISTALSKKYDVDKESLMAYAEKVIKRF
FT                   ENPYLQDEVTRVGREPLRKLSSEDRLIAPLKLCSEVGITPNFILYGIAAGLLFDYKEDA
FT                   QAVKMREYVEQFGIKKAVNVITGLEEESDLVEEIEKRYFELKGKLI"
FT   misc_feature    363113..364186
FT                   /gene="MtlD"
FT                   /locus_tag="TTE0342"
FT                   /note="Pfam match to entry Mannitol_dh, Mannitol
FT                   dehydrogenase, score 469.7, E-value 2.40E-137"
FT   gene            364570..368271
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT   regulatory      364570..364574
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        364582..368271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /product="5-nucleotidase/2',3'-cyclic phosphodiesterase and
FT                   related esterases'"
FT                   /note="Best Blastp hit = gi|7481086|pir||T35760 probable
FT                   nucleotidase - Streptomyces coelicolor
FT                   gi|5689908|emb|CAB52071.1| (AL109732) putative nucleotidase
FT                   [Streptomyces coelicolor A3(2)], score 325, E-value
FT                   3.00E-87"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23635"
FT                   /db_xref="GOA:Q8RCR9"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR9"
FT                   /protein_id="AAM23635.1"
FT                   /translation="MFSQRSRLFSILVAALLIFSLIFPSVPQIAFAATSKTFDFIEVTD
FT                   FHGYLQNDGKASDGTLYKQQIAAVMAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLR
FT                   GKPVIEMMKNIGFDAMALGNHEYDWGIESVIDTQNATLKNSTIPVLAANVYDKTTGKPV
FT                   SYVKPYVVIERDGVKIGIIGIVDNKEFPTIIMPAFIQNVDFKDPVPIVNDLAQQLRQQG
FT                   VKIVVVLAHMGAYQDSSGNVSGNLIDFAKQVKGVDAIFGGHTHTIVTTRVNGIPVGVAA
FT                   NYGKGIIDLKITINEDGTITAGDMQYIDLTKIYSTPNIDPKYIDPEVQAIVDKANEDVG
FT                   PIFNEVIGKAAIDLTRTQSAKPYGDSLLGNWAAEVTRKAVNADFGFANNGGLRIDIPKG
FT                   DITVGMMYQLMPFDNTIVTMKMTGAQIKTILEQAVQDGGKGIQVAGLSFKYDPTRPSMH
FT                   RVFDMRKSDGTPIDMNKSYLVATNNFMGTGGDGFTGFTDPEVKKSFVDTYKLVRDAFIE
FT                   AVKEQGTITSVIDGRIAPATKEGTLITVLATSDIHGNIFPWDYNTAKPANRGLAKVSTY
FT                   VKQVREKYPYVVLVDNGDTIQGTPLSYYYDKIDTKTEYPLAKVMGAMKYDTWTLGNHEF
FT                   NYGLEVLNRVIKDMRNEGIHVLSANTYKDDGTNYVDAYYIKTFNTPQGPVKVGILGLTT
FT                   KMIPAWENKENYAGLHFNDLVDEAKKWVPKLREAGADIVVVTMHSGEEKPTDIIPENQV
FT                   IAVATNVDGIDAIVAGHTHVNIPQHDYKNPSGQTVIVTEPGKWGEYVSQIYFDITKNDQ
FT                   GKWVIADKWSTTIKMDDSIQADPEILNLAQPYHDATLKYIGTKIGVATGDFLGTDQTIK
FT                   PTAIMDLINKVQKYYAKTDLSIAAPLSSSAKILKGDITIQDIMGVYVYENYLYGIKMTG
FT                   KQLKAWLEWSARYYKQVSSPNDPITKDPTLNIPDYNLDQLYGASYVIDLTQPAGHRIKN
FT                   LKVNGKLVKDDDVFTVAINNYRFNGGGGFMQAAGITNPEIVFDSAKAYGDDGQVRNLMI
FT                   RYIQEHGTISPVVESDWYISTTPVQEEVEVSQGTTQPSQQTEQQTASQPVYNYGIVTAS
FT                   ALNVREGAGLRYKVIGVLPAGKVVTLLEEVNGWYKIDYNGKTGYIYSKYVAATPNPSNV
FT                   VVLKAVKVTAKSGLNVRVNNSLNARKIGAVPYGTELKVVGEYNGWYQVLYNGGFGYVYA
FT                   KYTK"
FT   misc_feature    364675..365613
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /note="Pfam match to entry 5_nucleotidase, 5'-nucleotidase,
FT                   catalytic domain, score 225.1, E-value 4.10E-65"
FT   misc_feature    365617..366120
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /note="Pfam match to entry 5_nucleotidaseC,
FT                   5'-nucleotidase, C-terminal domain, score 143.9, E-value
FT                   2.80E-39"
FT   misc_feature    366184..367140
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /note="Pfam match to entry 5_nucleotidase, 5'-nucleotidase,
FT                   catalytic domain, score 274.5, E-value 1.30E-79"
FT   misc_feature    367144..367677
FT                   /gene="UshA"
FT                   /locus_tag="TTE0343"
FT                   /note="Pfam match to entry 5_nucleotidaseC,
FT                   5'-nucleotidase, C-terminal domain, score 114.4, E-value
FT                   2.20E-30"
FT   gene            368351..369335
FT                   /locus_tag="TTE0344"
FT   regulatory      368351..368355
FT                   /locus_tag="TTE0344"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        368367..369335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0344"
FT                   /product="predicted TIM-barrel enzymes, possibly
FT                   dehydrogenases, nifR3 family"
FT                   /note="Best Blastp hit = gi|10172709|dbj|BAB03816.1|
FT                   (AP001507) transcriptional regulator involved in nitrogen
FT                   regulation (NifR3/Smm1 family) [Bacillus halodurans], score
FT                   300, E-value 1.00E-80"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23636"
FT                   /db_xref="GOA:Q8RCR8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR8"
FT                   /protein_id="AAM23636.1"
FT                   /translation="MKIGDVVLENNVFLSPMAGVTDKPFRLICQEMGAGLTYTEMVSAK
FT                   GLYYGSENTKALLDIDDGEKVAIQIFGSDPEIMGEIARRLNESKALIIDINMGCPTPKI
FT                   VKNGDGAALMLKPDLAEKVMEAVVKASYKPVTVKIRKGWNDNNVNAVEIAQIAERVGIK
FT                   AVAVHGRTREQFYSGKADWEIIKKVKESVKIPVIGNGDIFTPEDAKRMLDETGCDAVMI
FT                   GRGAQGNPWIFKRTVHYLKTGELLPEPTIKEKVDLMIRHLTMMVEYKGERTGVVEMRKH
FT                   IAWYLKGLPGSARMREAVFKMESYKEIKEFLEGIPKIYEKG"
FT   misc_feature    368403..369326
FT                   /locus_tag="TTE0344"
FT                   /note="Pfam match to entry UPF0034, Uncharacterized protein
FT                   family UPF0034, score 442, E-value 5.30E-129"
FT   regulatory      369344..369357
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(369344..369357)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(369362..370170)
FT                   /locus_tag="TTE0345"
FT   CDS_pept        complement(369362..370156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7482130|pir||H69055 conserved
FT                   hypothetical protein MTH1418 - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)
FT                   gi|2622531|gb|AAB85895.1| (AE000904) conserved protein
FT                   [Methanothermobacter thermautotrophicus], score 83.2,
FT                   E-value 3.00E-15"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23637"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR7"
FT                   /protein_id="AAM23637.1"
FT                   /translation="MAGPLLEEQLIKPKHDWKDLTSKIVKKLKLKYEPVGVFLVPSVHK
FT                   ERYEKFFEDIPRPNGRLTYCQAVETVRGSTNYSGLPEPPDALRLKAEDFMCAAGAANLG
FT                   LYDLPEPIKNGERDFLLRRFYSLETSRVTREKIPKLEPGNVSEVIVFKLSKAPVEPQVV
FT                   LVFGVPAQILALEGHYLMKKGGRLNIDLLGTCGVCSEMTVSPLVNRKMNFSLLCGGARA
FT                   HAFHDPTEMGAGIPAEEFPDLVENLLNRQNIPMRQTLPENLR"
FT   misc_feature    complement(369404..370117)
FT                   /locus_tag="TTE0345"
FT                   /note="Pfam match to entry DUF169, Uncharacterized ArCR,
FT                   COG2043, score 96, E-value 7.50E-25"
FT   regulatory      complement(370166..370170)
FT                   /locus_tag="TTE0345"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(370169..370424)
FT                   /locus_tag="TTE0346"
FT   CDS_pept        complement(370169..370414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0346"
FT                   /product="Ferredoxin 3"
FT                   /note="Best Blastp hit = gi|119944|sp|P00211|FER2_DESDN
FT                   FERREDOXIN II gi|65713|pir||FEDV2N ferredoxin 2[4Fe-4S] II
FT                   - Desulfovibrio desulfuricans gi|420329|gb|AAB28156.1|
FT                   'ferredoxin II, Fd2 [Desulfovibrio desulfuricans, Norway,
FT                   NCIB 8310, Peptide, 59 aa]', score 63.9, E-value 4.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23638"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR6"
FT                   /protein_id="AAM23638.1"
FT                   /translation="MTDVNIFKPGAEITIDDKKCIGCRRCVEVCPEDVYELVKREGETN
FT                   PNREYKSIALYPEKCILCLSCLEICPTNAIYIFGKQ"
FT   misc_feature    complement(370187..370258)
FT                   /locus_tag="TTE0346"
FT                   /note="Pfam match to entry fer4, 4Fe-4S binding domain,
FT                   score 33.1, E-value 6.60E-06"
FT   misc_feature    complement(370307..370378)
FT                   /locus_tag="TTE0346"
FT                   /note="Pfam match to entry fer4, 4Fe-4S binding domain,
FT                   score 34.1, E-value 3.20E-06"
FT   regulatory      complement(370420..370424)
FT                   /locus_tag="TTE0346"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(370609..370721)
FT                   /note="TLR006, identity:100%, copy 4"
FT   repeat_region   complement(370720..372536)
FT                   /note="TLR004, identity:100%, copy 4"
FT   gene            370725..372022
FT                   /locus_tag="TTE0347"
FT   regulatory      370725..370729
FT                   /locus_tag="TTE0347"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        370739..372022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0347"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 412, E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23639"
FT                   /db_xref="GOA:Q8R6I4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I4"
FT                   /protein_id="AAM23639.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMGIKDRLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVAGFIAEVGDIEKYEHPKQIQKLGGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    371522..371851
FT                   /locus_tag="TTE0347"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 76.1, E-value 7.20E-19"
FT   gene            372534..373270
FT                   /locus_tag="TTE0348"
FT   regulatory      372534..372538
FT                   /locus_tag="TTE0348"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        372563..373270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23640"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR5"
FT                   /protein_id="AAM23640.1"
FT                   /translation="MLEFQYKEEIKRRSIIPKEKFYHRFLKIGNLIMISKPYDEEWQEK
FT                   SYKMSLYELMKEIDYEEVFGLRIPGKSNKKKVYTNRLSFEKFTIGDIVLATSLGFHIQG
FT                   AIRHAAIFDSRRYHGSIDDECLLTAEPDKGVIYESIQFYYENFGEAWGLFVPGTTFKQR
FT                   IEIVEELSKHVGERYYWSAHKNNPTSWYCSLVPWRGYYEIAGIDIDYNGGYWVLPIDIF
FT                   MSEYTEVFEYARG"
FT   gene            373468..374565
FT                   /gene="PurR3"
FT                   /locus_tag="TTE0349"
FT   regulatory      373468..373472
FT                   /gene="PurR3"
FT                   /locus_tag="TTE0349"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        373480..374565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PurR3"
FT                   /locus_tag="TTE0349"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|10175853|dbj|BAB06949.1|
FT                   (AP001518) transcriptional regulator (LacI family)
FT                   [Bacillus halodurans], score 273, E-value 3.00E-72"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23641"
FT                   /db_xref="GOA:Q8RCR4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR4"
FT                   /protein_id="AAM23641.1"
FT                   /translation="MINSKDIARIAGVSRSTVSRVINNYPNVSPETKEKVLKAIKEYNY
FT                   VPHASARMLRGKSSKTIGLVIVDLKRNSDIHKVYDNVYFGPFTTAVIDFANQLGYNVLV
FT                   ITVYKPKDYKKVREVFYNKTINGAIFIGVKNDDPEIKNLIEAGLKTAVIDQEIRDDEND
FT                   PFNKSIIVNMDNVTGAYEATKYLISLGHREIAHITGDMEKLSGFARLEGYKKALKEAGI
FT                   PFKSSLVVKGDFVEESGYKAAYKLFKKAKPTAIFASNDQMAIGAMQALEEMGYKIPDDV
FT                   SIIGFDDITISRYLKPALTTMSVSLLQMAELAVENLIRSVEEEIAIKAKFVVPVKLVER
FT                   ESCKRIEIKEENEKKEYLLSR"
FT   misc_feature    373480..373560
FT                   /gene="PurR3"
FT                   /locus_tag="TTE0349"
FT                   /note="Pfam match to entry lacI, Bacterial regulatory
FT                   proteins, lacI family, score 35.5, E-value 1.60E-08"
FT   misc_feature    373654..374502
FT                   /gene="PurR3"
FT                   /locus_tag="TTE0349"
FT                   /note="Pfam match to entry Peripla_BP_like, Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family., score 91.8, E-value 1.30E-23"
FT   gene            374736..376501
FT                   /gene="OppA4"
FT                   /locus_tag="TTE0350"
FT   regulatory      374736..374740
FT                   /gene="OppA4"
FT                   /locus_tag="TTE0350"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        374750..376501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppA4"
FT                   /locus_tag="TTE0350"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, periplasmic components"
FT                   /note="Best Blastp hit = gi|7442338|pir||E72282
FT                   'oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein - Thermotoga maritima (strain
FT                   MSB8)' gi|4981776|gb|AAD36298.1|AE001778_19 '(AE001778)
FT                   oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein [Thermotoga maritima]', score
FT                   637, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23642"
FT                   /db_xref="GOA:Q8RCR3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR3"
FT                   /protein_id="AAM23642.1"
FT                   /translation="MRRLLSVLLVLMLVTGALAGCGQKSQEAADKTQQSETAQQPAQET
FT                   TYQRNETLYAGGGLWAPPSNWNPLTPWNAVTGTVGLIYETLFNYDPLKNEFIPWLAEKG
FT                   EWTSDNTYQVTLRDGLTWSDGQPLTSEDVKFTFEIAKEHPEIYYSPMWQWLQSVDTPDN
FT                   KTVVFKFSTSHYHEWQYNLYQIPIIPKHIWQNKSKDDLLNGANEKAIGSGPYLFDTYSN
FT                   DRMVYKRNDNWWGIKALGLTPQPKRIVYLIVPSNNVALGMLMKGELDVSNFFLPGIPTL
FT                   KANYGITTFYDNPPYMIPDNTVFMFINVTKEPLSNVELRRAMAYAINPKVIAEKVYENQ
FT                   VEPSNPLGFVPAKSWEEYYDKNVVSQYGFSYDPNKAKAILDAAGFKLGNDGVRTTPDGK
FT                   KFKLEISVPYGWTDWMEAAKIVADQLKAVGIDAEAKFPDYSKYWEDLTKGTFDLSFNNF
FT                   GSQVTSTPWTLYNWLFNPITGDAQYNGNFGRFDVEGLQDMVAALNEAKPGTDEAKKAAS
FT                   KLEEVFLKNIPAIPLWYNGLWFQASNAAWENWPTEHDPYAYPVTWGGRWQTGGTMMMMK
FT                   IKPKASQ"
FT   misc_feature    374777..376117
FT                   /gene="OppA4"
FT                   /locus_tag="TTE0350"
FT                   /note="Pfam match to entry SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   88.1, E-value 8.90E-24"
FT   gene            376507..377511
FT                   /gene="DppB3"
FT                   /locus_tag="TTE0351"
FT   regulatory      376507..376511
FT                   /gene="DppB3"
FT                   /locus_tag="TTE0351"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        376519..377511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppB3"
FT                   /locus_tag="TTE0351"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|7449131|pir||D72282
FT                   'oligopeptide ABC transporter, permease protein -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4981775|gb|AAD36297.1|AE001778_18 '(AE001778)
FT                   oligopeptide ABC transporter, permease protein [Thermotoga
FT                   maritima]', score 499, E-value 1.00E-140"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23643"
FT                   /db_xref="GOA:Q8RCR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR2"
FT                   /protein_id="AAM23643.1"
FT                   /translation="MLRYLIKKLYIYILTFFFAVTIDWLIPRFMPGDPILVLVSRFSGL
FT                   PESAKVMYGYLIKAFGLDLPLWKQYLNFWMAIFKGDLGISIYLYPKPVLSVIAQAIPYT
FT                   LVVLLPSILLSWIVGNYIGAAAARHRSLDSSMLPVFYIITSIPYMWLGILLAWAFGVLL
FT                   GIFPIAGAYSFSMRPNWSWQFVADFLKHWILPFLSLFIVQIGGWAIGMRNLIIYELEAN
FT                   YSRYLEALGASEGLIRRYAFKNAILPQITGLALQLGTIVAGSIATEVVFAYPGMGYILL
FT                   QGILNQDYFLVQGVFLFIIIGVLLANFLVDILYMIVDPRIRLGLGGENV"
FT   gene            377496..378350
FT                   /gene="DppC3"
FT                   /locus_tag="TTE0352"
FT   regulatory      377496..377500
FT                   /gene="DppC3"
FT                   /locus_tag="TTE0352"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        377508..378350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppC3"
FT                   /locus_tag="TTE0352"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|7442445|pir||C72282
FT                   'oligopeptide ABC transporter, permease protein -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4981774|gb|AAD36296.1|AE001778_17 '(AE001778)
FT                   oligopeptide ABC transporter, permease protein [Thermotoga
FT                   maritima]', score 327, E-value 1.00E-88"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23644"
FT                   /db_xref="GOA:Q8RCR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR1"
FT                   /protein_id="AAM23644.1"
FT                   /translation="MKEFMYFAFKNTKFKIGLSILLFFLILATIGPYLSHYKDPLEYVS
FT                   MSNLLPNKDNWLGTTTFGQDVFTQFVYGLRSTFFIGLFGGGLATIIGLLIGFIAGYRGG
FT                   WIDEILMMLTNILIVIPTLALLIIIAAYLPYRGIGIQSVIIGLTAWPWTARAVRAQTLS
FT                   LKSREFVNLAKITALPPLKIVLEEIAPNMMSYVVMVFILQFAGAILAAVGLDFIGLGPT
FT                   RGISLGLMLQYSVLWNAIQLGIWWWFIPPGLAITMIVSSLYFLNIGLDEIFNPRLREE"
FT   misc_feature    377988..378215
FT                   /gene="DppC3"
FT                   /locus_tag="TTE0352"
FT                   /note="Pfam match to entry BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 34.9, E-value 1.80E-06"
FT   gene            378340..379309
FT                   /gene="DppD3"
FT                   /locus_tag="TTE0353"
FT   regulatory      378340..378344
FT                   /gene="DppD3"
FT                   /locus_tag="TTE0353"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        378347..379309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DppD3"
FT                   /locus_tag="TTE0353"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|7442611|pir||B72282
FT                   'oligopeptide ABC transporter, ATP-binding protein -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4981773|gb|AAD36295.1|AE001778_16 '(AE001778)
FT                   oligopeptide ABC transporter, ATP-binding protein
FT                   [Thermotoga maritima]', score 387, E-value 1.00E-106"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23645"
FT                   /db_xref="GOA:Q8RCR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCR0"
FT                   /protein_id="AAM23645.1"
FT                   /translation="MTNLVEIKGLKIYYKTLRGDAKALDDVTFTINDREILGIAGESGC
FT                   GKSTLGNSLILLKPPMKYVSGEVRLNGERLPIDNTVEMRKYRYKKISLIPQYAMDALNP
FT                   TRKIGGIIKDLVGQHRVKYEEIEGRLHERLRMVKLSKDILNMYPFELSGGMKQRLVLVI
FT                   STLLNPDLLIADEVTSALDVSSQKAVSLMFKEFRDEKIVNSIVFITHDIAVLYQIADRI
FT                   AIMYAGKVVEIGPTEEIMKNPLHPYTKALIKSLPNAGIRHTHQKLEGIPGHPPNLINPP
FT                   EGCRFKDRCPFASDECLNEPPLVEVEPGRYVACWKVKGR"
FT   misc_feature    378446..379030
FT                   /gene="DppD3"
FT                   /locus_tag="TTE0353"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   125.3, E-value 1.10E-33"
FT   gene            379422..380243
FT                   /gene="OppF3"
FT                   /locus_tag="TTE0354"
FT   CDS_pept        379422..380243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OppF3"
FT                   /locus_tag="TTE0354"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /note="Best Blastp hit = gi|7445874|pir||A72282
FT                   'oligopeptide ABC transporter, ATP-binding protein -
FT                   Thermotoga maritima (strain MSB8)'
FT                   gi|4981772|gb|AAD36294.1|AE001778_15 '(AE001778)
FT                   oligopeptide ABC transporter, ATP-binding protein
FT                   [Thermotoga maritima]', score 276, E-value 3.00E-73"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23646"
FT                   /db_xref="GOA:Q8RCQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ9"
FT                   /protein_id="AAM23646.1"
FT                   /translation="MVGESGSGKSTIGKMMLKLLKPSGGQILLNDKDIYKIKNNKEFYS
FT                   KVQGIFQDPYSSFNPIFKVDRIFKLIKQSFKKEVSSSEWEGRVEEVLKKVGLNVGDVLN
FT                   KYIHQLSGGQLQRLLIARALLMDVDVLIADEITSMLDASTRVDVLEALLSLKEIGASIL
FT                   FITHDLSQAYYISDKIVVLYKGSVVESGSIEKVFSNPMHPYTRMLLDSIPQLDRKWEED
FT                   RISVEDFDKSRAAWKEGLCKYIDRCPLADLNCVRPKLKLVEEDHYVACVKM"
FT   misc_feature    379422..379976
FT                   /gene="OppF3"
FT                   /locus_tag="TTE0354"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   158.4, E-value 1.30E-43"
FT   gene            380258..382611
FT                   /locus_tag="TTE0356"
FT                   /note="authentic frameshift, conserved hypothetical; Best
FT                   Blastx hit = pir||H72228 hypothetical protein TM1624 -
FT                   Thermotoga maritima (strain MSB8) gb|AAD36691.1|AE001806_1
FT                   '(AE001806) beta-mannosidase, putative [Thermotoga
FT                   maritima]', score 543, E-value 0"
FT   repeat_region   complement(382590..382702)
FT                   /note="TLR006, identity:100%, copy 5"
FT   repeat_region   complement(382701..384517)
FT                   /note="TLR004, identity:100%, copy 5"
FT   gene            382706..384003
FT                   /locus_tag="TTE0357"
FT   regulatory      382706..382710
FT                   /locus_tag="TTE0357"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        382720..384003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0357"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 412, E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23647"
FT                   /db_xref="GOA:Q8R6I4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I4"
FT                   /protein_id="AAM23647.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMGIKDRLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVAGFIAEVGDIEKYEHPKQIQKLGGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    383503..383832
FT                   /locus_tag="TTE0357"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 76.1, E-value 7.20E-19"
FT   gene            384674..386023
FT                   /gene="BglB2"
FT                   /locus_tag="TTE0358"
FT   CDS_pept        384674..386023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BglB2"
FT                   /locus_tag="TTE0358"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /note="Best Blastp hit = gi|1022362|emb|CAA91220.1|
FT                   (Z56279) beta-glucosidase [Thermoanaerobacter brockii],
FT                   score 868, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23648"
FT                   /db_xref="GOA:Q8RCQ8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ8"
FT                   /protein_id="AAM23648.1"
FT                   /translation="MIELVKFPKDFTWGVATSSYQIEGAVNEDGRTPSIWDTFSKTEGK
FT                   TYQGHTGDVACDHYHRYKEDVQIMKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDFYKRL
FT                   VDELLKREIIPVATIYHWDLPQWAYEKNGGWLNRESVKWYVEYASKLFEELGDVIPLWI
FT                   THNEPWCSSILSYGIGEHAPGHKDWREALIAAHHILLSHGEAVKVFRDMNLKGAQIGIT
FT                   LNLTPAYPASEKEEDKLAVQYADGFANRWFLDPIFKGNYPEDMMELYSKIIGEFDFIRE
FT                   GDLETISVPIDFLGVNYYTRSIVKYNEDSMLKAENVPGPGKKTEMGWEISPESLYDLLK
FT                   RLDREYTKLPMYITENGVAFKDEVTEDGRVHDYERIEYIKEHLKAIARFIEEGGNLKGY
FT                   FVWSLLDNFEWAHGYSKRFGIVYVDYETQKRILKDSAFWYKGVIEKGVIE"
FT   misc_feature    384689..386008
FT                   /gene="BglB2"
FT                   /locus_tag="TTE0358"
FT                   /note="Pfam match to entry Glyco_hydro_1, Glycosyl
FT                   hydrolase family 1, score 793.5, E-value 8.00E-235"
FT   gene            386090..387249
FT                   /locus_tag="TTE0359"
FT   regulatory      386090..386094
FT                   /locus_tag="TTE0359"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        386107..387249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0359"
FT                   /product="Cellulase"
FT                   /note="Best Blastp hit = gi|1483210|emb|CAB01405.1|
FT                   (Z77855) endoglucanase [Anaerocellum thermophilum], score
FT                   557, E-value 1.00E-157"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23649"
FT                   /db_xref="GOA:Q8RCQ7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005086"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ7"
FT                   /protein_id="AAM23649.1"
FT                   /translation="MNKWYAFTGVLVIIIIIMYLILKDTSLTFSCYEREKFPHLMGNAL
FT                   VKKPSVAGRLKIIEKDGRKILGDQYGNPIQLRGMSTHGLQWFSEIINHNAFSGLSRDWE
FT                   SNVIRLAMYVGEGGYATNPSVKDKVIEGINLAIQNDMYVIVDWHVLNPGDPNADIYSGA
FT                   KDFFKEIATKYPNDLHIIYELANEPNPTPPGVTNDVEGWKKVKNYAEPIIQMLRDMGNQ
FT                   NIIIVGSPNWSQRPDLAAEEPINDPNVMYSVHFYTGTHKVEEHGKPGYVFGNMAKALEK
FT                   GVPIFVSEWGTSEASGDGGPYLDEADKWLEFLNANNISWINWSLANKNEVSAAFLTSTN
FT                   LNPGDGKAWAVNQLSLSGEYVRARIKGIPYKPISREARGK"
FT   misc_feature    386293..387108
FT                   /locus_tag="TTE0359"
FT                   /note="Pfam match to entry cellulase, Cellulase (glycosyl
FT                   hydrolase family 5), score 333.7, E-value 2.10E-96"
FT   gene            387276..387739
FT                   /gene="GloA"
FT                   /locus_tag="TTE0360"
FT   regulatory      387276..387280
FT                   /gene="GloA"
FT                   /locus_tag="TTE0360"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        387287..387739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GloA"
FT                   /locus_tag="TTE0360"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /note="Best Blastp hit = gi|10174085|dbj|BAB05187.1|
FT                   (AP001512) BH1468; unknown conserved protein [Bacillus
FT                   halodurans], score 61.2, E-value 7.00E-09"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23650"
FT                   /db_xref="GOA:Q8RCQ6"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="PDB:3GM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ6"
FT                   /protein_id="AAM23650.1"
FT                   /translation="MSKNILDMRNTVQIGIVVRDIEESLQNYAEFFGVEKPQWFWTDDY
FT                   SKAHTKFNGRPTKARAKLAFFELGPLQLELIEPDENPSTWREFLDKNGEGIHHIAFVVK
FT                   DMDRKVEELYRKGMKVIQKGDFEGGRYAYIDTLRALKVMIELLENY"
FT   misc_feature    387335..387694
FT                   /gene="GloA"
FT                   /locus_tag="TTE0360"
FT                   /note="Pfam match to entry Glyoxalase, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily, score 30.1,
FT                   E-value 2.00E-07"
FT   gene            complement(387763..388567)
FT                   /gene="ZnuB"
FT                   /locus_tag="TTE0361"
FT   CDS_pept        complement(387763..388554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ZnuB"
FT                   /locus_tag="TTE0361"
FT                   /product="ABC-type Mn2+/Zn2+ transport systems, permease
FT                   components"
FT                   /note="Best Blastp hit = gi|10174011|dbj|BAB05114.1|
FT                   (AP001511) ABC transporter (permease) [Bacillus
FT                   halodurans], score 173, E-value 2.00E-42"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23651"
FT                   /db_xref="GOA:Q8RCQ5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ5"
FT                   /protein_id="AAM23651.1"
FT                   /translation="MFDIFSYEFMRRAFIAGAIIAVIAPLVGNFLVLRRLSQMGHALSH
FT                   VALAGVAAGILAGIDPTVGSIAIVLLAAFGIEGLRKTYFQYSELSIAIIVSAGMAVAII
FT                   LLNFARGGAVNVMNYLFGSIVSVTYTDVVLISTLGLLVILTIALFYKELLYITFDEEAA
FT                   TISGLPVSAINFLFTILVALTVALAMRIVGALLVSSLMVTPSAASLKIAQSFKQAIIYS
FT                   IIFSFISVFAGIILSFYFDLSPGGTIILISLAIMGITSLKK"
FT   misc_feature    complement(387766..388539)
FT                   /gene="ZnuB"
FT                   /locus_tag="TTE0361"
FT                   /note="Pfam match to entry ABC-3, ABC 3 transport family,
FT                   score 295.4, E-value 7.20E-85"
FT   gene            complement(388547..389335)
FT                   /gene="ZnuC"
FT                   /locus_tag="TTE0362"
FT   CDS_pept        complement(388547..389320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ZnuC"
FT                   /locus_tag="TTE0362"
FT                   /product="ABC-type Mn/Zn transport systems, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|10174010|dbj|BAB05113.1|
FT                   (AP001511) ABC transporter (ATP-binding protein) [Bacillus
FT                   halodurans], score 213, E-value 2.00E-54"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23652"
FT                   /db_xref="GOA:Q8RCQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ4"
FT                   /protein_id="AAM23652.1"
FT                   /translation="MSYIEVKNVNFAYDGRQVLRNVSLKIEKGEFVGIIGPNGSGKSTL
FT                   VKVMVGNLVPSTGEVLYEGVNLQNIKDRSFISYLPQRSFSFNSSFPASVEEVVSMGLYA
FT                   RKGLFKRLSKEDWEKVYEALKIVDMFEFRSRLIGRLSGGQLQRVFIARSIVSEPQILFL
FT                   DEPTTGIDAKSEKALYELLEKLNKERGITIVMVTHDIMAITNKAHRIICMTDGKINEKC
FT                   EAIDIEKHDFTSFLYEYPVKKVKHQHNNNGSVEHV"
FT   regulatory      complement(388563..388567)
FT                   /gene="ZnuB"
FT                   /locus_tag="TTE0361"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(388673..389236)
FT                   /gene="ZnuC"
FT                   /locus_tag="TTE0362"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   188.2, E-value 1.30E-52"
FT   gene            complement(389328..390208)
FT                   /locus_tag="TTE0364"
FT                   /note="authentic frameshift, zinc ABC transporter substrate
FT                   binding protein; Best Blastx hit =
FT                   gb|AAK06213.1|AE006439_10 (AE006439) zinc ABC transporter
FT                   substrate binding protein [Lactococcus lactis subsp.
FT                   lactis], score 94.4, E-value 2.00E-36"
FT   regulatory      complement(389331..389335)
FT                   /gene="ZnuC"
FT                   /locus_tag="TTE0362"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(390234..391127)
FT                   /gene="ZnuA"
FT                   /locus_tag="TTE0365"
FT   CDS_pept        complement(390234..391112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ZnuA"
FT                   /locus_tag="TTE0365"
FT                   /product="ABC-type Mn/Zn transport system, periplasmic
FT                   Mn/Zn-binding (lipo)protein (surface adhesin A)"
FT                   /note="Best Blastp hit =
FT                   gi|12725170|gb|AAK06213.1|AE006439_10 (AE006439) zinc ABC
FT                   transporter substrate binding protein [Lactococcus lactis
FT                   subsp. lactis], score 197, E-value 2.00E-49"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23653"
FT                   /db_xref="GOA:Q8RCQ3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ3"
FT                   /protein_id="AAM23653.1"
FT                   /translation="MKKLVMALVLASMIFTLVSCSTTANSSKPLVYASFYPIYDLTLKI
FT                   AGDKLEVKTIIPPGVEPHDWEPSTKDVAEMTKAKAILYLGLGMDSWIEKVKPNAPNVVF
FT                   YEVSKGVTPIMEGNQPNPHIWLSPKEASIMAKNINDALKQTFPEYKDYFEQNYQSLKNT
FT                   LEELDKKYTDALSNTKHKTFIVYHSAFEYLARDYNLKEEALVGANEEAEVSPARMAEII
FT                   NIIREKQIKYIFTEPLTSPKPIQTIAKETGARVLSLNPIEGLTKEEAKQHKDYIALMKE
FT                   NLENLKKALNE"
FT   misc_feature    complement(390240..391091)
FT                   /gene="ZnuA"
FT                   /locus_tag="TTE0365"
FT                   /note="Pfam match to entry Lipoprotein_4, Periplasmic
FT                   solute binding protein family, score 303.7, E-value
FT                   2.20E-87"
FT   regulatory      complement(391123..391127)
FT                   /gene="ZnuA"
FT                   /locus_tag="TTE0365"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(391132..391562)
FT                   /gene="Fur2"
FT                   /locus_tag="TTE0366"
FT   CDS_pept        complement(391132..391548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fur2"
FT                   /locus_tag="TTE0366"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /note="Best Blastp hit = gi|10174012|dbj|BAB05115.1|
FT                   (AP001511) transcriptional regulator (Fur family) [Bacillus
FT                   halodurans], score 109, E-value 1.00E-23"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23654"
FT                   /db_xref="GOA:Q8RCQ2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ2"
FT                   /protein_id="AAM23654.1"
FT                   /translation="MQKEEALKKLKAHNYKLTPQRELILDIMLSNQGYLSVKDVYEKVR
FT                   EVFPQVSIDTVYRTLSLLKNLNILNEAIIGNNIMYVAKKHLHNHTMRCLKCGRVFEMEI
FT                   CPLELLIDQIKDFEVVDHKIEIVGYCKECRSNPN"
FT   misc_feature    complement(391168..391515)
FT                   /gene="Fur2"
FT                   /locus_tag="TTE0366"
FT                   /note="Pfam match to entry FUR, Ferric uptake regulator
FT                   family, score 102.8, E-value 6.60E-27"
FT   regulatory      complement(391558..391562)
FT                   /gene="Fur2"
FT                   /locus_tag="TTE0366"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            391692..392641
FT                   /locus_tag="TTE0367"
FT   regulatory      391692..391696
FT                   /locus_tag="TTE0367"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        391697..392641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0367"
FT                   /product="MoxR-like ATPases"
FT                   /note="Best Blastp hit = gi|10173218|dbj|BAB04323.1|
FT                   (AP001509) methanol dehydrogenase regulatory protein
FT                   [Bacillus halodurans], score 358, E-value 7.00E-98"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23655"
FT                   /db_xref="GOA:Q8RCQ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ1"
FT                   /protein_id="AAM23655.1"
FT                   /translation="MELEQSEVIERIRKNIEKVIIGKSEVIDLMLTALIASGHVLLEDV
FT                   PGVGKTSLAKALARSIDCDFKRVQFTPDLLPGDLTGINVFNQKIGDFEFKKGPIFTNIL
FT                   LADEINRATPRTQSSLLECMEERQVTVDGVTYKLDRPFFVIATQNPIESYGTFPLPEAQ
FT                   IDRFLMKVKMGYPKREEEKRIIEVFDKKNPLEELKPVCTKEDVLKMQEEYKEVYVDKDV
FT                   SEYILDIVEKTRNMEEIELGASPRATLFLYKTSQAYAYVKGRDFVTPDDVRYIAPFVLA
FT                   HRIILKGSGKLRDIKAEEVIGRILEEVPVPLEK"
FT   misc_feature    391712..392626
FT                   /locus_tag="TTE0367"
FT                   /note="Pfam match to entry Mg_chelatase, Magnesium
FT                   chelatase, subunit ChlI, score 20.2, E-value 1.10E-09"
FT   gene            392647..393806
FT                   /locus_tag="TTE0368"
FT   regulatory      392647..392651
FT                   /locus_tag="TTE0368"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        392661..393806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|1496004|gb|AAB06263.1| (L39876)
FT                   ORF1; PepX [Caldicellulosiruptor saccharolyticus], score
FT                   148, E-value 1.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23656"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCQ0"
FT                   /protein_id="AAM23656.1"
FT                   /translation="MNALWFILVIVALVALQSNLYKKNIFKNLIIEREFERKAVFPGEK
FT                   TALKLTIHNKKFFPITYLKLQQKIPVELSMKKSKLVEKQDKVKYLHNTVLSMLPFQKVT
FT                   RKFEVVATKRGIYNLFDGIKAFSTDLFGAEEYEVELPAPARLIVYPRLIDLKSFRLIAN
FT                   SLYGDLFVRRWIIEDPVIISGVRDYTTSDSFKSINWKVTAKTQKLKVNKYDYTADKKIV
FT                   LFFNVDFHRYVFRVEEIEKFERAIEVAATLSVNLIKEGIPVGFSTNAICLAEGDYTFVE
FT                   PSAGEGQIARLLEIFAGLSFLKKYSVEDMASYLSKTLSWGTDLLVVTPFVDEGMLSLVE
FT                   RFFGDKDVMLVYMSSKGIENVPHNVKLFYYSEEGKEIEVVG"
FT   misc_feature    392994..393572
FT                   /locus_tag="TTE0368"
FT                   /note="Pfam match to entry DUF58, Protein of unknown
FT                   function DUF58, score 73, E-value 6.20E-18"
FT   gene            393728..395094
FT                   /locus_tag="TTE0369"
FT   regulatory      393728..393732
FT                   /locus_tag="TTE0369"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        393772..395094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23657"
FT                   /db_xref="GOA:Q8RCP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP9"
FT                   /protein_id="AAM23657.1"
FT                   /translation="MKRGKKLKWWDREKFVKIFATILEGFLVFLVFTLLNGLIVQEKAV
FT                   PFLAFFVFSFVSGIVNALEYWDIKLYRTFNLAVGIFSSLLLSVKVSENYYQLVADFIVF
FT                   LFLWYRGAKIKSTMVEDVMNIKIFYRNLMWLFFLNLFAYYLPPQEIAMIQKYTILYILL
FT                   SIFLLLEVKALKYHDSEGRISLFEWIGFGLILLATFTFSLPSVAHVIYEIYTVIGKIFV
FT                   LLSTYLAYGMFWILSKIFSLIPFDREFFKKAMESFYKEGKNPENFLQEETPQDYTWLSN
FT                   LLHMAAFLIALTVIVLLIILIIRVISKIEVEKRERDFVEEKEIDINLKDAPFVKKFREA
FT                   RNRILKAAEKIKFYRDNREKVRFYYKKLLISLYQKKALERGNYSVKDVYEKVTASFENV
FT                   REPMERVSRLYEKVRYGKYYPKREEVEEFIKEIGKVMKVKG"
FT   repeat_region   395142..395395
FT                   /note="TLR064, identity:100%, copy 1"
FT   gene            395464..396007
FT                   /gene="BtuR"
FT                   /locus_tag="TTE0370"
FT   regulatory      395464..395468
FT                   /gene="BtuR"
FT                   /locus_tag="TTE0370"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        395477..396007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BtuR"
FT                   /locus_tag="TTE0370"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /note="Best Blastp hit = gi|7462089|pir||B72252
FT                   cob(I)alamin adenosyltransferase - Thermotoga maritima
FT                   (strain MSB8) gi|4982030|gb|AAD36533.1|AE001797_13
FT                   (AE001797) cob(I)alamin adenosyltransferase [Thermotoga
FT                   maritima], score 177, E-value 6.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23658"
FT                   /db_xref="GOA:Q8RCP8"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP8"
FT                   /protein_id="AAM23658.1"
FT                   /translation="MKKGYVQVYTGDGKGKTTAALGLAFRAVGRGMKVIMFQFLKGMAT
FT                   GELKSAELLKPNFEIKRFAESKKFTWDMTEEELQELKSKVREEYEELLRILKSGEYDIV
FT                   IVDEAMAAIHSGLLSVEDVLRLIEEKPKSVELILTGRSAPQEIIEKADLVTEMKEIKHY
FT                   YKKGVPARVGIEI"
FT   misc_feature    395480..396004
FT                   /gene="BtuR"
FT                   /locus_tag="TTE0370"
FT                   /note="Pfam match to entry CobA_CobO_BtuR, ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP, score 191.1, E-value
FT                   1.80E-53"
FT   repeat_region   396064..396318
FT                   /note="TLR064, identity:98%, copy 2"
FT   regulatory      396346..396370
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            396375..397358
FT                   /gene="FecB"
FT                   /locus_tag="TTE0372"
FT   CDS_pept        396375..397358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FecB"
FT                   /locus_tag="TTE0372"
FT                   /product="ABC-type Fe3+-siderophores transport systems,
FT                   periplasmic components"
FT                   /note="Best Blastp hit = gi|7521157|pir||A75169 'probable
FT                   iron (III) ABC transporter, periplasmic-binding protein
FT                   PAB0349 - Pyrococcus abyssi (strain Orsay)'
FT                   gi|5457942|emb|CAB49432.1| '(AJ248284) IRON (III) ABC
FT                   transporter, periplasmic-binding protein, putative
FT                   [Pyrococcus abyssi]', score 265, E-value 8.00E-70"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23659"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP7"
FT                   /protein_id="AAM23659.1"
FT                   /translation="MIDKTKFLDRRVLMKRFKGIVAFLVIFALVFSLAACSTQNATKPQ
FT                   ETAKPAEEVKTQFPLKITDFLGREVTIEKQPERIVSLVPSVTELLFAIGAGSKVVGVTD
FT                   FDNYPPEVKDIPKVGGFKGPNIEAITAQKPDIIFASRLSGKEQMESLEKMGIPVVVLDA
FT                   QNFDQIYQSIELLGKITGNEKKAEKVINDMKNKIKEISDKVKDLPKVKVFYLVSLDGNW
FT                   TAGKGTFIDEIINLAGGENVASDVNGWAQYSIEELVKKNPDVIITSPHAGDVKDLKNMA
FT                   GYKDTNAVKNDKVFVVSNDDIIVRGTNRIVLGLEEVAKFLHPEAFK"
FT   misc_feature    396600..397277
FT                   /gene="FecB"
FT                   /locus_tag="TTE0372"
FT                   /note="Pfam match to entry Peripla_BP_2, Periplasmic
FT                   binding protein, score 200.8, E-value 2.10E-56"
FT   gene            397360..398352
FT                   /gene="BtuC"
FT                   /locus_tag="TTE0373"
FT   CDS_pept        397360..398352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BtuC"
FT                   /locus_tag="TTE0373"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, permease components"
FT                   /note="Best Blastp hit = gi|10957443|ref|NP_051558.1|
FT                   'hemin ABC transporter, permease protein, putative
FT                   [Deinococcus radiodurans]' gi|7473510|pir||G75619 'probable
FT                   hemin ABC transporter, permease protein - Deinococcus
FT                   radiodurans (strain R1)'
FT                   gi|6460872|gb|AAF12576.1|AE001826_45 '(AE001826) hemin ABC
FT                   transporter, permease protein, putative [Deinococcus
FT                   radiodurans]', score 219, E-value 3.00E-56"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23660"
FT                   /db_xref="GOA:Q8RCP6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP6"
FT                   /protein_id="AAM23660.1"
FT                   /translation="MKAKRGFYFTSAFLLLLLIMALSISAGAVHIPLQEILNVLLGKGD
FT                   EVNRRIILTLRLPRVIESALVGMGLSVVGAFFQGLLRNPMADPYVLGISSGAAFGATIA
FT                   IIMGLGIFGLSSMAFITALLTIFFVYTVSRTGSRLSMTTMLLAGIAISAFMSAIISLLM
FT                   LLNHDQFSRIVFWTMGGFGLVSWPQVIYSSPLILIGSFVMYAFSRDVNVILTGEESAEH
FT                   LGVNAELVKKIILILGSLVTASCVSVGGIIGFVGLIVPHISRFIVGPDNRVLVPFSALF
FT                   GASFLTFADLLARVILKPVEMPIGIITATFGGPFFLYLLVRSKQKNEGM"
FT   misc_feature    397438..398325
FT                   /gene="BtuC"
FT                   /locus_tag="TTE0373"
FT                   /note="Pfam match to entry FecCD_family, FecCD transport
FT                   family, score 370.5, E-value 1.70E-107"
FT   gene            398323..399157
FT                   /gene="FepC"
FT                   /locus_tag="TTE0374"
FT   regulatory      398323..398327
FT                   /gene="FepC"
FT                   /locus_tag="TTE0374"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        398339..399157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FepC"
FT                   /locus_tag="TTE0374"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /note="Best Blastp hit = gi|10174204|dbj|BAB05306.1|
FT                   (AP001512) iron(III) dicitrate transport system (permease)
FT                   [Bacillus halodurans], score 196, E-value 2.00E-49"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23661"
FT                   /db_xref="GOA:Q8RCP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP5"
FT                   /protein_id="AAM23661.1"
FT                   /translation="MKECDIMSILEVKDLYFSYGQKRVLKGINLKVDKSEMIGIIGANG
FT                   SGKTTLLRNISGYLKPDKGSVLIFGKNIRSLSVKERAKLIGYVPQDIIYDFEFTCYDIV
FT                   MMGRIPYLRRFQSEGKEDKEIVREAMEMTNTWQFKDKPVRELSGGERQRVYIARALAQR
FT                   PKILLMDEPVSHLDIKYQIEVLSIAKELSLNGILVISVLHDVNLASQFCDEIVIMREGT
FT                   IMAKGEPKKVLTFENIKLAFSIDVQIFEDPITRTPYIIPSLNGKEKLKVV"
FT   misc_feature    398441..399001
FT                   /gene="FepC"
FT                   /locus_tag="TTE0374"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   194.3, E-value 1.90E-54"
FT   gene            399135..400508
FT                   /gene="CobB"
FT                   /locus_tag="TTE0375"
FT   regulatory      399135..399139
FT                   /gene="CobB"
FT                   /locus_tag="TTE0375"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        399150..400508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CobB"
FT                   /locus_tag="TTE0375"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="Best Blastp hit = gi|6685302|sp|O87698|COBB_BACME
FT                   'COBYRINIC ACID A,C-DIAMIDE SYNTHASE'
FT                   gi|11279281|pir||T44692 'cobyrinic acid a,c-diamide
FT                   synthase [imported] - Bacillus megaterium'
FT                   gi|3724047|emb|CAA04316.1| (AJ000758) CbiA protein
FT                   [Bacillus megaterium], score 309, E-value 6.00E-83"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23662"
FT                   /db_xref="GOA:Q8RCP4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCP4"
FT                   /protein_id="AAM23662.1"
FT                   /translation="MCRVFMIAGTHSGAGKTTLSLGIMGVLSKKYNVRPFKVGPDYIDT
FT                   AYHRYVTRNFSVNLDLFMLGEENLKNLFYKNASRADVSIIEGVMGLYDGIDTTSRGSSA
FT                   HIAKLVNVPVVLVVDASSMAASVSALIMGYIYYDKDVDIRGVILNKVGSERHYTLLKEV
FT                   IERDLNIEVFGYLPKDVELELPERHLGLLPVYETENLDKKLEKLYGYIENCIDVEKLMN
FT                   LTVKPPDFIEKEDRVLKEKKVKIAYAYDEAFNFYYKESLETLEEMGAHLIPFSPLDDER
FT                   LPEGTEGLYIGGGFPEVFAKRLSENESMLREIKEAVEKGMPVYAECGGLMYLSKGIRDL
FT                   EGNRYSMVGVYDFEVVMTKKLQRFGYVEAEITMDNVLFKKGERIKGHEFHYSRIEGFSQ
FT                   NASYIVNRPGKEEKWECGFVHKNCLASFVHINLYTYKEGVKRFLDRCSSFGRK"
FT   misc_feature    399159..399851
FT                   /gene="CobB"
FT                   /locus_tag="TTE0375"
FT                   /note="Pfam match to entry CbiA, Cobyrinic acid a,c-diamide
FT                   synthase, score 192.5, E-value 6.50E-54"
FT   gene            400497..402036
FT                   /gene="CobQ"
FT                   /locus_tag="TTE0376"
FT   regulatory      400497..400501
FT                   /gene="CobQ"
FT                   /locus_tag="TTE0376"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        400510..402036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CobQ"
FT                   /locus_tag="TTE0376"
FT                   /product="Cobyric acid synthase"
FT                   /note="Best Blastp hit = gi|543955|sp|Q05597|CBIP_SALTY
FT                   COBYRIC ACID SYNTHASE gi|154436|gb|AAA27268.1| (L12006)
FT                   cobyric acid synthase [Salmonella typhimurium], score 489,
FT                   E-value 1.00E-137"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23663"
FT                   /db_xref="GOA:Q8RCP3"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCP3"
FT                   /protein_id="AAM23663.1"
FT                   /translation="MALKLMIQGTASSVGKSLIVTALCRIFKQDGLKVAPFKSQNMALN
FT                   SYITEEGLEIGRAQAVQAEAAGIKPSYHMNPILLKPSSDKKSQVVLRGRVYENMSAEEY
FT                   FKFRPKLLELIKEDFDFLAKRNDVVVIEGAGSPAEINLKEKDIVNMGLAELVNAPVLLV
FT                   GDIDRGGVFASIAGTMLLLDEKERNRVEGVIINKFRGDIEILKPGLKMLENIIQKEVLG
FT                   VIPYMDVHIDEEDGATDRFYTKCAQGEVDVAIINLPHISNFTDFDPLTKVPGVKIKYVN
FT                   KGERIGDCDVLIIPGTKNTIGDLKVLKDYGLDKEILNLREKGKFIVGICGGFQMLGKVI
FT                   KDPYHIESDTEEMEGLGLLSIETVIEREKTTSETKAFLGEELPDTLSSLKGLFVTGYEI
FT                   HMGESYILGKGKHFSIVVERNKEKVKVLDGAVSEDGRVFGTYIHGIFENSLFTKEFINI
FT                   VRKEKGLTPLEEVINYREFREKEYDRLANIVRNSLDMERIYQIMERYRDK"
FT   misc_feature    400519..401211
FT                   /gene="CobQ"
FT                   /locus_tag="TTE0376"
FT                   /note="Pfam match to entry CbiA, Cobyrinic acid a,c-diamide
FT                   synthase, score 293.5, E-value 2.50E-84"
FT   gene            402014..402983
FT                   /gene="CbiB"
FT                   /locus_tag="TTE0377"
FT   regulatory      402014..402018
FT                   /gene="CbiB"
FT                   /locus_tag="TTE0377"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        402033..402983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiB"
FT                   /locus_tag="TTE0377"
FT                   /product="Cobalamin biosynthesis protein CobD/CbiB"
FT                   /note="Best Blastp hit = gi|543942|sp|Q05600|CBIB_SALTY
FT                   CBIB PROTEIN gi|154421|gb|AAA27253.1| (L12006) putative
FT                   [Salmonella typhimurium], score 239, E-value 3.00E-62"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23664"
FT                   /db_xref="GOA:Q8RCP2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP2"
FT                   /protein_id="AAM23664.1"
FT                   /translation="MKVFLAYILDLILGDPEGYPHPVRLIGSLISKEERIIRKYAKGER
FT                   ALKIAGFVMCFLTIATVYFTTYFALYLAGIINRYFQYLLEVVFIYTTLATKDLAKAAYR
FT                   VFKPLEEKDLETARKKLSLIVSRDTEKLEEKDIIRGVLETVSENISDGIIAPMFYAFLG
FT                   GAPLAMLYKAASTLDSMVGYKNEKYKDLGFASAKLDDILNFIPARITGVLIVVSSFLLG
FT                   YDYKNSFRIFMRDRLKHESPNSAHGEAALAGALGVELGGINYYFGKPVIKPRLGDKKVD
FT                   LSLKHIKDSVKIMYMTSFIGLIVFYLLENFFKKLI"
FT   gene            402985..403480
FT                   /locus_tag="TTE0378"
FT   regulatory      402985..402989
FT                   /locus_tag="TTE0378"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        402998..403480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23665"
FT                   /db_xref="GOA:Q8RCP1"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP1"
FT                   /protein_id="AAM23665.1"
FT                   /translation="MKEKEVSLGNVKTLTLVAMLIALSAVGALIKIFNTVAFDSMPGYF
FT                   AALYLGSLYGAIVIALGHLLTAVTSGFPLGVLNHLYIALQMAVYAYLFRVFYKKFNVYV
FT                   AIVLTTLLNGPLATLLFVPMFGWGFFITWVFPLTIASFINISLAALIYKILSKKEQ"
FT   gene            403470..404212
FT                   /locus_tag="TTE0379"
FT   regulatory      403470..403474
FT                   /locus_tag="TTE0379"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        403484..404212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10173468|dbj|BAB04572.1|
FT                   (AP001510) BH0853; unknown [Bacillus halodurans], score
FT                   105, E-value 4.00E-22"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23666"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCP0"
FT                   /protein_id="AAM23666.1"
FT                   /translation="MIERYRDLVIIYEKDVAFVVSCDSVGAIGSKENDILKVDEEIVGR
FT                   TTLKVALSELLSVGATPLVVSDTLSVEMYPTGEKILKGIKKELEENGLEVVLTGSTEEN
FT                   FPTSMTGIGITAVGRARKEDLKIKKARKGMHVVLIGYPRVGSEVLGAEDVMTLKDYIKI
FT                   SQTKEVVEAIPVGSKGIAYELGVLEDLYGFRIKEDDGLNIDLFKSAGPATCCLVVYREE
FT                   DTDFIKAITDKPFTHVGIIE"
FT   gene            404209..405312
FT                   /gene="HisC"
FT                   /locus_tag="TTE0380"
FT   CDS_pept        404209..405312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HisC"
FT                   /locus_tag="TTE0380"
FT                   /product="Histidinol-phosphate aminotransferase/Tyrosine
FT                   aminotransferase"
FT                   /note="Best Blastp hit = gi|1895094|gb|AAC79515.1| (U90625)
FT                   CobD [Salmonella typhimurium], score 179, E-value 5.00E-44"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23667"
FT                   /db_xref="GOA:Q8R5U4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5U4"
FT                   /protein_id="AAM23667.1"
FT                   /translation="MKEGEKMKPYEHGGNIYDYQGNLIDFSSNINPLGPPEWIWEAIKE
FT                   VDLSRYPDIKYRRLKEAIAEYVGCDRENIIVGNGAAELIHLFARAFKLKKPLIPSPSFL
FT                   EYERAVKLNGGEPVYLKLEEEEGFRVNFAKVISKIEEADGLILGNPNNPTGQGIIREEI
FT                   GILLKKAELMNIPVLIDEAFIEFMKDYKKYEALPLVKKHDKLFVVRAVTKFFGMPGIRL
FT                   GYGIGSPSLIQKLEEYKEPWTVNAFAEAVGRWLFKDREYIEKTREYVNAEIEHMLFSLR
FT                   TIDYLVAFDTKVNFILLKLKAGTVDEVKEKLLKKGILIRDASNFRYLDKRFFRVAVKRR
FT                   EDNMCLIEALRGLYEEGVMPDKERVVV"
FT   misc_feature    404215..405276
FT                   /gene="HisC"
FT                   /locus_tag="TTE0380"
FT                   /note="Pfam match to entry aminotran_1, Aminotransferase
FT                   class-I, score -44.7, E-value 1.60E-07"
FT   misc_feature    404410..405207
FT                   /gene="HisC"
FT                   /locus_tag="TTE0380"
FT                   /note="Pfam match to entry aminotran_2, Aminotransferase
FT                   class-II, score 18.9, E-value 4.00E-08"
FT   gene            405312..405860
FT                   /gene="CobU"
FT                   /locus_tag="TTE0381"
FT   CDS_pept        405312..405860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CobU"
FT                   /locus_tag="TTE0381"
FT                   /product="Adenosyl cobinamide kinase/adenosyl cobinamide
FT                   phosphate guanylyltransferase"
FT                   /note="Best Blastp hit = gi|7471254|pir||G75594 cobinamide
FT                   kinase/cobinamide phosphate guanylyltransferase -
FT                   Deinococcus radiodurans (strain R1)
FT                   gi|6460576|gb|AAF12282.1|AE001862_108 (AE001862) cobinamide
FT                   kinase/cobinamide phosphate guanylyltransferase
FT                   [Deinococcus radiodurans], score 147, E-value 1.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23668"
FT                   /db_xref="GOA:Q8RCN9"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN9"
FT                   /protein_id="AAM23668.1"
FT                   /translation="MGLIMVTGGARSGKSEFAEKLAYERGKDEVLYIATSLPVDEEMKE
FT                   RIKRHRERRPSSWETVEAYKDLDKEILKRKKKVVLIDCLTVMISNLLMEVDLTWENSTL
FT                   EQIDEIEDRISQEVDKILIVSSGVEIIIVTNEVGMGLVPEYKLGRIFRDIAGRMNKKVA
FT                   EASKEVYLMISGIPVKIKG"
FT   misc_feature    405321..405851
FT                   /gene="CobU"
FT                   /locus_tag="TTE0381"
FT                   /note="Pfam match to entry CobU, Cobinamide kinase /
FT                   cobinamide phosphate guanyltransferase, score 222.4,
FT                   E-value 6.50E-63"
FT   gene            405853..406611
FT                   /gene="CobS"
FT                   /locus_tag="TTE0382"
FT   regulatory      405853..405857
FT                   /gene="CobS"
FT                   /locus_tag="TTE0382"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        405865..406611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CobS"
FT                   /locus_tag="TTE0382"
FT                   /product="Cobalamin-5-phosphate synthase"
FT                   /note="Best Blastp hit = gi|11354471|pir||A82224 cobalamin
FT                   5'-phosphate synthase (EC 6.-.-.-) VC1238 [imported] -
FT                   Vibrio cholerae (group O1 strain N16961)
FT                   gi|9655720|gb|AAF94397.1| (AE004203) cobalamin
FT                   (5`-phosphate) synthase [Vibrio cholerae], score 100,
FT                   E-value 1.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23669"
FT                   /db_xref="GOA:Q8RCN8"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCN8"
FT                   /protein_id="AAM23669.1"
FT                   /translation="MEELKALILSIQFMTGIPIPINIDVKEDKIYKIASYFPVVGLLIG
FT                   GILYIAYLLLKDLFSREIVMTFLVAFSYILTRGMHIDGLADTFDGLFSNKDREKIIEIM
FT                   KDSRLGTNGVLALVFMVILKILFLSDIRQSLLFSALLVSPVIARLSVVFSIAISKSARG
FT                   GKGLGGLLLERAGLREFVIALLISTIAGYFVMPLKDLALLYVISLSFTCLISKYISKKI
FT                   GGMTGDTLGAVNEFVELIAFIYFSIL"
FT   misc_feature    405874..406599
FT                   /gene="CobS"
FT                   /locus_tag="TTE0382"
FT                   /note="Pfam match to entry CobS, Cobalamin-5-phosphate
FT                   synthase, score 120.1, E-value 4.00E-32"
FT   gene            406673..406983
FT                   /locus_tag="TTE0383"
FT   regulatory      406673..406677
FT                   /locus_tag="TTE0383"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        406687..406983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0383"
FT                   /product="cobalt transport ATP-binding protein"
FT                   /note="Best Blastp hit = gi|11346281|pir||T45265 cobalt
FT                   transport ATP-binding protein O homolog [imported] -
FT                   Methanobacterium thermoautotrophicum
FT                   gi|1419078|emb|CAA63958.1| (X94292) cbiO
FT                   [Methanothermobacter thermautotrophicus], score 67, E-value
FT                   6.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23670"
FT                   /db_xref="GOA:Q8RCN7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN7"
FT                   /protein_id="AAM23670.1"
FT                   /translation="MLDRLKEEGKTIIVFTHDVDFAYSWADYIYVMKDGRIIREGVPEE
FT                   VFINKIDNGKLKKPLILEVYEVLKEKGIIKGNKMPRNVEELERLIKERTVPNI"
FT   regulatory      406964..406994
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(406964..406994)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(407007..407836)
FT                   /gene="HflC"
FT                   /locus_tag="TTE0384"
FT   CDS_pept        complement(407007..407786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HflC"
FT                   /locus_tag="TTE0384"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /note="Best Blastp hit = gi|11499015|ref|NP_070249.1|
FT                   membrane protein [Archaeoglobus fulgidus]
FT                   gi|6647985|sp|O28852|YE20_ARCFU HYPOTHETICAL PROTEIN AF1420
FT                   gi|7447605|pir||C69427 membrane protein homolog -
FT                   Archaeoglobus fulgidus gi|2649154|gb|AAB89829.1| (AE001006)
FT                   membrane protein [Archaeoglobus fulgidus], score 251,
FT                   E-value 5.00E-66"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23671"
FT                   /db_xref="GOA:Q8RCN6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN6"
FT                   /protein_id="AAM23671.1"
FT                   /translation="MKVIESLAFLFTLAIILISLISASIRIVQEYERGVIFRLGRYVGV
FT                   RGPGIFFLIPIIERMQKVDLRVVTMEVPTQEAITKDNVTIKVNAVVYFRVVDPANAVIK
FT                   VLDHIRATSQLAQTTLRSVLGQSDLDELLSHRDEINKRLREIIDEGTEPWGVKVNLVEI
FT                   RDVELPQSMQRAMAAQAEAERERRAKIISADGEYQAAAKLADAARIISSEPAALQLRYL
FT                   QTLREIANDRSNIVIFPFSLDVLQQFFPQAQKKEKDE"
FT   misc_feature    complement(407190..407759)
FT                   /gene="HflC"
FT                   /locus_tag="TTE0384"
FT                   /note="Pfam match to entry Band_7, SPFH domain / Band 7
FT                   family, score 359.6, E-value 3.40E-104"
FT   gene            complement(407773..409112)
FT                   /locus_tag="TTE0385"
FT   CDS_pept        complement(407773..409098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0385"
FT                   /product="Membrane-bound serine protease (ClpP class)"
FT                   /note="Best Blastp hit = gi|7451698|pir||H70456 nodulation
FT                   competitiveness protein NfeD - Aquifex aeolicus
FT                   gi|2984101|gb|AAC07639.1| (AE000757) nodulation
FT                   competitiveness protein NfeD [Aquifex aeolicus], score 261,
FT                   E-value 1.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23672"
FT                   /db_xref="GOA:Q8RCN5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN5"
FT                   /protein_id="AAM23672.1"
FT                   /translation="MFTMRKILLTTILLVFIILPPSSLQATSTQNPVYVLTVDGPIVPV
FT                   VADYIESGFKAAERDGASCIVIELSTPGGLYTTTQKIVTQILNSPIPVVVYVSPAGAWA
FT                   GSAGTFITLSANIAAMAPGSRIGAAHPVSIEDDSAMSEIQRQKITHDAAAWIRSIAENR
FT                   GRDPKNAEMAVVESRSFTDTEALNANLIDLRANNLNDLLKKINGKTVKNFDGTTITLKT
FT                   DGPIRYYPMTSVQKFLFAISDPNIAYLLMSAGILGIILELYHPGAIFPGVAGGISLLLG
FT                   LYTLGTLDAQLSGMLLVILGLVLLASEAFVVSHGILAVGGIISFVLGSLMLFSGNQMGL
FT                   TINKGVVFATAFFMAAFVSFLLAAVIRAQKRKVVTGIEGMIGEFGTAVTDIAPKGTVLV
FT                   EGERWQAVSKEPIKKGEKVVIIGVEGLTLKVQKVKEGGNESD"
FT   misc_feature    complement(407803..409089)
FT                   /locus_tag="TTE0385"
FT                   /note="Pfam match to entry DUF107, Protein of unknown
FT                   function DUF107, score 463.5, E-value 1.80E-135"
FT   regulatory      complement(407832..407836)
FT                   /gene="HflC"
FT                   /locus_tag="TTE0384"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(409108..409112)
FT                   /locus_tag="TTE0385"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            409259..409983
FT                   /locus_tag="TTE0386"
FT   regulatory      409259..409263
FT                   /locus_tag="TTE0386"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        409273..409983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23673"
FT                   /db_xref="GOA:Q8RCN4"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN4"
FT                   /protein_id="AAM23673.1"
FT                   /translation="MAFFKIETEEDIKNLNFFERIYGILFKPSVTIKNLMYQPKLVYPA
FT                   VVKIGGIVFLYLLRYPVYVKHIRELLKMRLSQPDAGFTPQEIELAMKLAPKSVITSTLI
FT                   NNLLSWLFVVLAVYAIIKWVFRGRADVSELFSITGYAYTPVLIYFLICFIASFFTGELL
FT                   VDMSPALLFPSLKGTTTYGFLRSIDPFMIWQFVIVWIGIKMSSRMNNSDVTWVTVFAFL
FT                   VTVFVNIDYYKLLD"
FT   regulatory      409997..410027
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(409997..410027)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(410034..411258)
FT                   /gene="Icd"
FT                   /locus_tag="TTE0387"
FT   CDS_pept        complement(410034..411245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Icd"
FT                   /locus_tag="TTE0387"
FT                   /product="Isocitrate dehydrogenases"
FT                   /note="Best Blastp hit = gi|7431248|pir||H72288 isocitrate
FT                   dehydrogenase - Thermotoga maritima (strain MSB8)
FT                   gi|4981696|gb|AAD36224.1|AE001772_3 (AE001772) isocitrate
FT                   dehydrogenase [Thermotoga maritima], score 536, E-value
FT                   1.00E-151"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23674"
FT                   /db_xref="GOA:Q8RCN3"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN3"
FT                   /protein_id="AAM23674.1"
FT                   /translation="MAQKIEMKVPIVEMDGDEMTRIIWKLIKEMLIKPYVDLKTEYYDL
FT                   GIKNRDETEDQVTVDAAYAIKKYGVGVKCATITPNAERVKEYNLKNMWKSPNATIRSIL
FT                   DGTVFRTPILVEGIKPLVRTWKKPITIARHAYGDIYKGVEYRIPEKGKAELVFTSEKGE
FT                   EIRYAIHEFETPGVILGMHNTDESIKSFARACFNYALDTKQDLWFATKDTISKIYDHRF
FT                   KDIFQEIYENEYKEKFEEAGIEYFYTLIDDAVARIVRSEGGMIWACKNYDGDVMSDMVA
FT                   TAFGSLAMMTSVLVSPDGKYEFEAAHGTVTRHYYKYLKGEETSTNPIATIFAWTGALKK
FT                   RGELDGIKDLVDFADKLEKASLKTVEKGIMTKDLAALSELPNKTVVNTETFLIEIKKTL
FT                   EEML"
FT   misc_feature    complement(410061..411230)
FT                   /gene="Icd"
FT                   /locus_tag="TTE0387"
FT                   /note="Pfam match to entry isodh, Isocitrate and
FT                   isopropylmalate dehydrogenases, score 266.7, E-value
FT                   4.80E-79"
FT   regulatory      complement(411254..411258)
FT                   /gene="Icd"
FT                   /locus_tag="TTE0387"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            411439..412554
FT                   /gene="ArgE"
FT                   /locus_tag="TTE0388"
FT   regulatory      411439..411443
FT                   /gene="ArgE"
FT                   /locus_tag="TTE0388"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        411451..412554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgE"
FT                   /locus_tag="TTE0388"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /note="Best Blastp hit = gi|7519001|pir||C71057
FT                   hypothetical protein PH1153 - Pyrococcus horikoshii
FT                   gi|3257570|dbj|BAA30253.1| (AP000005) 354aa long
FT                   hypothetical protein [Pyrococcus horikoshii], score 121,
FT                   E-value 1.00E-26"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23675"
FT                   /db_xref="GOA:Q8R5U3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U3"
FT                   /protein_id="AAM23675.1"
FT                   /translation="MIEAKELLKALIKKASTDPQRGALIPIISALQSIGLDWKLEMIEE
FT                   DMYNILLPLSSSPKLIVEVHYDVVPSVIEGYQTKEGEENGRIYGRGTSDVLGGVAILLE
FT                   VLKRLGREFPWERAGVWIAFVADEEKGGKGSRHLASSLPSTIQYALVIEPTQSKLAFSS
FT                   CGALEYELIIKGVPSHGSIPERGKNSITWTSRFIIKMEETLSKLNNLYNPDIPIQITPL
FT                   FISGGSEEYSVPHETRLNFDIRIPPKVPISDVEKEVNSLLENDKDVEVHCKLVEEWAPS
FT                   WETDEDTDFGQLLQKLYKEVYNEEPIFKVMESWTDAHNFWAKGIKPVIWGPGDLALAHT
FT                   PFEYIDIQELEKGKEFLEKFFYRLLEF"
FT   misc_feature    411616..412392
FT                   /gene="ArgE"
FT                   /locus_tag="TTE0388"
FT                   /note="Pfam match to entry Peptidase_M20, Peptidase family
FT                   M20/M25/M40, score 88.6, E-value 1.70E-24"
FT   gene            complement(412540..413038)
FT                   /gene="WecD"
FT                   /locus_tag="TTE0389"
FT   CDS_pept        complement(412540..413025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WecD"
FT                   /locus_tag="TTE0389"
FT                   /product="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /note="Best Blastp hit = gi|7429961|pir||H70428 conserved
FT                   hypothetical protein aq_1482 - Aquifex aeolicus
FT                   gi|2983873|gb|AAC07426.1| (AE000742) hypothetical protein
FT                   [Aquifex aeolicus], score 121, E-value 6.00E-27"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23676"
FT                   /db_xref="GOA:Q8RCN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN2"
FT                   /protein_id="AAM23676.1"
FT                   /translation="MENIEIIPVTEKSILSNFKKYLIKIYFEAYSSFPQYAYTHPREVK
FT                   GYLQWLFNHSQGGFFVALEDTMPIGFISTDPSWEDHWLGEKVGEIHEIVVSPSSQKKGI
FT                   GTLLLKKGIEFLQEKGHHTIGLWVGIENSKAQDFYKKHGFTPGPQAGKWLRMYLKLK"
FT   misc_feature    complement(412591..412848)
FT                   /gene="WecD"
FT                   /locus_tag="TTE0389"
FT                   /note="Pfam match to entry Acetyltransf, Acetyltransferase
FT                   (GNAT) family, score 84.7, E-value 1.90E-21"
FT   regulatory      complement(413034..413038)
FT                   /gene="WecD"
FT                   /locus_tag="TTE0389"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            413484..414101
FT                   /locus_tag="TTE0390"
FT   regulatory      413484..413488
FT                   /locus_tag="TTE0390"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        413496..414101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN1"
FT                   /protein_id="AAM23677.1"
FT                   /translation="MKKISIILMIFVLSTLLFTACNTESTDTKTDDYIINTVKKVEILD
FT                   HKFSNYFLTYEEYLKGLKDLFVNAFDENKHYERKYAEIDIRNFTDEQLKNIREKYIKEN
FT                   KEDKVEVEISKIYSDGKYKYVFTKANIIQPYMPKNKENITGIVITRKYAFVKENNDWKI
FT                   QYIDQALYSNNIPFEKMEYNKFNNKLVQYITKFDPLEN"
FT   gene            414126..414563
FT                   /locus_tag="TTE0391"
FT   regulatory      414126..414130
FT                   /locus_tag="TTE0391"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        414141..414563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCN0"
FT                   /protein_id="AAM23678.1"
FT                   /translation="MKKILMFFSVAVLIVLSSGIVFANVGNDNIIPLKDTSKIKSQIEP
FT                   LYVVYCPGGSPDGKHHFYRSGRNTSITLKDSSNRTVGTWWGIPCQCKYCGSQMSLSLDY
FT                   SNYINSSDIYYDGWFGLWAYITSIHPVNPEEMVLFK"
FT   repeat_region   414656..415174
FT                   /note="TLR070, identity:90%, copy 1"
FT   gene            414863..415240
FT                   /locus_tag="TTE0392"
FT   CDS_pept        414863..415240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23679"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM9"
FT                   /protein_id="AAM23679.1"
FT                   /translation="MPLVVLNSGDLQKKIHKNKELIEAFHMSVEEDWVKGEYLFLLTDI
FT                   EGDLLDVKCSTKEKKCIKNSGFEPGVSFREESCGTNAISMAMRLKRVVYVRPKEHYCDI
FT                   TLLLTDLFQSRQRRRFILSQF"
FT   gene            415369..416584
FT                   /gene="ProP"
FT                   /locus_tag="TTE0395"
FT   regulatory      415369..415373
FT                   /gene="ProP"
FT                   /locus_tag="TTE0395"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        415385..416584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ProP"
FT                   /locus_tag="TTE0395"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /note="Best Blastp hit = gi|2851676|sp|P42112|YXAM_BACSU
FT                   HYPOTHETICAL 44.7 KDA PROTEIN IN ASNH-GNTR INTERGENIC
FT                   REGION gi|7474438|pir||D70072 antibiotic resistance protein
FT                   homolog yxaM - Bacillus subtilis gi|2280498|dbj|BAA21592.1|
FT                   (AB005554) probable transporter [Bacillus subtilis]
FT                   gi|2636539|emb|CAB16029.1| (Z99124) similar to antibiotic
FT                   resistance protein [Bacillus subtilis], score 100, E-value
FT                   3.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23680"
FT                   /db_xref="GOA:Q8RCM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM8"
FT                   /protein_id="AAM23680.1"
FT                   /translation="MQNLKRNERFFLTVTLFSSFFTSLMAPFWVIYFNKINLDFSQISL
FT                   LIIINHIAVILFEIPTGALADTYSRKFSVLLSLLIGSLTSIGIYFNTSFTVLLFLYFLS
FT                   GVGATLNSGAFESWFADSFLLGQKEMDLTKYWGRLTSFNYLGSTIGFLGGSVLVRYNIF
FT                   REIWLIEGIGIFLVFIYVFLAGKEAKLQKKTDEYSYREYFNKIAKGTVYLFKHRILLSI
FT                   TVGSFFFFFSSGIMSMLWQPYFERAGIPVELFGIILALTMVLSIFVPRYADRIAERFGG
FT                   AARTLMIVSITSALFIFMMYAIPKYSFIPYIIYTAVYSAHTPIFMSYFNKLIPSSERAT
FT                   IISIYSLFISVSTILCTYSFGILSDKKGLYAALFLSLITALISSIPFKRAIGLEKELCL
FT                   "
FT   gene            416708..417051
FT                   /locus_tag="TTE0396"
FT   regulatory      416708..416712
FT                   /locus_tag="TTE0396"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        416719..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7445672|pir||C71182 probable
FT                   ABC transporter ATP-binding protein - Pyrococcus horikoshii
FT                   gi|3258167|dbj|BAA30850.1| (AP000007) 580aa long
FT                   hypothetical ABC transporter ATP-binding protein
FT                   [Pyrococcus horikoshii], score 91.7, E-value 3.00E-18"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23681"
FT                   /db_xref="GOA:Q8RCM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM7"
FT                   /protein_id="AAM23681.1"
FT                   /translation="MEALKKAGLLDWFKELPEGFDTKIGQTRKLISGGERSRLSIARMI
FT                   LFDPEILLLDEPLVGVDQERKEEIFDTLKELLKSKTCILVTHDKSLLRIADRTIYMKEE
FT                   DAVWLI"
FT   gene            417216..417960
FT                   /gene="CcmA"
FT                   /locus_tag="TTE0398"
FT   regulatory      417216..417220
FT                   /gene="CcmA"
FT                   /locus_tag="TTE0398"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        417223..417960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CcmA"
FT                   /locus_tag="TTE0398"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|7445673|pir||C71197 probable
FT                   ATP-binding transport protein - Pyrococcus horikoshii
FT                   gi|3258287|dbj|BAA30970.1| (AP000007) 318aa long
FT                   hypothetical ATP-binding transport protein [Pyrococcus
FT                   horikoshii], score 142, E-value 3.00E-33"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23682"
FT                   /db_xref="GOA:Q8RCM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM6"
FT                   /protein_id="AAM23682.1"
FT                   /translation="MIDLLTVKNLYKKYNKSKIIALNNVSMDINKGEIVGLLGPNGAGK
FT                   TTLLKITCGLTIPDSGEVIISNIKMEDKTRLKIMEKIGVVLEGNRNLYWAISVLDNYYY
FT                   FGSIKGKTGREIKKNIEKYADILKTKELLTRKVNTLSMGQKQRVAITASLLHEPELLIL
FT                   DEPSNGLDIESRILLTSAIKTLREEMKITVLIASHDTDFLRKTVDRFIIINNGNIVDEF
FT                   ANINITAEDIENKYKIHANLKEA"
FT   misc_feature    417316..417870
FT                   /gene="CcmA"
FT                   /locus_tag="TTE0398"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   174.7, E-value 1.50E-48"
FT   gene            417950..418742
FT                   /locus_tag="TTE0399"
FT   regulatory      417950..417954
FT                   /locus_tag="TTE0399"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        417963..418742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23683"
FT                   /db_xref="GOA:Q8RCM5"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM5"
FT                   /protein_id="AAM23683.1"
FT                   /translation="MFKYLNIVIAEIRRSLKESFSYKMGLVSDIVVLTLLYAGLIFMDT
FT                   GSMLGEYYNNPGNSKTLLLLGYIFWSYSIAAISGVSNEISIEAVKGTLEQKFMAVIPYP
FT                   FLIAGNIISSLLLSSIVAAVIIAFSNLIMGVSITVNEKVILSLLMTLVGMYGMGLILGG
FT                   LSLIAKRINQLTLLIQILLLFVTDTLSKTSPSSAISCIIPLTVGNDIARKSVSNIAISY
FT                   NEWLMLILVSMLWFVVGSVVFGMSSRYARKNGLLGTY"
FT   gene            complement(418788..419484)
FT                   /gene="GlpG"
FT                   /locus_tag="TTE0400"
FT   CDS_pept        complement(418788..419471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlpG"
FT                   /locus_tag="TTE0400"
FT                   /product="uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /note="Best Blastp hit = gi|7462304|pir||G72297 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981632|gb|AAD36164.1|AE001768_13 (AE001768) conserved
FT                   hypothetical protein [Thermotoga maritima], score 174,
FT                   E-value 1.00E-42"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23684"
FT                   /db_xref="GOA:Q8RCM4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM4"
FT                   /protein_id="AAM23684.1"
FT                   /translation="MFPIRDNIPSRRPPVITLSLIIINSLIFFTLSSASYSTFAEFVYK
FT                   YGLIPAKITKLIISGVPLSGSNLYPFITSMFLHGNTFHLISNMWILWLFGDNVEDRMGH
FT                   IRFLIFYLLSGVIAGVFHLVFNPISPVPVVGASGAIAGIMGAYFVLFPSARIITLVPSF
FT                   FLVPVFLPIPAVVYLFLWFLTQLYSGMVYSVIGGTTVGGIAWWAHIGGFISGVLLNRFF
FT                   LRDRY"
FT   misc_feature    complement(418791..419288)
FT                   /gene="GlpG"
FT                   /locus_tag="TTE0400"
FT                   /note="Pfam match to entry Rhomboid, Rhomboid family, score
FT                   115.4, E-value 1.10E-30"
FT   regulatory      complement(419480..419484)
FT                   /gene="GlpG"
FT                   /locus_tag="TTE0400"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   419632..421202
FT                   /note="TLR073, identity:100%, copy 1"
FT   gene            complement(419632..421119)
FT                   /locus_tag="TTE0401"
FT   CDS_pept        complement(419632..421107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0401"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10566910|dbj|BAB16031.1|
FT                   (AB030747) transposase [Streptococcus pyogenes], score 411,
FT                   E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23685"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM3"
FT                   /protein_id="AAM23685.1"
FT                   /translation="MLSKKEDARHQIEFVSIDQLVPQDHLLRKIEKVIDFSFIYDLVKD
FT                   KYSEGHGRPSIDPVVLIKILFIQYLFGIPSMRRTIAEIKTNVAYRWFLGYGLTEEIPHF
FT                   STFSQNYIRRFKGTDIFEKIFTKILEEAIKHGLVNAEEVFIDSTHVKASANKKKYTKEI
FT                   VEQEARTYQEKLEEEINKDREAHGKKPLKKIKKIKTKEVKVSKTDPDSGMLNKNGKEKI
FT                   FAYSFHTACDKNGFVLGVKVEAANVHDSVMFQEVLEEVEKRVRKPKAIAVDAGYKNPYI
FT                   LKTIFDRQIIPAVPYTRPKTKDGFMKKHEFVYDEYYDCYICPQNEILTYVTTNREGYRE
FT                   YKSNPEKCKNCPLREKCTQSKDYTKRIFRHIWEGYVEEAEHLRHTPYCKEVYERRKETI
FT                   ERVFADLKEKHGLRWTTLRGKEKLSMQAMLVFAAMNLKKMALWLWRKGKGPFDISKLYP
FT                   LFGVLKKILSRYIQPLLSVLRKQGLKFCFVNKL"
FT   regulatory      complement(421115..421119)
FT                   /locus_tag="TTE0401"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(421211..422802)
FT                   /note="TLR008, identity:92%, copy 3"
FT   gene            complement(421293..422771)
FT                   /locus_tag="TTE0402"
FT   CDS_pept        complement(421293..422771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23686"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCM2"
FT                   /protein_id="AAM23686.1"
FT                   /translation="MKKTRDNPCDKIDCGKPKNTKGVSLVKKHIFEDIILQNALNFTEE
FT                   VVEIFGDLLNKGMNITELVARIKELTDKLGRGAIEAIIEELDRIIKEDKRRKEKWVVER
FT                   KDKKRLTTVLGDIEYERTYYKSKEDGRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEE
FT                   SYERSSKKACPEELSKQTVLNAIREIGEVEVKREIKEKKEVRGLYIEADEDHVPLQDGR
FT                   DETPRLVYIHEGREEKNGRNVLKNVYYKAYVGEKPEDIWIDVANYIEDNYKEEKIEKIY
FT                   IAGDGAPWIKEGLKWILKSRFVLDRYHLNKYVLKATSKEPKYRDKIWRAINEGDKEGVK
FT                   KVFDELIKAAEEEREKEKIKEAKKYILNNWEGIKIYSEDEDVIGCSAEGHISHVFSARL
FT                   SRNPLGWSREGLKLMAKLRVFSKNGGDLREVEWGKKKNINAGSYKLTKKQIKEAVRRVK
FT                   TSTNEKINNITVLNIGKVTPIYRVLRALKYAQVI"
FT   repeat_region   422803..423839
FT                   /note="TLR070, identity:100%, copy 2"
FT   gene            422952..423411
FT                   /locus_tag="TTE0403"
FT   regulatory      422952..422956
FT                   /locus_tag="TTE0403"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        422965..423411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10174444|dbj|BAB05545.1|
FT                   (AP001513) transcriptional activator of the acetoin
FT                   dehydrogenase operon [Bacillus halodurans], score 75.9,
FT                   E-value 3.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23687"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H8"
FT                   /protein_id="AAM23687.1"
FT                   /translation="MNFLCPQEELISSYERCREIGIDPSITLPLVILNQEDLQKKIHKN
FT                   KELIEAFHMSVEEDWVKGEYLFLLSDFEGYLLDVKCSTKEKKCIKDSGFEQGVSFREES
FT                   CGTNAISMAMRLKRVVYVRPKEHYCDIFKKWHCIASPIMVENGK"
FT   gene            423410..423746
FT                   /locus_tag="TTE0404"
FT   regulatory      423410..423414
FT                   /locus_tag="TTE0404"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        423420..423746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23688"
FT                   /db_xref="GOA:Q8RCM1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM1"
FT                   /protein_id="AAM23688.1"
FT                   /translation="MDISTIDKKIADEVSMVIKLLAEKIATEYEKIVKEKELNEIKIKL
FT                   NDSQIKMLALEAKGYRELDIAEALGIGVVTVKYHKRKIVEKLGVKNIKGAVIKAIKLGL
FT                   VDLD"
FT   gene            423893..424267
FT                   /locus_tag="TTE0405"
FT   regulatory      423893..423897
FT                   /locus_tag="TTE0405"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   423904..425924
FT                   /note="TLR076, identity:100%, copy 1"
FT   CDS_pept        423905..424267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23689"
FT                   /db_xref="GOA:Q8RCM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCM0"
FT                   /protein_id="AAM23689.1"
FT                   /translation="MENLNVNKKENEVIESENKRDIKRTLKTIYFLIAEGGLVCLLAVG
FT                   FNTLKMEYNFVYGILLAILSFPVFAGVVYYPLRKYASENLQFINASVDGFISDLILVLS
FT                   FLFFILIFKIPLLKLG"
FT   gene            424276..425924
FT                   /locus_tag="TTE0406"
FT   regulatory      424276..424280
FT                   /locus_tag="TTE0406"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        424290..425924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23690"
FT                   /db_xref="GOA:Q8RCL9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL9"
FT                   /protein_id="AAM23690.1"
FT                   /translation="MSKKRIIKIVLAVIMVIGAAFFLSYMIFYNPSYSYSEVYNKYYKN
FT                   LKDIDLAKGLTTEQKLEDFEYLYNTLQKNYPFFEVGKRKTGFDWLSRKEEFEKRIRETK
FT                   NNIEFYNEIKRMVTLLQVAHARLVSPELFEMFKKALDMPITDGKMKELDPFQNPIIIKD
FT                   YEYWKQNIKETTYILPIAFSYIEGKYVAIPYNKNESLEGYGIPEGSILLKVNELTSDEY
FT                   VKSLMDKTFLNYDFKRNKIVKYKLYVFADTLGDTIKLTFLSPKGEAIEKTLKPVELVIN
FT                   QSALDKMPLVKSILVKDKVAYLKIPAMKISQKDIEKDGKEIYSFFKEIKNYPYLIIDIR
FT                   GNGGGNLAYWVENVVQPLIDKKIPYKAYTVVKNYDIKYTKTLDKLPKGKNYPPEVKDDF
FT                   GYFAEISYTVTPKNYVGFKGKIYLLTDAGVYSAAESFASFAKATKWATVVGTPTSGGLG
FT                   FNPDHLILPNSGLMVRYPNNMALNPDGTANEEVGTQPDIYVEESYDDFVNYLRDRKNID
FT                   ENNILNMVKYDTVLKKVLEMTKLFIVK"
FT   repeat_region   425940..426157
FT                   /note="TLR095, identity:100%, copy 1"
FT   gene            426609..426959
FT                   /locus_tag="TTE0407"
FT   regulatory      426609..426613
FT                   /locus_tag="TTE0407"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        426621..426959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23691"
FT                   /db_xref="GOA:Q8RCL8"
FT                   /db_xref="InterPro:IPR024257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL8"
FT                   /protein_id="AAM23691.1"
FT                   /translation="MKKFYWLLGFLGFIGFLGFFKSYMYFAFFAFFSNFFTSRYINILQ
FT                   DKQLQNKMAEAHSISFVVTSFFLSFMLIMLIFNVSYEIFKATFCIIFALVFIIDSYLLY
FT                   KYTGNNQK"
FT   gene            427267..427428
FT                   /locus_tag="TTE0408"
FT   regulatory      427267..427271
FT                   /locus_tag="TTE0408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        427279..427428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|3024971|sp|Q58429|YA23_METJA
FT                   HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN MJ1023
FT                   gi|2127730|pir||F64427 ABC transporter ATP-binding protein
FT                   - Methanococcus jannaschii gi|1499865|gb|AAB99027.1|
FT                   (U67545) ABC transporter ATP-binding protein [Methanococcus
FT                   jannaschii], score 59.7, E-value 5.00E-09"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23692"
FT                   /db_xref="GOA:Q8RCL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL7"
FT                   /protein_id="AAM23692.1"
FT                   /translation="MDSILSVKNLKKYYGKVKAVDEISFNMYPGEVVGLIGPNGACKST
FT                   TLRI"
FT   gene            427430..427973
FT                   /locus_tag="TTE0409"
FT   regulatory      427430..427434
FT                   /locus_tag="TTE0409"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        427443..427973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL6"
FT                   /protein_id="AAM23693.1"
FT                   /translation="MSKKREYYYIGKRRDTDIWEIMLKYGVLSASHFEVRFPDDPTMTL
FT                   SEGREEFLGLPKISVEPWSGMKGAIAVKGEMTKEARKLFLQIIETRRIRLWDFILFRDG
FT                   RKLLSVSDFDDRIVTENFAKEFMEKLFLTWFEPIPEPEIKSEKISKDFLEEVSQAIQEA
FT                   LSKLVLDLENDKN"
FT   gene            427925..428721
FT                   /gene="CcmA2"
FT                   /locus_tag="TTE0410"
FT   regulatory      427925..427929
FT                   /gene="CcmA2"
FT                   /locus_tag="TTE0410"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        427960..428721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CcmA2"
FT                   /locus_tag="TTE0410"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|1171664|sp|P46903|NATA_BACSU
FT                   ATP-BINDING TRANSPORT PROTEIN NATA (NA+ ABC TRANSPORTER)
FT                   gi|7445612|pir||A69666 Na+ ABC transporter (extrusion)
FT                   (ATP-binding protein) natA - Bacillus subtilis
FT                   gi|973330|gb|AAB53022.1| (U30873) NatA [Bacillus subtilis]
FT                   gi|2415726|dbj|BAA22236.1| (AB000617) NatA [Bacillus
FT                   subtilis] gi|2632561|emb|CAB12069.1| (Z99105) Na+ ABC
FT                   transporter (ATP-binding protein) [Bacillus subtilis],
FT                   score 236, E-value 2.00E-61"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23694"
FT                   /db_xref="GOA:Q8RCL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL5"
FT                   /protein_id="AAM23694.1"
FT                   /translation="MIKIEGEGLVLVEVDGLTKVFKNIRAVDNLSFRVEEGEIYGLLGE
FT                   NGAGKTTTLRMLATMLKPTNGTAIINGRDLIKEPEEIRKEVGILFGGESGLYDRLTARE
FT                   NILYFAELHDMDKKEANKKIDILARKFDMMEFIDRLAAKLSKGMKQKVAILRSIIHDPK
FT                   VMLFDEPTSGLDVGSVREVHDFIRFCKEEGKTIIFSSHSMSEVEKLCDKIGIIHKGKLI
FT                   EEGTIEGLKEKYKTDNLEELFMELVGEKIEV"
FT   misc_feature    428068..428616
FT                   /gene="CcmA2"
FT                   /locus_tag="TTE0410"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   194.4, E-value 1.80E-54"
FT   gene            428700..429895
FT                   /gene="NatB"
FT                   /locus_tag="TTE0411"
FT   regulatory      428700..428704
FT                   /gene="NatB"
FT                   /locus_tag="TTE0411"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        428711..429895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NatB"
FT                   /locus_tag="TTE0411"
FT                   /product="ABC-type Na+ efflux pump, permease component"
FT                   /note="Best Blastp hit = gi|2507078|sp|P46904|NATB_BACSU
FT                   PROTEIN NATB gi|7475662|pir||B69666 Na+ ABC transporter
FT                   (extrusion) (membrane protein) natB - Bacillus subtilis
FT                   gi|1663528|gb|AAB53023.1| (U30873) NatB [Bacillus subtilis]
FT                   gi|2632562|emb|CAB12070.1| (Z99105) Na+ ABC transporter
FT                   (membrane protein) [Bacillus subtilis], score 147, E-value
FT                   3.00E-34"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23695"
FT                   /db_xref="GOA:Q8RCL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL4"
FT                   /protein_id="AAM23695.1"
FT                   /translation="MKFKHVYIVLKKELKDIFRDKKTWIVTILLPALFIPIMMYIVIGG
FT                   AESISEQKISDTKIAIIDEGNNQKFVNYLKSTGISIITDLQNPKESLEKGDIRAILIIP
FT                   SDFGKNIEEGKNADLIIQVDMANMKSSNAENMIRSLIKEYANNIVKERLIAKGIDPKIL
FT                   DPIEVKTENIASQSKMAGSFLAFIVPMLLTLWTATGGMGAAVDLAAGEKERGTLEPLLT
FT                   TSASRLSIMAGKYLAVTAMALLSAVASLLGLFASFSLNRNMASLNADFKMSTIAIIVMF
FT                   IAAFFTASIFAALELALSAYAKSFKEGQTYISPLMFIAIIPAYLVMYKMPNEIPISYFA
FT                   IPVFGTISIFKELLYGIINMTHIGIFVFSSMIYVAISIYIAALMFKQEWALFRV"
FT   regulatory      429939..429980
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            430196..430495
FT                   /locus_tag="TTE0412"
FT   regulatory      430196..430200
FT                   /locus_tag="TTE0412"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        430211..430495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23696"
FT                   /db_xref="GOA:Q8RCL3"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL3"
FT                   /protein_id="AAM23696.1"
FT                   /translation="MDTPRNNEESESKEEVIDSITYSYISFEDKVIDKCMLSKYKELLE
FT                   PEEFKILLLNIIEGIPQKEIAAMFNKTQSCISKMKKRALRKLEEFIKEV"
FT   gene            430485..430700
FT                   /locus_tag="TTE0413"
FT   regulatory      430485..430489
FT                   /locus_tag="TTE0413"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        430500..430700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23697"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL2"
FT                   /protein_id="AAM23697.1"
FT                   /translation="MEECERLFAVILKAKQGDKEAIEEIIKRFEPLIMDSVKGVDEEIE
FT                   EELRQDIVEIIIKAVKKFEIK"
FT   repeat_region   complement(430757..430868)
FT                   /note="TLR006, identity:100%, copy 6"
FT   repeat_region   complement(430867..432684)
FT                   /note="TLR004, identity:100%, copy 6"
FT   gene            430872..432169
FT                   /locus_tag="TTE0414"
FT   regulatory      430872..430876
FT                   /locus_tag="TTE0414"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        430886..432169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0414"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10176666|dbj|BAB07760.1|
FT                   (AP001520) BH4041; unknown conserved protein in others
FT                   [Bacillus halodurans], score 412, E-value 1.00E-114"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23698"
FT                   /db_xref="GOA:Q8R6I4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I4"
FT                   /protein_id="AAM23698.1"
FT                   /translation="MKYKQNEKILQVTGDTLIAGVDIAKESHYARAFDYRGVEYGKYLR
FT                   FENNREGMTKFLNWAKDLMERHKKNKLIVGIEPTGQYWLCFAQYLKDNNIKVVLVNPFH
FT                   VKMSKELDDNSPTKSDKKDPKTIAMLVKDGRYVEPIIPEGVYAELRVAMGIKDRLNKQI
FT                   GMTKNQITRWLDIYFPEFNTVFSDWEGKAALITLREFPTPEKIAKKSAEEIISIWKKEV
FT                   QRGVGEKRAIKLIETAKESIGKKQGIKMAEYEIKTLIEQYEFLKKQIEEIEKKMEELIV
FT                   EIPGVKELLEIKGIGVNTVAGFIAEVGDIEKYEHPKQIQKLGGLNLIENSSGKHKGETT
FT                   ISKRGRKRLRSVLFNAVMALVAKNEEFRELHKYYTTRAQNPLKKKQSLIVLCNKLIRIF
FT                   YVILKKGVKYDPIKMMKDIKRPGLQEAA"
FT   misc_feature    431669..431998
FT                   /locus_tag="TTE0414"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 76.1, E-value 7.20E-19"
FT   gene            432699..433382
FT                   /locus_tag="TTE0415"
FT   regulatory      432699..432703
FT                   /locus_tag="TTE0415"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        432741..433382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23699"
FT                   /db_xref="GOA:Q8RCL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL1"
FT                   /protein_id="AAM23699.1"
FT                   /translation="MREEGDSINIKRIIFYVLLIAVILVAFVGYDYYNYNRRNVFLYNT
FT                   NKAPDLNYSTQSKNFKIYTLIEVGKKYQFSGNETSEWAKNAKEAQESNKYTSLQYRIII
FT                   ENISDKVIKDFKAQAFVDEGLQPYIMSGILYFGTLNQQKIDLNVKNNEKMDYMTEISRF
FT                   TWLPNINQIDVKDREKILEAIKKPIKLIIKWRDGEEYLLLENAEVKIYCQ"
FT   gene            433579..433989
FT                   /locus_tag="TTE0416"
FT   CDS_pept        433579..433989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCL0"
FT                   /protein_id="AAM23700.1"
FT                   /translation="MDSINDYFLSELRFLSQNIEEFNGSVEDLVIFSSITGSVYALSLA
FT                   CKVNGFYKNHLLVSEVFTELNNMFWGAPKWLDKIKENRYELGELLKKLLENSNDKESQE
FT                   KLFQLIKKLRDNRKQRESPFCLFRQKGLFTFV"
FT   regulatory      433941..433974
FT                   /locus_tag="TTE0416"
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            434082..435003
FT                   /locus_tag="TTE0417"
FT   regulatory      434082..434086
FT                   /locus_tag="TTE0417"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        434095..435003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0417"
FT                   /product="predicted metal-dependent membrane protease"
FT                   /note="Best Blastp hit = gi|7481590|pir||T34651 probable
FT                   transmembrane protein - Streptomyces coelicolor
FT                   gi|4007687|emb|CAA22372.1| (AL034446) putative
FT                   transmembrane protein [Streptomyces coelicolor A3(2)],
FT                   score 65.9, E-value 7.00E-10"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23701"
FT                   /db_xref="GOA:Q8RCK9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK9"
FT                   /protein_id="AAM23701.1"
FT                   /translation="MKKMFVNKNGQMRSGWKIAILIAGTFVITLLFAFLAFLIIGLIGK
FT                   YSEYTMHKLLLLLMVGEERFYLFTTISFLSTLIMIALMLKFIDKKKFKDIGFTSLKDGY
FT                   KDLVAGFLIGAFSIAIIVLILYIIGAVTIERNSNISAYYLLGGMYAFILVGLEEELMSR
FT                   GYFINALNQMERPWVSVLISSIIFSLMHILNPNIVFLGLLNIFLIGVLFSYMYLKTGNL
FT                   WMPIGYHISWNYFQGYIFGFNVSGNAIRGIYNAFPKNNFLSGGDFGLEGGIIATLVILI
FT                   TFLILYYYFERYRKVQEVELG"
FT   misc_feature    434527..434814
FT                   /locus_tag="TTE0417"
FT                   /note="Pfam match to entry Abi, CAAX amino terminal
FT                   protease family, score 83.4, E-value 4.70E-21"
FT   gene            435006..435774
FT                   /locus_tag="TTE0418"
FT   regulatory      435006..435010
FT                   /locus_tag="TTE0418"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        435019..435774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7462642|pir||F72313
FT                   hypothetical protein TM0947 - Thermotoga maritima (strain
FT                   MSB8) gi|4981486|gb|AAD36028.1|AE001758_6 (AE001758)
FT                   hypothetical protein [Thermotoga maritima], score 99.8,
FT                   E-value 3.00E-20"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23702"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK8"
FT                   /protein_id="AAM23702.1"
FT                   /translation="MNIDERVLGIDGACGGWAVATCKNGKAFVQFFKKIEDVWYFYRDK
FT                   LELVLIDIPIGLPHSEKRYRSCDEEARKFLGHPRSSSIFSPPCREVFEARDYKEALAIN
FT                   KKILGKGLSKQAWNIIPKIKEVDEFIIKIPEVVKFLKESHPEVAFKGLKGEVAKFSKRD
FT                   EEGYKERMEFLRILFRKFDCEIVEDKIKGLRRDDIVDALILLATGILAIKKEGNIYSFP
FT                   TNFKEKDLLGLPMEIFFVKFSRLNEIFIE"
FT   gene            435799..436755
FT                   /gene="PldB"
FT                   /locus_tag="TTE0419"
FT   regulatory      435799..435803
FT                   /gene="PldB"
FT                   /locus_tag="TTE0419"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        435811..436755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PldB"
FT                   /locus_tag="TTE0419"
FT                   /product="Lysophospholipase"
FT                   /note="Best Blastp hit = gi|11349862|pir||D83233
FT                   hypothetical protein PA3301 [imported] - Pseudomonas
FT                   aeruginosa (strain PAO1)
FT                   gi|9949429|gb|AAG06689.1|AE004752_5 (AE004752) hypothetical
FT                   protein [Pseudomonas aeruginosa], score 193, E-value
FT                   3.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23703"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK7"
FT                   /protein_id="AAM23703.1"
FT                   /translation="MAENFDGFSIKGEDGADIYVHLWEPEEIYRGIIQIFHGMAEHGGR
FT                   YQNFARYMNEKGFVVCADDHRGHGKTAGSLDNVGYIGKDGFNKIVEDEYLIMKFLKEKY
FT                   GNLPIVIFGHSFGSFVAQEFMIRYGKEVNGVILSGSSAVKELPLRFGYALAFIEKTLFG
FT                   EKKRSKVLDRLTFGSYNKRIKGDSLSKFEWLSTDKEEVKKYEEDPYCGGVFTAGFFYYF
FT                   FKGLLNLYKPQRLLAIPKDLPLFIISGEEDPVGEYGKLVKRLYELYKSIGLKQVNIKLY
FT                   PGKRHELLNEVEREKVYEDILTWIGKRVLNYSQ"
FT   gene            complement(436738..437700)
FT                   /locus_tag="TTE0420"
FT   CDS_pept        complement(436738..437685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0420"
FT                   /product="predicted permease"
FT                   /note="Best Blastp hit = gi|7363467|gb|AAF61312.1|
FT                   (AF132735) malate permease [Clostridium cellulovorans],
FT                   score 275, E-value 6.00E-73"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23704"
FT                   /db_xref="GOA:Q8RCK6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK6"
FT                   /protein_id="AAM23704.1"
FT                   /translation="MEVFFSSVQGVLIIVFILALGYYLSKIGWFDSFTADLFAKLVINV
FT                   SLPLNMIINISTTFSKEQLEHSVRGLLIPFLSILLSYVIAYIFAEIFKIKKGRKGVFVV
FT                   IFSLSNTIFVGLPMAQALFGDIATPYALLYYMANTTILWTLGAYSIIQDVNENEKNILN
FT                   WDTVKRIFNPPLLGFIIGVIFVLENISLPKFLFESFKMIGNLTTPLSIFYIGIVIHEMG
FT                   FDKFKLDKDAILVFVGRFLITPAFVLLLNIFIPVPKLMRDVFVIMSAMPVLVNSAIIAR
FT                   VYGADYEFATSMITYTTISSVVIMPFLMVLLRVI"
FT   regulatory      complement(437696..437700)
FT                   /locus_tag="TTE0420"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   437793..438220
FT                   /note="TLR098, identity:100%, copy 1"
FT   gene            437894..438117
FT                   /locus_tag="TTE0421"
FT   regulatory      437894..437898
FT                   /locus_tag="TTE0421"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        437899..438117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23705"
FT                   /db_xref="GOA:Q8RCK5"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK5"
FT                   /protein_id="AAM23705.1"
FT                   /translation="MSAVEKSLMLFISAILMVSFFTIIAFANSTIKLIVNGSEIKPDVP
FT                   LQIINGRTMVPIKWMAEALGAEVEWDK"
FT   repeat_region   438440..440271
FT                   /note="TLR028, identity:99%, copy 4"
FT   gene            complement(438594..439997)
FT                   /locus_tag="TTE0422"
FT   CDS_pept        complement(438594..439997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0422"
FT                   /product="transposase"
FT                   /note="Best Blastp hit = gi|10173047|dbj|BAB04153.1|
FT                   (AP001508) transposase (03) [Bacillus halodurans]
FT                   gi|10173608|dbj|BAB04712.1| (AP001510) transposase (03)
FT                   [Bacillus halodurans] gi|10173823|dbj|BAB04926.1|
FT                   (AP001511) transposase (03) [Bacillus halodurans]
FT                   gi|10173917|dbj|BAB05020.1| (AP001511) transposase (03)
FT                   [Bacillus halodurans] gi|10174165|dbj|BAB05267.1|
FT                   (AP001512) transposase (03) [Bacillus halodurans]
FT                   gi|10176084|dbj|BAB07180.1| (AP001518) transposase (03)
FT                   [Bacillus halodurans] gi|10176328|dbj|BAB07423.1|
FT                   (AP001519) transposase (03) [Bacillus halodurans], score
FT                   112, E-value 8.00E-24"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23706"
FT                   /db_xref="GOA:Q8RCK4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK4"
FT                   /protein_id="AAM23706.1"
FT                   /translation="MLCLFSLSVHRLSIDGQAPYKLNLSTNHGEGVLQKLKRQRTFKKL
FT                   FAKRSVNLSMSSTLIVGIDISSELNAASFIDEAGNRLVKKALFFPNDLDGAQQLIDFTI
FT                   SLAQQFNISSIKFGMEATSHYAWHLHTFLASSPELAPFNPLFYVINPSIIKSFKGAYIH
FT                   LPKTDSVDATVIAECVRFGQVKPTPLPDLRYAALQRLTRMRYHIVRSLVREKNRALNLI
FT                   SFKFSTYPSECPFSNIFGKASLAIIENFTPDDIASMPLDNLIDFIVKNGNNRLSDPTQI
FT                   AKTLKAAANRAYRLHPDLAEANDLALSMTLENIRFLESQLKKLDGEISRQLKAFNQTLT
FT                   TIPGIGDVLAAGIIAEIGDIKRFNNEAALAKYAGLIWNKYQSGNFNAQDTSLVKCGDQY
FT                   LRYYLVEAANCVRVHTVRFKEYYNKKYREVPKHQHKRALVLTARRLIPLIFAMLSKGQI
FT                   YQERGVVSI"
FT   misc_feature    complement(438732..439058)
FT                   /locus_tag="TTE0422"
FT                   /note="Pfam match to entry Transposase_20, Transposase
FT                   IS116/IS110/IS902 family, score 67.7, E-value 2.50E-16"
FT   gene            439998..440197
FT                   /locus_tag="TTE0423"
FT   regulatory      439998..440002
FT                   /locus_tag="TTE0423"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        440045..440197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I8"
FT                   /protein_id="AAM23707.1"
FT                   /translation="MVMLLYQHATGVSQKYLSKLKRDLLLLSLSETKDHLNKNEKFNYE
FT                   IVLPG"
FT   gene            440270..440923
FT                   /locus_tag="TTE0424"
FT   regulatory      440270..440274
FT                   /locus_tag="TTE0424"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   440274..440928
FT                   /note="TLR098, identity:94%, copy 2"
FT   CDS_pept        440279..440923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7208814|emb|CAB76937.1|
FT                   (AJ275974) hypothetical protein [Clostridium thermocellum],
FT                   score 52, E-value 6.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23708"
FT                   /db_xref="GOA:Q8RCK3"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK3"
FT                   /protein_id="AAM23708.1"
FT                   /translation="MLLKKSLMLFIGVILMVSFFTIIAFANSTIKLIVNGSEIKPDVPP
FT                   QIINGRTMVPIKWVAEALGAEVEWDKQKKIVKVSFDKKVETDLISNYLRTAETSKHFVE
FT                   NFAHALQERNGAVARLFLSPEIRGQIKPEIIGPSTPVTKIEIKEVSYSNYYWIYDVKAY
FT                   YGPYDNNSPTLAFEVKLTVEPERYPDGSVVSSRYFITKLDWIKGKTEFIPN"
FT   regulatory      complement(440925..440952)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(440967..441683)
FT                   /locus_tag="TTE0425"
FT   CDS_pept        complement(440967..441668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK2"
FT                   /protein_id="AAM23709.1"
FT                   /translation="MATLLKISTGPNHNADPQNEWNVTAKKSFRVIITAYDVYGNVDTS
FT                   YNKIVNIYADDGKGNYPYQIGSAQALNGQATVWCNPLTIIYGTNPFRYIIARDIDGLQS
FT                   LPIRIAVYFYVYGSIEFHTNCDGTLSYGAQTACVPNGLPPNSIFVALPATGLCNKSIYI
FT                   STSSTGTFKKSQILDVGPWRTNDPYWNTGNYGIYRADIDISDGLATQLGIPYGCNGSTP
FT                   WGGAYVLWRFS"
FT   regulatory      complement(441679..441683)
FT                   /locus_tag="TTE0425"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   441694..441956
FT                   /note="TLR103, identity:100%, copy 1"
FT   gene            442031..442615
FT                   /locus_tag="TTE0426"
FT   CDS_pept        442031..442615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23710"
FT                   /db_xref="GOA:Q8RCK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK1"
FT                   /protein_id="AAM23710.1"
FT                   /translation="MRGRYFLIFILGIIIGVLISQGFTKYTAKETMAKNIQNIDLANPI
FT                   SQKEILKQLKDSPSFDMSQIPVCGSDIYGGIWKDYGVNSASFDDWKLPKVWQKYIYSQD
FT                   DKTDPTSINNDSNDKFLYITLQGVVFLYFPPDGRYWPTVPMFGDIPPGSVIVAQHVPIK
FT                   PAVESGIIPVYHGQAFIKGYPLPEGWKRALK"
FT   gene            complement(442665..443315)
FT                   /locus_tag="TTE0427"
FT   CDS_pept        complement(442665..443303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCK0"
FT                   /protein_id="AAM23711.1"
FT                   /translation="MATCPTNPKPNYTTFVNNYLSYAQTASRSLQLPVAAILAHWYQEW
FT                   GIPIKNPAFQTWAPSGICVSGYCGGSTGNTFPIFCTLNDGVQAYIKQMNYYNDGSHIDI
FT                   FGFPTKLSTFYNIGYKAGGKTATVKNDNGNTVTAQGVTHYGLNDIPEFPTPQQLTYYEH
FT                   QALYSVLEALGASEWDAGHYFSGTDTQPGQSLINIVINSGWQDSHNYIY"
FT   regulatory      complement(443311..443315)
FT                   /locus_tag="TTE0427"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   443328..443494
FT                   /note="TLR103, identity:97%, copy 2"
FT   gene            complement(443392..443773)
FT                   /locus_tag="TTE0428"
FT   CDS_pept        complement(443392..443760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23712"
FT                   /db_xref="GOA:Q8RCJ9"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ9"
FT                   /protein_id="AAM23712.1"
FT                   /translation="MLNINDKKLISYIAKGMKNEYIRLYKKYKKIKEKEIPVEDEEIIS
FT                   SDDENTQNIETKLAIEEALQKLTPLQKEIIIETILYGEKEKEVALKLHISQQAVNKTKK
FT                   RALKKMREFLGEDFLDGL"
FT   gene            complement(443766..443976)
FT                   /locus_tag="TTE0429"
FT   CDS_pept        complement(443766..443960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ8"
FT                   /protein_id="AAM23713.1"
FT                   /translation="MKVIKLKNKSLTSIKPKEKDEKILLEIIAKFKPLINKYKKKLEYD
FT                   GAEEDLLLWLLKTITKLKG"
FT   regulatory      complement(443769..443773)
FT                   /locus_tag="TTE0428"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(443972..443976)
FT                   /locus_tag="TTE0429"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   444130..444550
FT                   /note="TLR098, identity:98%, copy 3"
FT   gene            444229..444453
FT                   /locus_tag="TTE0430"
FT   regulatory      444229..444233
FT                   /locus_tag="TTE0430"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        444238..444453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23714"
FT                   /db_xref="GOA:Q8RCJ7"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ7"
FT                   /protein_id="AAM23714.1"
FT                   /translation="MLLKKSLMLFISAILMVSFFTIIAFANSTIKLIVNGSEIKPDVPP
FT                   QIINGRTMVPIKWMAEALGAEVEWDK"
FT   gene            444628..445386
FT                   /locus_tag="TTE0431"
FT   regulatory      444628..444632
FT                   /locus_tag="TTE0431"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        444643..445386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23715"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ6"
FT                   /protein_id="AAM23715.1"
FT                   /translation="MKKFFVFLVVFVLFLAGCNNNLSDYEKNNSSGSETVSKIKSEEEQ
FT                   AASHINPSAPQFIFYNGNSTTAWVNQFIFTSNGEIKEQSPYGDKTYIKLKYLKDGIIKT
FT                   ADLTEYALQYNLFDGVEYITASSEGKYIVVQFSSDLPISIIVDTDTNNSKILWYNEAKH
FT                   ESMMSISFNPNNEDEFAFLPSADIKGPDGAHTLKIYNLNNNLTKTIGEIKEEKISMSKA
FT                   LIKWDGDKIFVMIPDGKHVFSFIVK"
FT   regulatory      445401..445441
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(445401..445441)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(445460..445942)
FT                   /locus_tag="TTE0432"
FT   CDS_pept        complement(445460..445927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23716"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ5"
FT                   /protein_id="AAM23716.1"
FT                   /translation="MWKITIDLYKDRYKEGVLRLWTYSTISGKYIERYRCPCLGRGTTY
FT                   PDSPDSWKYINGNTPTGTWDATIDGIGDPEVYGPNPRIALTSISGNAYIAEHTYGRSGF
FT                   MIHGGRADYEPPLYPTNGCIRVYDNDQAALVNIINADGESHGTVIISENLG"
FT   regulatory      complement(445938..445942)
FT                   /locus_tag="TTE0432"
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   445961..446220
FT                   /note="TLR103, identity:93%, copy 3"
FT   gene            446329..447347
FT                   /locus_tag="TTE0433"
FT   regulatory      446329..446333
FT                   /locus_tag="TTE0433"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        446379..447347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23717"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ4"
FT                   /protein_id="AAM23717.1"
FT                   /translation="MIDRNNGWAIGENMGENKVFITIDGGSTWITTSTSGIGDIRGWFF
FT                   MDSDHGWILYSNGTLYRTENRGKNWDADEVPFDMGKLFFINSNGKYEGWVLKEYGPASG
FT                   NVPVDVYRLINNKWTLIHKGELPNSTSASPNPLPYEGEKKSFIFLPDAKTGFIATERRD
FT                   PGKSSLYMTTDGGYTWNKKDIPLLSKLNDKYISVYSLKFVDGEIIWPISAFDDVKKDFA
FT                   ILFLVSKDNGNSWGEKTSFIYKNSPRKIYVLDKENWYVLFENQLLKTNNGGHTWKKLNI
FT                   PQNTFQIQFIDNKIGWALASTSTGTNLFYSENGGYTWDKKF"
FT   gene            447371..448111
FT                   /locus_tag="TTE0434"
FT   regulatory      447371..447375
FT                   /locus_tag="TTE0434"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        447386..448111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23718"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ3"
FT                   /protein_id="AAM23718.1"
FT                   /translation="MRKTKTFLLIAFAIVLSLSIIALGLSVSRVSAGDGPNQSQFNKII
FT                   EKVGSFLKGDKGKLKVNEGDIIAEVNGIPIYKNEFELRKGLTLASDEQINDINNFVLNK
FT                   LVREKVKEYLAMKYNLKVSEDEINSYIEKEKQQFKEFPEAEKKLKELISASGMTYEEYW
FT                   NDYERYNVKRMLLFDKLYNAIVDEGIKNGELKKTDKMTIEVQNEYKKYFDNIIDQYVKQ
FT                   AKISINKKYKDMFRGFKVE"
FT   gene            448124..448620
FT                   /locus_tag="TTE0435"
FT   regulatory      448124..448128
FT                   /locus_tag="TTE0435"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        448135..448620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23719"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ2"
FT                   /protein_id="AAM23719.1"
FT                   /translation="MKKFFIILLLSLAFLLIYAFYPRNGTFNNLILSHYSGISFNKVMI
FT                   IKYQDFDFKVKTIKNPDKIKEILRYFKNFDLKESNERNYANYDYRTNGYSIYFEGEKDY
FT                   KIYDLAIAISKDNPHVLEIFPDIINRRLFLYVSHNTYEILNVEVNFEYIEELWKLGE"
FT   regulatory      448716..448745
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(448716..448745)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(448790..449584)
FT                   /gene="CcmA3"
FT                   /locus_tag="TTE0436"
FT   CDS_pept        complement(448790..449584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CcmA3"
FT                   /locus_tag="TTE0436"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|7445851|pir||C72336 'ABC
FT                   transporter, ATP-binding protein - Thermotoga maritima
FT                   (strain MSB8)' gi|4981293|gb|AAD35847.1|AE001746_8
FT                   '(AE001746) ABC transporter, ATP-binding protein
FT                   [Thermotoga maritima]', score 152, E-value 3.00E-36"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23720"
FT                   /db_xref="GOA:Q8RCJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ1"
FT                   /protein_id="AAM23720.1"
FT                   /translation="MYVVEVKNLSKQIDGKQILSSVSFKVQEGEIMALVGPNGAGKTTT
FT                   LKCIMNAMKKDSGEIFIFEKPFHPSIKKDIAFVTEHRKVFSNLQLADYYKMYKTLYPLW
FT                   DDTFFKNFLSKYGFNLNDEMQKFSRGQKTLILAILAFSTNAKLIILDEPTQHLDPATRF
FT                   ELIEIIKQYVNEKKGTILLSSHEIFELEEYATSFAIIKDGKILYTDSIDEAKQKHRIVS
FT                   LNENIKGAKVIAVMNNEVLVQTEEDIGEYPRLNQIIVGYLKS"
FT   misc_feature    complement(448976..449500)
FT                   /gene="CcmA3"
FT                   /locus_tag="TTE0436"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   115.1, E-value 1.30E-30"
FT   gene            complement(449584..450189)
FT                   /locus_tag="TTE0437"
FT   CDS_pept        complement(449584..450174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23721"
FT                   /db_xref="GOA:Q8RCJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCJ0"
FT                   /protein_id="AAM23721.1"
FT                   /translation="MNEMISKMDVYIQKEVKEKAVRIFLLTFLLLIPGIFIKTIVLLFL
FT                   SASFIVYDIRHQNAELLYFLPFSRKELFFYNLILLSLIVIATSNISAIFVGITLIDKLK
FT                   IILQSLILLFAIFGLQMTFSGFEMDGLVWSVLIVLLDMIFGYIGSPNINSALFNPYSLV
FT                   SFTRQGNLVLSFIYSSLISFLGYWSYVIKGGEN"
FT   gene            complement(450167..450540)
FT                   /locus_tag="TTE0438"
FT   CDS_pept        complement(450167..450523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0438"
FT                   /product="predicted Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|7443063|pir||D72336
FT                   'transcription regulator, GntR family - Thermotoga maritima
FT                   (strain MSB8)' gi|4981294|gb|AAD35848.1|AE001746_9
FT                   '(AE001746) transcriptional regulator, GntR family
FT                   [Thermotoga maritima]', score 67, E-value 8.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23722"
FT                   /db_xref="GOA:Q8R5U2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5U2"
FT                   /protein_id="AAM23722.1"
FT                   /translation="MLRKVDKHSGVPAYLQIVNMIKSEILLGNLQKGAQLPSVRDLQVI
FT                   FDVNINTVLKALEKLKNEGYIESEQGVGYFVKKDIDVNKEVIEIIRECVSKLKNGRIDY
FT                   YTAMLIFEEVWKNE"
FT   regulatory      complement(450185..450189)
FT                   /locus_tag="TTE0437"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(450296..450475)
FT                   /locus_tag="TTE0438"
FT                   /note="Pfam match to entry gntR, Bacterial regulatory
FT                   proteins, gntR family, score 54, E-value 3.90E-15"
FT   gene            complement(450533..451627)
FT                   /locus_tag="TTE0439"
FT   CDS_pept        complement(450533..451612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23723"
FT                   /db_xref="GOA:Q8RCI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI9"
FT                   /protein_id="AAM23723.1"
FT                   /translation="MHQNLIETIAFLASFTLVVGGLAFLFSDKASNIPLLKTLKESSIA
FT                   KIAASGAFALIAWFLPWISLKVLFLALAFVLLLSIFPLKKTLSPLGTVILIFFLIIIAL
FT                   GLLAIPVSTLPQININIPPIDISDSSGDVVINRLDKKVLPDTEIPLEDVQNIQISTYSG
FT                   MELEFTKTNTIEIPSDFVVKKEGENLILSELSQKNVTYVIKVGTLSPKNLEINCSGIKI
FT                   TRKADLKDFSLNCDGAKINADITSEKETSIHCSGLNLTGKLRGENLNIDADCINMSGEL
FT                   YFDKIFINSSGINIHTSAKFNDFKISSSGFNGTIEILNSSNERGNLLIDSDGGLARIIN
FT                   KNNAPVEIKTHGFIKLVKE"
FT   regulatory      complement(450536..450540)
FT                   /locus_tag="TTE0438"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(451623..451627)
FT                   /locus_tag="TTE0439"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            451666..451827
FT                   /locus_tag="TTE0440"
FT   CDS_pept        451666..451827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23724"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI8"
FT                   /protein_id="AAM23724.1"
FT                   /translation="MYFVKGVGSIFFKISLEDEKLQKDFRDLCRNNKLRKGKSRILPLC
FT                   LIKLDGKG"
FT   gene            451820..452871
FT                   /gene="FrvX"
FT                   /locus_tag="TTE0441"
FT   regulatory      451820..451824
FT                   /gene="FrvX"
FT                   /locus_tag="TTE0441"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        451831..452871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FrvX"
FT                   /locus_tag="TTE0441"
FT                   /product="Cellulase M and related proteins"
FT                   /note="Best Blastp hit = gi|2494340|sp|Q57975|Y555_METJA
FT                   HYPOTHETICAL PROTEIN MJ0555 gi|2127881|pir||C64369
FT                   endoglucanase homolog - Methanococcus jannaschii
FT                   gi|1591260|gb|AAB98546.1| (U67504) endoglucanase (celM)
FT                   [Methanococcus jannaschii], score 259, E-value 5.00E-68"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23725"
FT                   /db_xref="GOA:Q8RCI7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI7"
FT                   /protein_id="AAM23725.1"
FT                   /translation="MDYKELLKKLSESHGVSGHERGIYQLLKKEFEEISDEVLEDNFGN
FT                   LIFKKKGLKGKYKVMLAAHLDEIGLMVKDIDEKGFIKFTPVGGVDQRTLPSQEVIVHGK
FT                   KELLGVIGSKPPHLLSSEDMEKAIKIDDMYVDVGLPKEEVEKLVSIGDIITVKREFREL
FT                   LNDNVSGKALDDRAGVVVMAVCLDELRKMYHYHDVYAVATLQEEVGVRGAITSSYNIEP
FT                   DIAIAIDVTHAKARGVSRDIEIGKGPAIGKGPNIHPAVYKGLVDIAKKYNINYQIEPLP
FT                   GHSGTDAWAIQVSKKGVPTGLVSIPLKYMHTSVETANMKDIIESGRLLAHYIANLPEEL
FT                   EGHLCY"
FT   gene            452849..453881
FT                   /gene="FrvX2"
FT                   /locus_tag="TTE0442"
FT   regulatory      452849..452853
FT                   /gene="FrvX2"
FT                   /locus_tag="TTE0442"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        452862..453881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FrvX2"
FT                   /locus_tag="TTE0442"
FT                   /product="Cellulase M and related proteins"
FT                   /note="Best Blastp hit = gi|7435582|pir||C72301
FT                   endoglucanase - Thermotoga maritima (strain MSB8)
FT                   gi|4981591|gb|AAD36126.1|AE001765_5 (AE001765)
FT                   endoglucanase [Thermotoga maritima], score 262, E-value
FT                   5.00E-69"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23726"
FT                   /db_xref="GOA:Q8RCI6"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI6"
FT                   /protein_id="AAM23726.1"
FT                   /translation="MLLKELTELLGASGDEKEVREKIKEIVKPYVDELYVDRIGNLIAC
FT                   KKGKKEKPKVMLAAHMDEVALMVKSVNEDGTLSFSPVGGVDNRILVAKAVKVGEKKING
FT                   VIGAKPIHLQKKGEQEKPLDFDELYIDIGAASKEEALKHISPGDYVYFESNFEILGDGY
FT                   VKAKALDDRIGCNVLIEILKNTYEYPVCAAFTVQEEVGLRGAGVAAYNVEPDFALVVEG
FT                   TVAADVVDSEPHLVSTELGKGPAISLMDRTTLYDRKIIDKIVRIAEENNVPYQFRRIAS
FT                   GGNDAGKIHLTKGGIKTVAISVPCRYIHSFNSVAKLSDFENTVKLVDLVIKNIEEVLK"
FT   gene            453865..454861
FT                   /gene="FrvX3"
FT                   /locus_tag="TTE0443"
FT   regulatory      453865..453869
FT                   /gene="FrvX3"
FT                   /locus_tag="TTE0443"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        453878..454861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FrvX3"
FT                   /locus_tag="TTE0443"
FT                   /product="Cellulase M and related proteins"
FT                   /note="Best Blastp hit = gi|1097207|prf||2113327A
FT                   endoglucanase [Clostridium thermocellum], score 349,
FT                   E-value 2.00E-95"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23727"
FT                   /db_xref="GOA:Q8RCI5"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI5"
FT                   /protein_id="AAM23727.1"
FT                   /translation="MSVNVELIKKLTQAFGPSGSEEKVFEIIREEVKGFCDEITHDAMG
FT                   NMICVKKGKGKKIMVAAHADEIGIMVTHIEEEGFLRFTTIGGVYVEHLVGRRVKFKNGT
FT                   VGVIGVEHLEDKKDFKLEKLYIDIGAKDKKEAEELVKIGESGSFVGEFVEAGDRLISKA
FT                   FDDRIGCYVAIEALKNVKTENELYFVFTVQEEVGLRGATTAAYSINPDFAIAVDVTATG
FT                   DTPKAKKMAVALGKGAAIKVMDRSIIVSPSVRDMMIEVAKENSIPYQLEILEFGGTDAG
FT                   AIHLSRGGVPSGVISIPTRYVHSVSEMVDKKDVEASINLLIKILEK"
FT   regulatory      454869..454891
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(454869..454891)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      455137..455186
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(455137..455186)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(455202..456305)
FT                   /locus_tag="TTE0444"
FT   CDS_pept        complement(455202..456290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7518076|pir||E75012
FT                   hypothetical protein PAB1273 - Pyrococcus abyssi (strain
FT                   Orsay) gi|5459053|emb|CAB50539.1| (AJ248288) hypothetical
FT                   protein [Pyrococcus abyssi], score 280, E-value 2.00E-74"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23728"
FT                   /db_xref="GOA:Q8RCI4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI4"
FT                   /protein_id="AAM23728.1"
FT                   /translation="MDFINQALNFYSEEIEAYTLYSYLSKIEKSPEIKKRFKKLSEMEK
FT                   NHAAFWEKFLKDRKAQVPKLKSQPFKLFIYRIFRKLLGNKLFVTILEMNETSTTECYFK
FT                   FLNEVPLSDEEKTVLSRIIEEELEHEKLFSQQKDRISIENIRDFIMGMNDGLVEILGTV
FT                   TGLSAVYPKNPITVGTAGLVVGVAGALSMAIGAYTSVRSQRQVNEGIKKKMELLFKVSK
FT                   ERAKEEFLNKLQDSGIPMEVGEEIAEKLNNNEEAMTNLLTEEITENEVKSALYTGIAYL
FT                   VGLVFPVIPYFFISSSSLLALAFSVIFAAIALSIVGTVVSVASESLSIKGKITEMVITG
FT                   LGAAALSYLFGTLVQKVFGITA"
FT   regulatory      complement(456301..456305)
FT                   /locus_tag="TTE0444"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(456343..456363)
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(456368..459901)
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT   CDS_pept        complement(456368..459889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, alpha subunit"
FT                   /note="Best Blastp hit = gi|4972241|emb|CAB43935.1|
FT                   (Y17727) pyruvate ferredoxin oxidoreductase [Clostridium
FT                   pasteurianum], score 1671, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23729"
FT                   /db_xref="GOA:Q8RCI3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI3"
FT                   /protein_id="AAM23729.1"
FT                   /translation="MAKVMKTMDGNTAAAHVAYAFTEVAAIYPITPSSPMAELVDAWSA
FT                   HGRKNIFGQTVKVIEMQSEAGAAGAVHGSLAAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   LPGVFHVSARAVATHALSIFGDHSDVMACRQTGFALLASGSVQEVMDLGAVAHLSAIKG
FT                   RVPFLHFFDGFRTSHEVQKIEVLDYDDLAKLIDYEALKAFRDRALRPEKPVTRGTAQNP
FT                   DIFFQGREAANRFYNALPEVVEYYMNEINKLTGRNYKLFNYYGAPDAERIIVAMGSVTE
FT                   TIEETIDYLMKKGEKVGLVKVHLYRPFSIKHFLEVVPKTVKKIAVLDRTKEPGSIGEPL
FT                   YEDVKTAFYESELKPVIVGGRYGLGSKDTTPAQIIAVFENLKLEEPKNHFTIGIVDDVT
FT                   NTSLPVGEEIDTSPEGTTSCKFWGFGSDGTVGANKSAIKIIGDNTDLYVQAYFQYDSKK
FT                   SGGVTVSHLRFGKKPIRSTYLVNTADFIACHKQSYVYRYDILKGLKDGGTFLLNCNWKP
FT                   EELEEKLPASIKRYLARHNINFYIINAVDIAKEIGLGGRINMIMQSAFFKLTNIIPIED
FT                   AVKHLKEAIVEEYGHKGEKIVQMNFEAVERGINSLVKVEVPPHWADAQDEPEEERNVPE
FT                   FIKNVADVMNRLEGDNLPVSAFLGREDGTFPPGTAAYEKRGIAVDVPEWQIDNCIQCNQ
FT                   CAFVCPHAAIRPFLLTEEEVKNAPEGFKVKKAIGKGFEGLYYRIQVSVLDCTGCGVCVN
FT                   ECPAKEKALVMKPLETQLHEAENWEYAMTLSPKPNPMSKETVKGSQFEQPLLEFSGACA
FT                   GCGETPYVKLITQLFGDRMMIANATGCSSIWGASAPSTPYTVNHEGKGPAWANSLFEDN
FT                   AEFGLGMVLAVKQQRMKLADIVKELLEQNITAELKEALQFWLDNMMDGEKSKEASKKLL
FT                   PILENYKAENEKVKTLINEILERKDYLVKKSQWIIGGDGWAYDIGYGGLDHVLASGEDV
FT                   NILVLDTEVYSNTGGQSSKATPLGAVAQFAAAGKPLIKKDLGRMAMTYGYVYVAQVAMG
FT                   ASQTQLMKALIEAERYPGPSLIIAYAPCIAHGIDMSESQIEQKRAVESGYWILYRYNPL
FT                   LKKEGKNPFILDSKPPKLSFQEFLRREVRFTALERTFPERAKELFEEAEKAAMERYKIY
FT                   ERMAKEE"
FT   misc_feature    complement(457775..457846)
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT                   /note="Pfam match to entry fer4, 4Fe-4S binding domain,
FT                   score 28.6, E-value 9.00E-05"
FT   misc_feature    complement(458063..458617)
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT                   /note="Pfam match to entry POR, Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, score 287.9, E-value
FT                   1.20E-82"
FT   misc_feature    complement(459146..459844)
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT                   /note="Pfam match to entry POR_N, Pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding
FT                   domain, score 415.3, E-value 5.50E-121"
FT   regulatory      complement(459897..459901)
FT                   /gene="PorA"
FT                   /locus_tag="TTE0445"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(460152..461702)
FT                   /gene="PotE"
FT                   /locus_tag="TTE0446"
FT   CDS_pept        complement(460152..461690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PotE"
FT                   /locus_tag="TTE0446"
FT                   /product="Amino acid transporters"
FT                   /note="Best Blastp hit = gi|8039815|sp|P39282|YJEM_ECOLI
FT                   HYPOTHETICAL 54.7 KDA PROTEIN IN POXA-PSD INTERGENIC
FT                   REGION, score 502, E-value 1.00E-141"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23730"
FT                   /db_xref="GOA:Q8RCI2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI2"
FT                   /protein_id="AAM23730.1"
FT                   /translation="MQKGVNDAKKLALIPLILMIFTSVFGFTNIPRSFYLMGYGAIPWY
FT                   LLSGITFFIPYAFMMAEYGSAFKEEKGGIYSWMEKSVNPKYAFIGTFMWYASYIIWMVN
FT                   VSSSIWIPLSNAIFGKDTTSTWSLFGLKATQTLGLLGVIWVITVTYIASHGLKSISKVT
FT                   SVGGTAVALLNIVLLFGGIFVLVANKGKIAQPVASASAFISSPNPAYQTTLAMLAFLVF
FT                   AIFAYGGLEVVSGLVDQTEKPEKNFPRGLLISAILISIGYSLGIFMVGTFTNWKEVLGS
FT                   QNVNMANVAYVVMNNLGYQIGHALGLPEATSLAIGAWFARYVGLSMFLALTGAFFTLTY
FT                   APLKQIIEGTPAKLWPGKIAKIEDGIPKTAMWVQCSIAVVIIILVSFGGEAAARFFAKL
FT                   ILMTNVAMTLPYVFLSGAFYSFKKNKQIKKPFEIFKSNASSLIATVIVTATVAFANFFT
FT                   IIQPAIEGDLSSTIWMIVGPVFFSLVALLMYNRYEHVKEKSPVKVSTKIKPEHK"
FT   regulatory      complement(461698..461702)
FT                   /gene="PotE"
FT                   /locus_tag="TTE0446"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            462015..462250
FT                   /locus_tag="TTE0447"
FT   regulatory      462015..462019
FT                   /locus_tag="TTE0447"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462029..462250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23731"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI1"
FT                   /protein_id="AAM23731.1"
FT                   /translation="MSAHIIGICDSFDAMTTKRPYNQKRLKSMHEAMLELKTMPYKYNY
FT                   KIVEALEEVVREIKGDQRYFISQYREGN"
FT   gene            462237..464230
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT   regulatory      462237..462241
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462251..464230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="Best Blastp hit = gi|730003|sp|P39215|MCPB_BACSU
FT                   METHYL-ACCEPTING CHEMOTAXIS PROTEIN MCPB (H3)
FT                   gi|459688|gb|AAA20554.1| (L29189) transmembrane receptor
FT                   [Bacillus subtilis] gi|2635610|emb|CAB15104.1| (Z99119)
FT                   methyl-accepting chemotaxis protein [Bacillus subtilis]
FT                   gi|2635622|emb|CAB15115.1| (Z99120) methyl-accepting
FT                   chemotaxis protein [Bacillus subtilis], score 231, E-value
FT                   2.00E-59"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23732"
FT                   /db_xref="GOA:Q8RCI0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCI0"
FT                   /protein_id="AAM23732.1"
FT                   /translation="MRSVRTKLLVLMVLFILIPLVIAGYFSTNIAESVLKSKINDSNQT
FT                   ALSVLNKYVNSFKRDTETIVQMLSESNEILNYDGSQASDEAVLKKLEETKKAMPDAMNV
FT                   YFATPSKKMILYPIQKLENYDPTERPWYKEAVNANGKITWTEPYQDFNTKVPEITVTKA
FT                   VLDSSGKLIGVLGIDISLEQLSKNISDVKLGKTGYIYVVTKDGITISHPDSTKLFTSIK
FT                   KYDFGERLLATKNSTIQYVSNNILKFASVRDLDSFGWKAVVTMDNSELTGDVTKIRNFI
FT                   ITVSIVILLIGIVIAYFFSNSISSGIKKVVTAMEEASQGNITVRADVKTKDEVGVLANS
FT                   FNTMLEGIKKLIFDIKSVSESVNHSAENLAVASEQAAQATQDVAKAIEEIAQGASSQAK
FT                   EAEESANATVVLGQLIDSSLKNAEEINHEVENVNMVSNEGLVTIKELIEKTKHTIQANN
FT                   NVKEATNYLLEKSAEIEKIVETITNIADQTNLLSLNAAIEAARAGEAGRGFAVVADEVR
FT                   KLAEQSSQAARNIANLIAEIQSTINNTHRTVEDSTKSIEEQSEVVNTTKDVFEGILNAV
FT                   KFIVEKIENLTKSLREIEEHKNRIVDSIQNIAAVSEEAAASAEEVSATSEEQSAIVEEM
FT                   ASTANELKSYANTLIEAIKQFKVE"
FT   misc_feature    462680..462922
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT                   /note="Pfam match to entry Cache, Cache domain, score 74.7,
FT                   E-value 1.60E-19"
FT   repeat_region   463090..464230
FT                   /note="TLR107, identity:100%, copy 1"
FT   misc_feature    463091..463300
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT                   /note="Pfam match to entry HAMP, HAMP domain, score 57.2,
FT                   E-value 3.60E-13"
FT   misc_feature    463670..463852
FT                   /gene="Tar"
FT                   /locus_tag="TTE0448"
FT                   /note="Pfam match to entry MCPsignal, Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 122.2,
FT                   E-value 1.70E-33"
FT   gene            464342..466003
FT                   /gene="HutU"
FT                   /locus_tag="TTE0449"
FT   regulatory      464342..464346
FT                   /gene="HutU"
FT                   /locus_tag="TTE0449"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        464354..466003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HutU"
FT                   /locus_tag="TTE0449"
FT                   /product="Urocanate hydratase"
FT                   /note="Best Blastp hit = gi|10174601|dbj|BAB05702.1|
FT                   (AP001513) uroconase (urocanate hydratase) [Bacillus
FT                   halodurans], score 731, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23733"
FT                   /db_xref="GOA:Q8RCH9"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCH9"
FT                   /protein_id="AAM23733.1"
FT                   /translation="MSRVVRAPRGTELHCKNWQIEAPYRMIMNNLDPEVAEDPANLIVY
FT                   GGAGKAARNWEAFDKILESLENLEEDETLLVQSGKPVGIFKTHEMAPRVLISNAMLVPK
FT                   WANWETFWDLEAKGLTMYGQMTAGSWIYIGSQGIVEGTFETFAALAKKHFDGSLKGKFV
FT                   LSAGLGGMGGAQPLAITMLDGACLIVEVDRNRIKRRLETKYLDVMAEDLDEALGMVMKA
FT                   KEEGRALSVGLVGNAADVHPELVRRGIIPDVVTDQTSAHDPLNGYVPNGMTLDEAIALR
FT                   KSNPEEYIKRAKKAMAEHVLAMLEMQKRGAIVFDYGNNIRRMAYDEGVKDAFNIPSYVP
FT                   EYIRDLFCEGKGPFRWVALSGDPEDIYKTDQKVLELFPDDPILNRWIRLARERVKFQGL
FT                   PARICWLGYGQRAEFGLAINEMVRKGELKAPIVIGRDHHDTGSVASPYRETEAMKDGSD
FT                   AIADWPILNALLNTASGATWVSVHHGGGVGIGYSIHAGVVVCADGTKETDLRIERVLTG
FT                   DPGLGIVRHADAGYEIAIKTAKEKGIKMPMLK"
FT   misc_feature    464354..466000
FT                   /gene="HutU"
FT                   /locus_tag="TTE0449"
FT                   /note="Pfam match to entry Urocanase, Urocanase, score
FT                   1159.2, E-value 0"
FT   gene            466018..466923
FT                   /locus_tag="TTE0450"
FT   regulatory      466018..466022
FT                   /locus_tag="TTE0450"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        466027..466923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0450"
FT                   /product="Glutamate formiminotransferase"
FT                   /note="Best Blastp hit = gi|7462794|pir||D72326
FT                   hypothetical protein TM0843 - Thermotoga maritima (strain
FT                   MSB8) gi|4981376|gb|AAD35925.1|AE001751_5 '(AE001751)
FT                   formiminotransferase-
FT                   cyclodeaminase/formiminotetrahydrofolate cyclodeaminase,
FT                   putative [Thermotoga maritima]', score 343, E-value
FT                   2.00E-93"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23734"
FT                   /db_xref="GOA:Q8RCH8"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH8"
FT                   /protein_id="AAM23734.1"
FT                   /translation="MNQIIECVPNVSEGRDQEKISELIKEVVSTEGVKLLDYSSDKDHN
FT                   RTVITFVGDKEGVKEAAFKLIKKASEIIDMRYHKGEHPRIGAVDVVPFVPVKNVTMEEC
FT                   VQIARELGERVGKELNIPVYLYEEAATTPERKNLENIRRGEYEGFFEKIKQPEWKPDFG
FT                   PSEMNPKSGAIVIGARNFLIAFNVNLGTNDIEIANKIAKAVRFSSGGYRYVKAMGVELR
FT                   ERGIVQVSMNLTDFNKTPIYRVFETIKAEASRYGVNVVGSEIIGLVPSKALLDVADYYL
FT                   RLENFSMDMVLENRIYE"
FT   gene            466923..468180
FT                   /gene="HutI"
FT                   /locus_tag="TTE0451"
FT   regulatory      466923..466927
FT                   /gene="HutI"
FT                   /locus_tag="TTE0451"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        466933..468180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HutI"
FT                   /locus_tag="TTE0451"
FT                   /product="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /note="Best Blastp hit = gi|1170424|sp|P42084|HUTI_BACSU
FT                   IMIDAZOLONEPROPIONASE (IMIDAZOLONE-5-PROPIONATE HYDROLASE)
FT                   gi|7475575|pir||D69643 imidazolone-5-propionate hydrolase
FT                   hutI [imported] - Bacillus subtilis
FT                   gi|603768|dbj|BAA06642.1| '(D31856) HutI protein,
FT                   imidazolone-5-propionate hydrolase [Bacillus subtilis]'
FT                   gi|2636483|emb|CAB15973.1| (Z99124)
FT                   imidazolone-5-propionate hydrolase [Bacillus subtilis],
FT                   score 394, E-value 1.00E-109"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23735"
FT                   /db_xref="GOA:Q8RCH7"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCH7"
FT                   /protein_id="AAM23735.1"
FT                   /translation="MRADLLIYNISKIYTPIGTKPLCGEDMEKIEEIENAYIAIKDGKI
FT                   LAAGKSPAAISAEREIDAKGMIALPGFVDPHTHVMHYGSRENEMALKLKGYSYIDILKQ
FT                   GGGIHSTVRATREASDEALLQKALKSLEIMLSHGVTTVEVKSGYGLNTEQEIRLLRLMN
FT                   QLKSLSVVDIVPTFLGAHAIPQEFEENPWRYVEKVINEMLPKVKEEDLAEFCDVFCEEG
FT                   AFDYEQSKKILEEAKKLGFRLKIHADELTHSKGGELAGILGAISADHLEEVSDEGIDLM
FT                   KKAGTVAVLLPGVSFFLNRPYADARRLIERGLPVALGTDYNPGTSPTENLQLIMSFAYI
FT                   NMKMRAEEILTAVTLNAACAIDRGDEIGTIEEGKRADIVLVDAPNLDYMMYHFGINHVN
FT                   TVIKAKGNDVVVIGIK"
FT   misc_feature    467332..468171
FT                   /gene="HutI"
FT                   /locus_tag="TTE0451"
FT                   /note="Pfam match to entry ATZ_TRZ, Chlorohydrolase, score
FT                   -33, E-value 8.30E-07"
FT   gene            468202..468645
FT                   /locus_tag="TTE0452"
FT   regulatory      468202..468206
FT                   /locus_tag="TTE0452"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        468214..468645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7430259|pir||G69160 conserved
FT                   hypothetical protein MTH464 - Methanobacterium
FT                   thermoautotrophicum (strain Delta H)
FT                   gi|2621532|gb|AAB84970.1| (AE000830) unknown
FT                   [Methanothermobacter thermautotrophicus], score 51.6,
FT                   E-value 5.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23736"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH6"
FT                   /protein_id="AAM23736.1"
FT                   /translation="MFAVSQKLLEICEKYKIGLVYLFGSQKENALKLLQGEKVVIDDPL
FT                   ADIDVGVVFLEDIEKIEKRYLLYADIYNELEDLFKPYKLDLVFLQENHSIFQLEALKGI
FT                   CVYSYSEEFKDSYEMQILRRAADFKYMYDKYIEEVLEKY"
FT   gene            468626..469088
FT                   /locus_tag="TTE0453"
FT   regulatory      468626..468630
FT                   /locus_tag="TTE0453"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        468651..469088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7518156|pir||A75034
FT                   hypothetical protein PAB1546 - Pyrococcus abyssi (strain
FT                   Orsay) gi|5458679|emb|CAB50166.1| (AJ248287) hypothetical
FT                   protein [Pyrococcus abyssi], score 83.2, E-value 1.00E-15"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23737"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH5"
FT                   /protein_id="AAM23737.1"
FT                   /translation="MVGNMINRQLILERLILISEYLEELKVLSSMDKATFLSDKRNSAA
FT                   AESFLRRTLEAIFDIGRHILAKSGNIELSKEYKSIARGLGEYGYIDEELSKKLVKMAGY
FT                   RNRMVHLYNLVTDEELYEIITSNLNDIEEFVKEIKNKVLLE"
FT   gene            complement(469160..469330)
FT                   /locus_tag="TTE0455"
FT   CDS_pept        complement(469160..469330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|6226549|sp|O33830|AGLA_THEMA
FT                   ALPHA-GLUCOSIDASE (MALTASE) gi|7462053|pir||F72205
FT                   alpha-glucosidase - Thermotoga maritima (strain MSB8)
FT                   gi|4982417|gb|AAD36897.1|AE001820_6 (AE001820)
FT                   alpha-glucosidase [Thermotoga maritima], score 84.7,
FT                   E-value 1.00E-16"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23738"
FT                   /db_xref="GOA:Q8RCH4"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH4"
FT                   /protein_id="AAM23738.1"
FT                   /translation="MFHFLILALSTGDIDIIKELLYRDPRTQNDEQVEKVLEEILSLPE
FT                   NKEMRKHYLKK"
FT   gene            469335..470065
FT                   /locus_tag="TTE0456"
FT   regulatory      469335..469339
FT                   /locus_tag="TTE0456"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        469349..470065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0456"
FT                   /product="Methenyl tetrahydrofolate cyclohydrolase"
FT                   /note="Best Blastp hit = gi|13540921|ref|NP_110609.1|
FT                   Formiminotransferase cyclodeaminase [Thermoplasma
FT                   volcanium], score 107, E-value 1.00E-22"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23739"
FT                   /db_xref="GOA:Q8RCH3"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH3"
FT                   /protein_id="AAM23739.1"
FT                   /translation="MLQRFAFIGIISGVKTFEKGDGVVLINDSLKGYIEKVASASPTPG
FT                   GGSVSAAAASLGIALSKMVYDLTIGRKFYEEYSEDIKEEIQEGLNICNRLLEEYMKLVD
FT                   EDTAAYDEVMKALKMPKNTEEEKKIRSEVLQKAYINAMNVPLKLARLCGEGFTPTALIA
FT                   EYGNPNAVSDAAVGAILLYAAMEGAVLNVKVNLPYIKDKKLAEEAKKECDELLNKYRSV
FT                   RNEIVSKVLNKISGEY"
FT   gene            470254..471325
FT                   /gene="Med"
FT                   /locus_tag="TTE0457"
FT   regulatory      470254..470258
FT                   /gene="Med"
FT                   /locus_tag="TTE0457"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        470267..471325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Med"
FT                   /locus_tag="TTE0457"
FT                   /product="Surface lipoprotein"
FT                   /note="Best Blastp hit = gi|11065692|emb|CAC14304.1|
FT                   (AJ276209) putative substrate binding lipoprotein precursor
FT                   of an ABC transporter [Clostridium sticklandii], score 243,
FT                   E-value 3.00E-63"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23740"
FT                   /db_xref="GOA:Q8RCH2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH2"
FT                   /protein_id="AAM23740.1"
FT                   /translation="MRRWRVVLASLLILVLALSVVLSGCSSKTKQESTQPQQTTEANKN
FT                   KNFKVGLVTDVGGINDRSFNQMAYEGLQRAAKELGVTVNVIQSKQMTDYVPNLTNFAQQ
FT                   GYDLVISVGFMMHDATEEVSQKFPNTKFLIIDSEITDRPNVASAMFKEQEVGYLAGALA
FT                   GLVEKEKVGKVKGTNIIGAVGGMQIPPVDRFIAGYQQGAKAVNPDIKILINYTNNFNDP
FT                   AAGKQMALTQISQGAEIIFQVAGGTGEGVIKAAQEKNLYAIGVDADQSYLAPDNVLTSA
FT                   VKRVDVAVYDVIKDALNGNFKSGIMYFDLKNNGVGLGKINKDVPQSIIDQVNQLAKDII
FT                   DGKIQVSDKISK"
FT   misc_feature    470306..471316
FT                   /gene="Med"
FT                   /locus_tag="TTE0457"
FT                   /note="Pfam match to entry Bmp, Basic membrane protein,
FT                   score 362.7, E-value 3.90E-105"
FT   regulatory      471338..471362
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            471366..472910
FT                   /gene="MglA3"
FT                   /locus_tag="TTE0458"
FT   regulatory      471366..471370
FT                   /gene="MglA3"
FT                   /locus_tag="TTE0458"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        471381..472910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MglA3"
FT                   /locus_tag="TTE0458"
FT                   /product="ABC-type sugar (aldose) transport system, ATPase
FT                   component"
FT                   /note="Best Blastp hit = gi|7430342|pir||D70009 probable
FT                   ABC transporter yufO - Bacillus subtilis
FT                   gi|1934812|emb|CAB07937.1| (Z93937) unknown [Bacillus
FT                   subtilis] gi|2635651|emb|CAB15144.1| (Z99120) similar to
FT                   ABC transporter (ATP-binding protein) [Bacillus subtilis],
FT                   score 548, E-value 1.00E-155"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23741"
FT                   /db_xref="GOA:Q8RCH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH1"
FT                   /protein_id="AAM23741.1"
FT                   /translation="MSAILEVRNITKRFPKVVANDNVNLTVERGEIHAILGENGAGKST
FT                   LMNIIYGLYKPDSGQLIFDGEELNLSGPHEAIEKGIGMVHQHFMLIPVFTVAENIVLGA
FT                   EPKGITYDRKKANELIREISEKYHLEIDPDAKVKDLSVGLQQRVEILKAFYRKAKLLIL
FT                   DEPTAMLTPQETQKLFEIMRELKQQGMSIIFISHKLEEVLEISDRVTVMRRGKTVGTLK
FT                   TKETNEQELANLMVGREVVLRIEKSEYKPGDVVLSVKNLTVVDQQNVTRVKDVSFEIRE
FT                   GEIFGLAGIDGNGQLELVEAIMGLRPKKSGSVFFYGKDVTNFSTRQLYREGISYIPQDR
FT                   QADGLVLDFTIAENLILREYKDPTYSRRGVIQYKKVYENAEKKVKEFDVRPPEYMLKAR
FT                   NLSGGNQQKVILAREVGYNPKLLIAVQPTRGMDVGAIEYIHRRILELRDKGAAIFLVSL
FT                   ELEEIMSLSDRIGVIYKGQLMDILDGKTATKEQIGLLMAGSRFDKTTLEAR"
FT   misc_feature    471468..472025
FT                   /gene="MglA3"
FT                   /locus_tag="TTE0458"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   213, E-value 4.50E-60"
FT   misc_feature    472224..472808
FT                   /gene="MglA3"
FT                   /locus_tag="TTE0458"
FT                   /note="Pfam match to entry ABC_tran, ABC transporter, score
FT                   42.3, E-value 1.10E-08"
FT   gene            472897..473965
FT                   /locus_tag="TTE0459"
FT   regulatory      472897..472901
FT                   /locus_tag="TTE0459"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472910..473965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0459"
FT                   /product="uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /note="Best Blastp hit = gi|7451350|pir||H72418 'sugar ABC
FT                   transporter, permease protein - Thermotoga maritima (strain
FT                   MSB8)' gi|4980594|gb|AAD35198.1|AE001696_12 '(AE001696)
FT                   sugar ABC transporter, permease protein [Thermotoga
FT                   maritima]', score 200, E-value 2.00E-50"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23742"
FT                   /db_xref="GOA:Q8RCH0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCH0"
FT                   /protein_id="AAM23742.1"
FT                   /translation="MKNLWKELYIPIVAVLVAIIIGSIIMLATGFNPVKAYVSLFIGAF
FT                   GNLNNIANTLANAVPLILTGLGVAISFKTGLFNIGAEGQYWIGAIVAVWIGYSFSLPWY
FT                   IHIPLALIAAMIAGGLWAGIVPGLAKAYTGANEVITTMMMSYIAIYFSHFLLEFGPMME
FT                   KGSTIPQSPLIKDSAVIPFLIKNTQLSYGIFIALAAAIFVYWFMFKTTWGFEMRAVGYN
FT                   QRAARYAGMNVPLNMVFALGLSGAFAGLAGAVQMLGVQHRLYDSFTSGYGYTAIVVALL
FT                   ANNHPIGVIFAAILFAALGTGSQYMQLNAQVPGQMADVITGLIVFFVAAHRIAEVIKDL
FT                   LARKQKKEVKA"
FT   gene            473949..474885
FT                   /locus_tag="TTE0460"
FT   regulatory      473949..473953
FT                   /locus_tag="TTE0460"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        473962..474885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0460"
FT                   /product="uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /note="Best Blastp hit = gi|7450275|pir||A72419 'sugar ABC
FT                   transporter, permease protein - Thermotoga maritima (strain
FT                   MSB8)' gi|4980595|gb|AAD35199.1|AE001696_13 '(AE001696)
FT                   sugar ABC transporter, permease protein [Thermotoga
FT                   maritima]', score 243, E-value 2.00E-63"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23743"
FT                   /db_xref="GOA:Q8RCG9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG9"
FT                   /protein_id="AAM23743.1"
FT                   /translation="MKEILLNPQLWAATLAMATPLALPALGGTFSERSGVVNIAMEGIM
FT                   LIAAFFAVMFAHMTGNAWIGLLGAIVVGLIVALIFAWAAVSLTANQIILGMAINIFASG
FT                   VTAYLLNTIYGFTGTPVDTPMLPTVEIPIIKDIPFVGHVLSGHSVIVYLMIIILFISDY
FT                   FLFHTNLGLRLRAVGENPEAAETAGIDVIKLRYLGVALSGLLSAMGGAYLSIGALNSFN
FT                   PDMTSGRGYIALAAMIFGKWTPFGSFGASLLFGFATALSMQLQNTAFSKNLIMMLPYAL
FT                   TILALVGIGGKSVPPAADGVPYTPKK"
FT   gene            474893..475631
FT                   /gene="PhnF"
FT                   /locus_tag="TTE0461"
FT   regulatory      474893..474897
FT                   /gene="PhnF"
FT                   /locus_tag="TTE0461"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        474906..475631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PhnF"
FT                   /locus_tag="TTE0461"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|10175014|dbj|BAB06113.1|
FT                   (AP001515) transcriptional regulator (GntR family)
FT                   [Bacillus halodurans], score 216, E-value 3.00E-55"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23744"
FT                   /db_xref="GOA:Q8RCG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG8"
FT                   /protein_id="AAM23744.1"
FT                   /translation="MLLPEKKPLYELALKKMEELIKTGQWKEGSKLPSESQLAKQFGIS
FT                   RATLREAMRILEEEGLIVKQQGVGTFVRRKPLIKSGLEELFSVTALIERQGMVPGTKDF
FT                   TVYKLPATENEAKHLRIKPGDIIYKVERIRTADNVPVVYCIDRLPENIVGESFTGFEQS
FT                   IFSYLEAEHSIRITYAISHIRVIKHDPVVEKKLMMDKNDSILLLEQVHYDENNTPILFS
FT                   SNYFNASKFDFYIVRKRTL"
FT   misc_feature    474942..475121
FT                   /gene="PhnF"
FT                   /locus_tag="TTE0461"
FT                   /note="Pfam match to entry gntR, Bacterial regulatory
FT                   proteins, gntR family, score 88.9, E-value 6.00E-26"
FT   gene            475636..476053
FT                   /gene="Cdd"
FT                   /locus_tag="TTE0462"
FT   regulatory      475636..475640
FT                   /gene="Cdd"
FT                   /locus_tag="TTE0462"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        475646..476053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Cdd"
FT                   /locus_tag="TTE0462"
FT                   /product="Cytidine deaminase"
FT                   /note="Best Blastp hit = gi|5689648|emb|CAB51906.1|
FT                   (AJ237978) cytidine deaminase [Bacillus psychrophilus],
FT                   score 158, E-value 3.00E-38"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23745"
FT                   /db_xref="GOA:Q8RCG7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG7"
FT                   /protein_id="AAM23745.1"
FT                   /translation="MEYRDYEKLIEIAKEARENAYAPYSNFKVGACVLTEDGNIYKGCN
FT                   IENASFGLTVCAERVAMFNAYSGGERKLKAIAVVADTDGPVSPCGACRQVMMELGGEDM
FT                   VVILSNMKGDHAIMTVRDLLPGAFTSKDMEK"
FT   misc_feature    475652..475969
FT                   /gene="Cdd"
FT                   /locus_tag="TTE0462"
FT                   /note="Pfam match to entry dCMP_cyt_deam, Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region, score 106.5,
FT                   E-value 5.00E-28"
FT   gene            476074..477265
FT                   /gene="DeoB"
FT                   /locus_tag="TTE0463"
FT   regulatory      476074..476078
FT                   /gene="DeoB"
FT                   /locus_tag="TTE0463"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        476084..477265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DeoB"
FT                   /locus_tag="TTE0463"
FT                   /product="Phosphopentomutase"
FT                   /note="Best Blastp hit = gi|7437406|pir||JE0180
FT                   phosphopentomutase (EC 5.4.2.7) - Bacillus
FT                   stearothermophilus TH6-2 gi|2558482|dbj|BAA22917.1|
FT                   (AB008120) phosphopentomutase [Bacillus
FT                   stearothermophilus], score 470, E-value 1.00E-131"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23746"
FT                   /db_xref="GOA:Q8RCG6"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCG6"
FT                   /protein_id="AAM23746.1"
FT                   /translation="MLQRVILIVLDSVGVGELPDAYKFGDKGTNTLGHVVEKTGIKLPT
FT                   MEKLGLGNIIPLKTVAPNPNAIGAYGKMAEKSAGKDTTTGHWEIAGLIVEKPFPTYPEG
FT                   FPKEIIEEFEKRIGRKVLGNKPASGTEIIKELGEEHIKTGYPIVYTSADSVFQIAAHEE
FT                   VIPLEELYRMCEIAREILKGDHAVGRVIARPFIGSPGNFVRTANRRDFSLKPFGPTVLD
FT                   MLKEAGYQVYAVGKIEDIFAGQGITDSVHTGNNDEGITATIEAMDAVKKGIIFTNLVDF
FT                   DMVYGHRNDVNGYAKALKHFDERLPEIMLRLKEEDLLIITADHGCDPTTPGTDHTREYV
FT                   PLLVYSPSMKEGRNLGLRKTYADVAATIAEIFNVGPIHTGTSFLRELPLKVGV"
FT   misc_feature    476837..477166
FT                   /gene="DeoB"
FT                   /locus_tag="TTE0463"
FT                   /note="Pfam match to entry Metalloenzyme, Metalloenzyme
FT                   superfamily, score 126.9, E-value 3.70E-34"
FT   gene            477256..478564
FT                   /gene="DeoA"
FT                   /locus_tag="TTE0464"
FT   regulatory      477256..477260
FT                   /gene="DeoA"
FT                   /locus_tag="TTE0464"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        477269..478564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DeoA"
FT                   /locus_tag="TTE0464"
FT                   /product="Thymidine phosphorylase"
FT                   /note="Best Blastp hit = gi|2501426|sp|P77836|PDP_BACST
FT                   PYRIMIDINE-NUCLEOSIDE PHOSPHORYLASE (PYNP)
FT                   gi|2126872|pir||JT0875 pyrimidine-nucleoside phosphorylase
FT                   (EC 2.4.2.2) - Bacillus stearothermophilus
FT                   gi|2126873|pir||JC4992 pyrimidine-nucleoside phosphorylase
FT                   (EC 2.4.2.2) - Bacillus stearothermophilus
FT                   gi|1620901|dbj|BAA13512.1| (D87961) Pyrimidine nucleoside
FT                   phosphorylase [Bacillus stearothermophilus], score 496,
FT                   E-value 1.00E-139"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23747"
FT                   /db_xref="GOA:Q8RCG5"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG5"
FT                   /protein_id="AAM23747.1"
FT                   /translation="MRMYDLILKKRDGGILTKEEIDFIISGYTKDYIPDYQISALLMAI
FT                   YFRGMTPEETSHLTMAMAYSGDVLDLSRIKGIKVDKHSTGGVADTTTLVLAPMVAACGA
FT                   PVAKMSGRGLGHTGGTIDKLESIPGMRVELSEEEFIDNVNKYGIAIIGQTKNLTPADKK
FT                   LYALRDVTATVDSIPLIASSIMSKKIAAGADGIVLDVKVGRGAFMKDLESAKKLAKLMV
FT                   DIGNSVGRKTVAHVTNMDYPLGLAIGNALEVLEAIQVLKGHGSKDLLEVCMLLGSDMLQ
FT                   IAGIAKDDNEARAKLKDALESGKALQKFKEFIRAQGGDDRVVDDPTLLPQAKYVRPWIA
FT                   DRDVYIKDLMALDLGLLAMKLGAGRERKEDKIDLAVGIMLGGKVGEVIKKGEPIATIYA
FT                   NDESKADWAFEEIKKYILLSDEPVERPVLIYE"
FT   misc_feature    477269..477469
FT                   /gene="DeoA"
FT                   /locus_tag="TTE0464"
FT                   /note="Pfam match to entry Glycos_trans_3N, Glycosyl
FT                   transferase family, helical bundle domain, score 65.8,
FT                   E-value 9.20E-16"
FT   misc_feature    477491..478255
FT                   /gene="DeoA"
FT                   /locus_tag="TTE0464"
FT                   /note="Pfam match to entry Glycos_transf_3, Glycosyl
FT                   transferase family, a/b domain, score 209.9, E-value
FT                   3.90E-59"
FT   regulatory      478571..478585
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            478657..480316
FT                   /gene="Tar2"
FT                   /locus_tag="TTE0465"
FT   regulatory      478657..478661
FT                   /gene="Tar2"
FT                   /locus_tag="TTE0465"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        478670..480316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tar2"
FT                   /locus_tag="TTE0465"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="Best Blastp hit = gi|7462886|pir||A72254
FT                   methyl-accepting chemotaxis protein - Thermotoga maritima
FT                   (strain MSB8) gi|4981993|gb|AAD36498.1|AE001795_1
FT                   (AE001795) methyl-accepting chemotaxis protein [Thermotoga
FT                   maritima], score 97.8, E-value 3.00E-19"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23748"
FT                   /db_xref="GOA:Q8RCG4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG4"
FT                   /protein_id="AAM23748.1"
FT                   /translation="MGKTIKAQIVRSFVIIGILMLLLSLTVNLGLINTLNNIEKLRTYV
FT                   VNQVINVSSAQVQIAVLSGNIQQTLNDYMNGNVTNFSVGAPVTSIETYVNNIQNSLNDY
FT                   KNTKVYDSLNKNLTTIKQAVEDLKKAISELPEKYNPSEDSDKVVAVSYHLNHLQSALND
FT                   FSSTYSQGFLPYFNKIIQDNKKNFYVSLAISGVILLILFVYATVIIRKLKKYAEFINSE
FT                   ILNAEKQSEEVVKYASYVQEKSEENARNITSSRQGLEELVNGINIIAGNVSEVADSMNK
FT                   VSEVSEALSRVSDKLMKDMNEAMEKIKEIEGIVSKQGEEVKTLIRSLEERLHSSKDVSW
FT                   QLSELEEKMSGIKNILYSISNIADQTNLLALNAAIEAARAGENGRGFAVVAEEIRKLAA
FT                   QSTESVDKISEIIESLTLFTKETVGNVIENINESVKASQEVNKVLDIFERTKEGFEQVA
FT                   DIVSEISIAAEETALSSSQALEAVKSVMEASQNISAQVEELLASSEQLLSEINEVNENN
FT                   LKNLESIKEQVKYAKTQEENMQKIANIALQL"
FT   misc_feature    479723..479905
FT                   /gene="Tar2"
FT                   /locus_tag="TTE0465"
FT                   /note="Pfam match to entry MCPsignal, Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain, score 112.1,
FT                   E-value 1.30E-30"
FT   regulatory      480382..480407
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            480424..481385
FT                   /locus_tag="TTE0466"
FT   regulatory      480424..480428
FT                   /locus_tag="TTE0466"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        480438..481385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|12720619|gb|AAK02457.1|
FT                   (AE006073) unknown [Pasteurella multocida], score 273,
FT                   E-value 2.00E-72"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG3"
FT                   /protein_id="AAM23749.1"
FT                   /translation="MKRIFELTLKDIEGMDKNTLIETIKNSEGRTVMAETVITVPPLIY
FT                   GVSNLELAAAFGSDMITLNLFDFQRPFIFGIDDVGVNLSDVAGALSMMEEIALKNAKDT
FT                   EYVKKIKKIVGRFIGVNLEPVPEGVKYVEGRKLTEENLKRAREYGFDYIVITGNPNTGV
FT                   NETTVIQGIELAKKILGDKLMIVAGKMHGAGSGNIYDDKVLRDFVKAGADCVLIPAPGT
FT                   VPGIDLDLAKKQIDAIHEEGALAMTAIGTSQEGAQKSVIEYIAIQSKMAGADIQHIGDA
FT                   GYSGVAFPENIMALSIAIRGVRHTYRRMAYSLNK"
FT   gene            complement(481394..481640)
FT                   /locus_tag="TTE0467"
FT   CDS_pept        complement(481394..481630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23750"
FT                   /db_xref="GOA:Q8RCG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG2"
FT                   /protein_id="AAM23750.1"
FT                   /translation="MLYLVFEGFPAISYNTLLLIYFQALKQKSRQGLLDLYRLMPAYAV
FT                   TRRIVFVFAFIIYFVLNFVNNRFLYLKDLFKRR"
FT   gene            481620..482982
FT                   /gene="PtsG"
FT                   /locus_tag="TTE0468"
FT   regulatory      481620..481624
FT                   /gene="PtsG"
FT                   /locus_tag="TTE0468"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        481633..482982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PtsG"
FT                   /locus_tag="TTE0468"
FT                   /product="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /note="Best Blastp hit = gi|10173035|dbj|BAB04141.1|
FT                   '(AP001508) PTS system, N-acetylglucosamine-specific enzyme
FT                   II, ABC component [Bacillus halodurans]', score 418,
FT                   E-value 1.00E-116"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23751"
FT                   /db_xref="GOA:Q8RCG1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG1"
FT                   /protein_id="AAM23751.1"
FT                   /translation="MLPVAVLPAAALLLRLGAPDVFNIPFIMQAGAAVFDNLPLIFAVG
FT                   IAIGFAEGDGVAALAAAVGYFVLTKGATTINKDINMGVLGGILMGIIAGYLYNKYHDTK
FT                   LPDFLGFFGGKRFVPIVTAFAAIVLALIMGYVWPPIQNGIYAVGEWIIGAGALGVFVYG
FT                   VLNRLLIPFGLHHVINSLVWFVFGTFKTPAGKIVTGDLNRFFAGDPTAGIFMAGFYPIM
FT                   MFGLPAAALAMWAAAKPEQRKVVSGVFISAALTSFLTGITEPIEFSFMFLAPVLYVIHA
FT                   LLTGLSLAVTYVLGIKNGFGFSAGLIDYILSYGIATKPLLLVVIGVIYGVVYYVIFYYV
FT                   ITKFNLPTPGRLEEEAQDQYRDMSKSEISDVAAQYVEVLGGSDNIESLEACITRLRLTV
FT                   KDDTIVDDEKLKKLGATGVMRMGKNALQVIVGTKADLIAQEMKKHMKKKS"
FT   misc_feature    481633..482487
FT                   /gene="PtsG"
FT                   /locus_tag="TTE0468"
FT                   /note="Pfam match to entry PTS_EIIC, Phosphotransferase
FT                   system, EIIC, score 425.8, E-value 3.80E-124"
FT   regulatory      complement(481636..481640)
FT                   /locus_tag="TTE0467"
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    482746..482850
FT                   /gene="PtsG"
FT                   /locus_tag="TTE0468"
FT                   /note="Pfam match to entry PTS_EIIB, phosphotransferase
FT                   system, EIIB, score 56, E-value 1.30E-14"
FT   gene            483030..483535
FT                   /gene="NagE"
FT                   /locus_tag="TTE0469"
FT   regulatory      483030..483034
FT                   /gene="NagE"
FT                   /locus_tag="TTE0469"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        483041..483535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NagE"
FT                   /locus_tag="TTE0469"
FT                   /product="Phosphotransferase system IIA components"
FT                   /note="Best Blastp hit = gi|10174132|dbj|BAB05234.1|
FT                   '(AP001512) PTS system, glucose-specific enzyme II, A
FT                   component [Bacillus halodurans]', score 166, E-value
FT                   2.00E-40"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23752"
FT                   /db_xref="GOA:Q8RCG0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCG0"
FT                   /protein_id="AAM23752.1"
FT                   /translation="MVVMFGLFKRKKYVDVYSPMDGILVKIEEVPDPVFAQKMVGDGIA
FT                   VEPAKGLVVSPVDGTVIQLFPTKHALGIRTKEGLEILIHIGMDTVEMKGDGFESFVSEG
FT                   DRVKIGDKLITFDIEKVKEKHPLTSPVIITNGDIVDKIEKVEDSKEVKAGESRVMRVYL
FT                   K"
FT   misc_feature    483134..483445
FT                   /gene="NagE"
FT                   /locus_tag="TTE0469"
FT                   /note="Pfam match to entry PTS_EIIA_1,
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 1, score 202.1, E-value 8.40E-57"
FT   gene            483549..484378
FT                   /locus_tag="TTE0470"
FT                   /note="authentic frameshift, transcriptional
FT                   antiterminator; Best Blastx hit = emb|CAA72077.1| (Y11193)
FT                   transcription antiterminator [Bacillus subtilis], score
FT                   177, E-value 6.00E-53"
FT   gene            484480..485647
FT                   /gene="LeuA2"
FT                   /locus_tag="TTE0472"
FT   regulatory      484480..484484
FT                   /gene="LeuA2"
FT                   /locus_tag="TTE0472"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        484493..485647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuA2"
FT                   /locus_tag="TTE0472"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /note="Best Blastp hit = gi|7799773|emb|CAB91069.1|
FT                   (AJ239033) homocitrate sythase 1 [Anabaena variabilis],
FT                   score 387, E-value 1.00E-106"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23753"
FT                   /db_xref="GOA:Q8RCF9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCF9"
FT                   /protein_id="AAM23753.1"
FT                   /translation="MAFKKDKPVYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGID
FT                   QLEVGIPTMGGDEKETVAKIAKLGLKASIMAWNRAVVKDVQESLECGVDAVAISISTSD
FT                   IHIEHKLKKTRQWVLDSMTEAVRFAKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGA
FT                   DRLRFCDTVGFLDPFKTYEMVKAIKDAVDIEIEMHTHNDFGMATANALAGVKAGAKFVG
FT                   VTVNGLGERAGNAALEEVVMALKYVYKMDLGIDTSRFREISEYVALASGRPLPPSKAIV
FT                   GKNVFAHESGIHVDGALKNPYTYEVFDPQEVGLERQIVIGKHSGTAALINKFKEYGRVL
FT                   TEEEANLLLPHVRKMAIQLKRPLFDKELMYLYEDVIVKGKAKAI"
FT   misc_feature    484535..485338
FT                   /gene="LeuA2"
FT                   /locus_tag="TTE0472"
FT                   /note="Pfam match to entry HMGL-like, HMGL-like, score
FT                   392.5, E-value 4.20E-114"
FT   gene            485652..487590
FT                   /gene="AcnA"
FT                   /locus_tag="TTE0473"
FT   regulatory      485652..485656
FT                   /gene="AcnA"
FT                   /locus_tag="TTE0473"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        485665..487590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcnA"
FT                   /locus_tag="TTE0473"
FT                   /product="Aconitase A"
FT                   /note="Best Blastp hit = gi|7514223|pir||F70453 aconitase -
FT                   Aquifex aeolicus gi|2984078|gb|AAC07617.1| (AE000756)
FT                   aconitase [Aquifex aeolicus], score 715, E-value 0"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23754"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF8"
FT                   /protein_id="AAM23754.1"
FT                   /translation="MNLTQKILLAHLVEGKMAKGEEIAIKIDQTLTQDSTGTMAYLQLE
FT                   ALGIDRVKTELSVSYVDHNTLQQGPENADDHKYLQTVAARYGIYFSRPGNGICHQVHLE
FT                   RFGVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYRIIMPAIVNVRLKGEL
FT                   NPWVSAKDVILELLRRLTVKGGIGKIFEYSGDGVKTLSVPERTTIANMGAELGATTSIF
FT                   PSDERTYEFLKAQGREDVFVPLSADEDAEYDEVIEIDLSELEPMVALPHSPDNVVKVKD
FT                   AGRPRVDQVAIGSCTNSSYMDLMKVASILKGKTIPEHVSLVIAPGSRQVLTMLAKNGAL
FT                   ADLIAAGARILESACGPCIGMGQAPATGAVSVRTFNRNFYGRSGTKSAYVYLVSPEVAA
FT                   AAALTGYLIDPRELGEPPQVPLVERFEVNDNMIVKPPEDGKNVEVIKGPNIKPFPLNTP
FT                   LSDIEKKVLIKVGDDITTDHIMPSNARLLPLRSNIPELSKHCFEIIDENFSKRAVEWGG
FT                   GIIVGGHNYGQGSSREHAALVPLYLGVKAVIAKSFARIHKANLINSGILPLTFVKEEDY
FT                   EDIDMGDVLKIENTVEQVRSGKNIIVKNLTKGKSFEVRLEVSDRNREILIAGGMINYVK
FT                   SKNKTN"
FT   misc_feature    485668..486879
FT                   /gene="AcnA"
FT                   /locus_tag="TTE0473"
FT                   /note="Pfam match to entry aconitase, Aconitase family
FT                   (aconitate hydratase), score 413.1, E-value 1.20E-125"
FT   misc_feature    486985..487503
FT                   /gene="AcnA"
FT                   /locus_tag="TTE0473"
FT                   /note="Pfam match to entry Aconitase_C, Aconitase
FT                   C-terminal domain, score 65, E-value 1.60E-15"
FT   regulatory      487591..487612
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(487618..488424)
FT                   /gene="Gcd14"
FT                   /locus_tag="TTE0474"
FT   CDS_pept        complement(487618..488409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Gcd14"
FT                   /locus_tag="TTE0474"
FT                   /product="predicted SAM-dependent methyltransferase
FT                   involved in tRNA-Met maturation"
FT                   /note="Best Blastp hit = gi|7462313|pir||G72340 conserved
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4981273|gb|AAD35829.1|AE001744_19 (AE001744) conserved
FT                   hypothetical protein [Thermotoga maritima], score 191,
FT                   E-value 7.00E-48"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23755"
FT                   /db_xref="GOA:Q8RCF7"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF7"
FT                   /protein_id="AAM23755.1"
FT                   /translation="MKSIHNKRIIVGPDNFKKVVDITSSGKVGLPKGQVDVQFLAKLAP
FT                   GTSFEIQGEKYYLLECDTFDYIMYSLKRQTQIVYPKEGSYIAMRLDIFPGKRVGEAGTG
FT                   SGAFTVYLSRLVGPHGRVYTYEQREEFFKLARKNLDEFCEYDNVIMYNKSISDGIEEKE
FT                   LDAFFLDVRKPWEVLEQVSGALKLGGHLGILVPTTNQVSEALVALEKSGFYTIEVSEIL
FT                   LRKYKINPERLRPEDLMIGHTGYLIFARKISDRGDGSSHPI"
FT   regulatory      complement(488420..488424)
FT                   /gene="Gcd14"
FT                   /locus_tag="TTE0474"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            complement(488467..488862)
FT                   /locus_tag="TTE0475"
FT   CDS_pept        complement(488467..488850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23756"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF6"
FT                   /protein_id="AAM23756.1"
FT                   /translation="MRYVTPLVVFLLVFIFFLDFASIKYLDSTSQKIDSLLSKVEDHIK
FT                   SGDWEKAKDWVEKAESEWKKIDRKWALLVEHREIDEIEINMEKLKSFVESKNRDQSMAQ
FT                   LKTVKMLLKYVPENEKPTFENIF"
FT   gene            complement(488852..489545)
FT                   /locus_tag="TTE0476"
FT   CDS_pept        complement(488852..489526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10173848|dbj|BAB04951.1|
FT                   (AP001511) BH1232; unknown conserved protein in B. subtilis
FT                   [Bacillus halodurans], score 155, E-value 3.00E-37"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23757"
FT                   /db_xref="GOA:Q8RCF5"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF5"
FT                   /protein_id="AAM23757.1"
FT                   /translation="MLILFFRTLILYALVVVFMRISGKQQIGQLQPYELVVAIMIADLV
FT                   AIPMQNKGIPLVAGIIPVLTLLISQLVLSYLSMKSLRARVIICGTPTILIEKGKILTSQ
FT                   LQKERYNINDLLEELRVKGYPNIADVEYAILETNGSLSVIPKSDKRPVTPKDLNITPEY
FT                   EGLPLPIIIDGRIMHQNMQKAGIDLAWLDEQLKIWNIKSVKEVLFASLDSNKVLTVYKK
FT                   EG"
FT   regulatory      complement(488858..488862)
FT                   /locus_tag="TTE0475"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(489541..489545)
FT                   /locus_tag="TTE0476"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            489732..490571
FT                   /gene="Cof"
FT                   /locus_tag="TTE0477"
FT   regulatory      489732..489736
FT                   /gene="Cof"
FT                   /locus_tag="TTE0477"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        489747..490571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Cof"
FT                   /locus_tag="TTE0477"
FT                   /product="predicted hydrolases of the HAD superfamily"
FT                   /note="Best Blastp hit = gi|401595|sp|P09997|YIDA_ECOLI
FT                   HYPOTHETICAL 29.7 KDA PROTEIN IN IBPA-GYRB INTERGENIC
FT                   REGION gi|7429213|pir||QQECGB 'hypothetical 29.7K protein,
FT                   ibpA-gyrB intergenic region - Escherichia coli (strain
FT                   K-12)' gi|2367265|gb|AAC76720.1| '(AE000446) orf,
FT                   hypothetical protein [Escherichia coli K12]', score 143,
FT                   E-value 3.00E-33"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23758"
FT                   /db_xref="GOA:Q8RCF4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF4"
FT                   /protein_id="AAM23758.1"
FT                   /translation="MYKLLVSDADGSLLNSNSAISDRTKEAVREVISRGVIFTIATGRM
FT                   FSSILPYAEELKINAPVISYNGALIKDIYTKKVYYYNPIPSEDALFAIKLLKENGYHIN
FT                   LYIDDELYVEEITDRVEWYLSFNNNVKVNPVGDLMEFLMDTGSVTAKIYALNDLKNPVS
FT                   IDARVYDEISKKLTISSSGGGHLEINAKGVSKGNALKTLANMYNIKREQVVAIGDNLND
FT                   LSMIEYAGLGVAMGNAPDIVKIKASYTTLSNDEDGVAHVIDKFFLNRKTIAV"
FT   gene            490638..490805
FT                   /locus_tag="TTE0479"
FT   regulatory      490638..490642
FT                   /locus_tag="TTE0479"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        490650..490805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23759"
FT                   /db_xref="GOA:Q8RCF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF3"
FT                   /protein_id="AAM23759.1"
FT                   /translation="MEGTVIKLIYLVILFIGALYCLFSFLPLFVELDSIFHQKSLKKFM
FT                   KMNEKN"
FT   gene            490869..491895
FT                   /gene="PurR4"
FT                   /locus_tag="TTE0480"
FT   regulatory      490869..490873
FT                   /gene="PurR4"
FT                   /locus_tag="TTE0480"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        490882..491895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PurR4"
FT                   /locus_tag="TTE0480"
FT                   /product="Transcriptional regulator"
FT                   /note="Best Blastp hit = gi|10175864|dbj|BAB06960.1|
FT                   (AP001518) transcriptional regulator involved in carbon
FT                   catabolite control [Bacillus halodurans], score 324,
FT                   E-value 9.00E-88"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23760"
FT                   /db_xref="GOA:Q8RCF2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF2"
FT                   /protein_id="AAM23760.1"
FT                   /translation="MGATIKDVAREAKVSIATVSRVLNNSAVVTEETRQRVLEAIKKTG
FT                   YKPNALARSLKIQKTHTIGLIIPDISSTFYPEVVRGIEDIAAMYNYNIFLCNTDQKEDK
FT                   EIKYIEILGEKQVDGIIFMGDVVRDSVIQAFNEFKVPVVLAGTQDKEKRYPSVMIDNEK
FT                   AAYDAVKYLISLGHKKIGMIAGSMQDPIAGLQRIEGYKRALEEHGIKYDPELVVEGEFK
FT                   TRKAYLAMLKLLEHKVTAVFAASDDMAAAAINAIFDSNLRVPDDIHVVGFDNTYISTIF
FT                   RPTITTILQPAYDIGAVAMRLLTKLLGKEPIEEMHVILPHQLIVRESTGFKEGSSR"
FT   misc_feature    490882..490965
FT                   /gene="PurR4"
FT                   /locus_tag="TTE0480"
FT                   /note="Pfam match to entry lacI, Bacterial regulatory
FT                   proteins, lacI family, score 47, E-value 7.30E-12"
FT   misc_feature    491059..491862
FT                   /gene="PurR4"
FT                   /locus_tag="TTE0480"
FT                   /note="Pfam match to entry Peripla_BP_like, Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family., score 98.2, E-value 1.60E-25"
FT   gene            491936..492627
FT                   /gene="OmpR"
FT                   /locus_tag="TTE0481"
FT   regulatory      491936..491940
FT                   /gene="OmpR"
FT                   /locus_tag="TTE0481"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        491950..492627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OmpR"
FT                   /locus_tag="TTE0481"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a HTH DNA-binding domain"
FT                   /note="Best Blastp hit = gi|6687469|emb|CAB64972.1|
FT                   (AJ012050) VicR protein [Enterococcus faecalis], score 216,
FT                   E-value 2.00E-55"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23761"
FT                   /db_xref="GOA:Q8RCF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF1"
FT                   /protein_id="AAM23761.1"
FT                   /translation="MERLLIIDDEEMFVKGLKLSLEEEGFEVDAAYDGEEGLEKVRIGN
FT                   YDLVILDIMLPKMDGFSVCREIRTFSNIPIIMLTARGDDVDRIVGIEIGADDYLAKPFN
FT                   TRELIARIRALLRRASNPYVKKKEEIRRGDLYINIPERAVYKRGKKIELTNKEFEILVL
FT                   LASNPGKVYTKDKLLDLIWGVDFYGDANTVTVHVRKLREKLEDDPANPQYIFTKWGAGY
FT                   YMK"
FT   misc_feature    491953..492309
FT                   /gene="OmpR"
FT                   /locus_tag="TTE0481"
FT                   /note="Pfam match to entry response_reg, Response regulator
FT                   receiver domain, score 156.6, E-value 4.40E-43"
FT   misc_feature    492394..492612
FT                   /gene="OmpR"
FT                   /locus_tag="TTE0481"
FT                   /note="Pfam match to entry trans_reg_C, Transcriptional
FT                   regulatory protein, C terminal, score 120.5, E-value
FT                   9.20E-35"
FT   gene            492626..494042
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT   regulatory      492626..492630
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        492636..494042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT                   /product="Sensory transduction histidine kinases"
FT                   /note="Best Blastp hit = gi|10174563|dbj|BAB05664.1|
FT                   (AP001513) two-component sensor histidine kinase [Bacillus
FT                   halodurans], score 186, E-value 4.00E-46"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23762"
FT                   /db_xref="GOA:Q8RCF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCF0"
FT                   /protein_id="AAM23762.1"
FT                   /translation="MSLRWKIFYLYLTIMIISLAVTGLYLYNYIEKSYLDNLKINNSMQ
FT                   ANMVSNFVSRFVGTPSSYLIEPTIVEYAKQINARILFTNIDGRVMVDSAPSKEFEGKSI
FT                   KMYPDIKEALSGKSSTSIHNISGVGWAMYTAVPVISKNNVVGAILISSSIDNVIDLLNS
FT                   IKYRMIYTFSGIGVLVGFLSLLVASFITNPLKRLTEAANILSQGKLDYKVDVKSKDEIG
FT                   KLANAFNKMSYSLMKIDEERKRFVSDASHELKTPLASVKALIESLINSRSQDIAFYKEI
FT                   LHDVNGEIDRMTRLVNDLLELARLDKIKSPRIKRVEVSEVISDVIDSLAPLAESKNVNL
FT                   TFNGKEKVFAEVDPDRFYRMAYNIVENGIKYTHEGGNVLVGLDEDEDNIYLAISDNGIG
FT                   ISEEVLPKIFDRFARGDTARSKKNGGFGLGLAIAKEIIDMHEGKVTVESKVGEGTTFKI
FT                   VLPKRKNKEY"
FT   misc_feature    493137..493346
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT                   /note="Pfam match to entry HAMP, HAMP domain, score 46.8,
FT                   E-value 4.80E-10"
FT   misc_feature    493356..493559
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT                   /note="Pfam match to entry signal, His Kinase A
FT                   (phosphoacceptor) domain, score 68, E-value 2.10E-16"
FT   misc_feature    493689..494027
FT                   /gene="BaeS"
FT                   /locus_tag="TTE0482"
FT                   /note="Pfam match to entry HATPase_c, Histidine kinase-,
FT                   DNA gyrase B-, phytochrome-like ATPase, score 164.1,
FT                   E-value 2.40E-45"
FT   gene            494125..495591
FT                   /locus_tag="TTE0483"
FT   regulatory      494125..494129
FT                   /locus_tag="TTE0483"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        494137..495591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7463333|pir||B70163
FT                   hypothetical protein BB0507 - Lyme disease spirochete
FT                   gi|2688430|gb|AAC66880.1| (AE001153) B. burgdorferi
FT                   predicted coding region BB0507 [Borrelia burgdorferi],
FT                   score 54.7, E-value 3.00E-06"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23763"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE9"
FT                   /protein_id="AAM23763.1"
FT                   /translation="MKKFSLAVFVLLAVILMGGCMGNLNAKDDNPPINPKPLAQEVLEN
FT                   QTKEVSLYFLNDKSNSLTMEKRFIPKDADVLKQVVLELIKGPNEEYSRPIFPAGTRLLS
FT                   IDMQEGTVFVNFSKEFLQEGDDEKIDKLRVAALVNALTDILGVNSVQILVEGNKVEQVG
FT                   KCKIGLEPLKRIMVVGDVYYNPEKIKRLQERADFGKEAWRFDPLQVLRKEGGIIGLGEQ
FT                   DEIALKEEFSGKAVAEVVHDGKVYKVELIQPFGKGSNYIWLIHKVTPLFTPIPDTDPTK
FT                   GETFIYGKVKAIDYEARVITIEREYQDARDLKNEVGPEIKVLPHAIIHFLAKVSYTPDS
FT                   GVKYAEKDISLNRIKVGDELGIILTKDKEARAIIVSDPSLIPYEPNIKVLSPARNEAVS
FT                   SPFKVIGKARVFEGGVNIRLIDNSGNVLNETFVQASNSAPSWGDFEAIVSYKPLKEPRN
FT                   GLLQVFSISPQDGSIQNLVSIPLRLK"
FT   gene            complement(495583..496119)
FT                   /locus_tag="TTE0484"
FT   CDS_pept        complement(495583..496107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|10176679|dbj|BAB07773.1|
FT                   (AP001520) BH4054; unknown conserved protein in B. subtilis
FT                   [Bacillus halodurans], score 125, E-value 3.00E-28"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23764"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE8"
FT                   /protein_id="AAM23764.1"
FT                   /translation="MEELRLRYNEEKASFQIANFLSRHLLPETVFLCIGTDRFITDSLG
FT                   PIVGNLISGSLPPIYYVYGTLKNPVHAINLEENLRYIKKKHPYSKIIAVDASLGEEENI
FT                   GKISIKKSPIHPGKGVGKILPPVGDLSIVGIVDSFHAKDLNSIRLGFIYEIAETIANGI
FT                   LIASYSKSLSF"
FT   regulatory      complement(496115..496119)
FT                   /locus_tag="TTE0484"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            496185..496654
FT                   /locus_tag="TTE0485"
FT   regulatory      496185..496189
FT                   /locus_tag="TTE0485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        496199..496654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23765"
FT                   /db_xref="GOA:Q8RCE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE7"
FT                   /protein_id="AAM23765.1"
FT                   /translation="MKGYKKFLTAISVAVLIAATTIFMFKTSLKEQNTIIPEKTGILSQ
FT                   SEVKFLVPQEDREKEEIELMKKEIREKNKRLKVNEKIAEIEKMLDDGQRERVEEILKKL
FT                   GNDRVEEIIKLVEKGIDGKGNEKILAILRERLTPEEIKYILELVDKY"
FT   regulatory      496656..496677
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            complement(496663..499110)
FT                   /locus_tag="TTE0486"
FT   CDS_pept        complement(496663..499110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|7462418|pir||A72228
FT                   hypothetical protein - Thermotoga maritima (strain MSB8)
FT                   gi|4982226|gb|AAD36719.1|AE001807_10 (AE001807)
FT                   hypothetical protein [Thermotoga maritima], score 77,
FT                   E-value 9.00E-13"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23766"
FT                   /db_xref="GOA:Q8RCE6"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE6"
FT                   /protein_id="AAM23766.1"
FT                   /translation="MCNTTVIYLWYNSPVEENIFNKGGRKLKIFSRKLISILIILLVIA
FT                   FSVENVKAAYTVLESKEQTQIVTKGVTHTNLLYFTPEGFININILKIDLKDPYLDLSVI
FT                   FSPSGIKERMPIREMANSYGAVAAINGDFFDTKTGFVIGATVKDGNLITDPASNGKMAT
FT                   FYIDKTGTPYIDYWTKKMSITLPDGTTVFLAAINKISSTFQYTVMYTRDWYRFSPGANE
FT                   NVPQLVEVVVDQNDTVIEVRQGQPSTEIPEGGYVLAASGDIGNLLLRLSPGDKIQKDIT
FT                   TNPPFEDIKMAVSGGTILVKGGKIYPFTHEIKGYAARTAIGYTKDKRYVLMVTVDGPPY
FT                   RGMTQEELASLMLSLGAYDALNLDGGGSTQMAVRPLGETEAVLYNYSPNSYERKVPNGV
FT                   AVFSTAPKGNLYGLKLEVEDNKVFKGLHRSIKVKGYDENYNPIPVELHEVEFSVTGVEG
FT                   RFEGNYFIPLSTGEGTIVARVGEVTSTIKIAVLENPAVLEFKPSEIVLDKNKKIGIKLF
FT                   GKDVKGYRALIDPIDIEWQIYNNVGTIDNNGTFTSANFDSSGAIVAKVLDKTALLPVKA
FT                   GKGSEFDYSNLVPQTDFTQFDPDNKEVAVNNTSDSFKFMIFGDTKYNTLLKLQISLKAV
FT                   DTANKEYPLAIFVGDINERALANLKTRYIAVGDKYQRYEYGNSTFIVLNNRNGTFVKPD
FT                   PNQWTWFKDQLNNIQGDNLFILLSKPIWGNEGLKDNKEASLFEETLKEFHKKTGKNVWV
FT                   ISNSSKKFYTSLEEGIRYVETYGTNVSGNNNDIYNDFGFVSVMVNGKDIKYQFKRVVNP
FT                   PSN"
FT   gene            499255..499330
FT                   /locus_tag="TTEt08"
FT   tRNA            499255..499330
FT                   /locus_tag="TTEt08"
FT                   /product="tRNA-Pro"
FT   gene            499335..499410
FT                   /locus_tag="TTEt09"
FT   tRNA            499335..499410
FT                   /locus_tag="TTEt09"
FT                   /product="tRNA-Val"
FT   gene            499432..499517
FT                   /locus_tag="TTEt10"
FT   tRNA            499432..499517
FT                   /locus_tag="TTEt10"
FT                   /product="tRNA-Tyr"
FT   gene            499626..500147
FT                   /locus_tag="TTE0487"
FT   CDS_pept        499626..500147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0487"
FT                   /product="Rubrerythrin"
FT                   /note="Best Blastp hit = gi|11280231|pir||T44569
FT                   rubrerythrin [imported] - Pyrococcus furiosus
FT                   gi|6066242|gb|AAF03227.1|AF156097_7 (AF156097) rubrerythrin
FT                   [Pyrococcus furiosus], score 210, E-value 1.00E-53"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23767"
FT                   /db_xref="GOA:Q8RCE5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE5"
FT                   /protein_id="AAM23767.1"
FT                   /translation="MQGGIFMREMTKKNLLDAYAGESQAHMRYQIFADVAEKEGKPNIA
FT                   KLFRAISYAELVHATNHYKTLGEVGDTVKNLEKAIEGETFEVEEMYPAYNAVAELQQES
FT                   GAKKSIHYAIEAEKIHAKLYAEAKEAALKGEDLKISKVYICPVCGYTSVDVLPEKCPIC
FT                   GVPKEKFVAF"
FT   misc_feature    499653..500018
FT                   /locus_tag="TTE0487"
FT                   /note="Pfam match to entry Rubrerythrin, Rubrerythrin,
FT                   score 185.6, E-value 7.90E-52"
FT   misc_feature    500043..500135
FT                   /locus_tag="TTE0487"
FT                   /note="Pfam match to entry rubredoxin, Rubredoxin, score
FT                   27.3, E-value 2.90E-06"
FT   regulatory      500149..500166
FT                   /note="putative rho-independent transcription terminator"
FT                   /regulatory_class="terminator"
FT   gene            500392..501592
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT   regulatory      500392..500396
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        500405..501592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="Best Blastp hit = gi|6166547|sp|P54419|METK_BACSU
FT                   S-ADENOSYLMETHIONINE SYNTHETASE (METHIONINE
FT                   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE)
FT                   gi|7434008|pir||D69657 methionine adenosyltransferase (EC
FT                   2.5.1.6) - Bacillus subtilis gi|2293164|gb|AAC00242.1|
FT                   (AF008220) SAM synthase [Bacillus subtilis]
FT                   gi|2635539|emb|CAB15033.1| (Z99119) S-adenosylmethionine
FT                   synthetase [Bacillus subtilis], score 585, E-value
FT                   1.00E-166"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23768"
FT                   /db_xref="GOA:Q8RCE4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RCE4"
FT                   /protein_id="AAM23768.1"
FT                   /translation="MRRLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAV
FT                   TTGLVLVMGEITTECYVDIPRIARDVIRDIGYTRAKYGFDADTCAVITSIDEQSPDIAM
FT                   GVNKALEARRGELTDAEIEAIGAGDQGLMIGFACDETEELMPMPIMLAHKLARRLAEVR
FT                   KNGTLSYLRPDGKTQVTVEYEEDRPVRVDSVVVSAQHAPEVDHDTIEKDIIEHVVNVII
FT                   PENMMDKNTKIFVNPTGRFVLGGPQADSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKV
FT                   DRSASYAARYVAKNIVAAGLAKKCEVQVAYAIGVATPLEVEINTFGTGKISDEKISEIV
FT                   KKVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDRVDILRKLAGI"
FT   misc_feature    500405..500707
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT                   /note="Pfam match to entry S-AdoMet_synt,
FT                   S-adenosylmethionine synthetase, N-terminal domain, score
FT                   202.8, E-value 4.80E-59"
FT   misc_feature    500771..501127
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT                   /note="Pfam match to entry S-AdoMet_syntD2,
FT                   S-adenosylmethionine synthetase, central domain, score
FT                   270.7, E-value 1.90E-77"
FT   misc_feature    501131..501586
FT                   /gene="MetK"
FT                   /locus_tag="TTE0488"
FT                   /note="Pfam match to entry S-AdoMet_syntD3,
FT                   S-adenosylmethionine synthetase, C-terminal domain, score
FT                   288.5, E-value 8.20E-83"
FT   gene            501695..503992
FT                   /gene="RecD"
FT                   /locus_tag="TTE0489"
FT   CDS_pept        501695..503992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecD"
FT                   /locus_tag="TTE0489"
FT                   /product="ATP-dependent exoDNAse (exonuclease V), alpha
FT                   subunit-helicase superfamily I member"
FT                   /note="Best Blastp hit = gi|6714785|emb|CAB66276.1|
FT                   (AL136519) putative deoxyribonuclease. [Streptomyces
FT                   coelicolor A3(2)], score 546, E-value 1.00E-154"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23769"
FT                   /db_xref="GOA:Q8RCE3"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE3"
FT                   /protein_id="AAM23769.1"
FT                   /translation="MTKIKGLNPLYPPLNRLKLSCKISLTGGKAMVEIEGVVEEIIFRN
FT                   EQNGYTVLELDIEGDMVTAVGVMPFVTVGERIKVQGEWVVHPDYGDQIRVINYQTLSPN
FT                   TLEGIERFLASGLIPGIGPVTARKIVERFGLDSLHVIETEPHRLREIKGLSDEKIKRIS
FT                   EAYEMQKGIKEVMVFLHQFGISSHMAIKIYKEYGNNAIEIIKQNPYRLADDIFGIGFKT
FT                   ADKIAESLGIDPHSTYRISAGARYVLMQYAANGHTYVPKELLKKETAQLLEVSEEEVED
FT                   AFVLLAQNEKIHIERFEDETVGVYYIPYYVAELHTAERLFTMTVTQCEDLKIDVQKEIR
FT                   DFEKEAGIVLEKTQKLAVEEAIKNSVVVITGGPGTGKTTIINCIIRIFEKANKKVALAA
FT                   PTGRAAKRITEATGKEAKTIHRLLEYTYTEEEGKGFNKNEKDPLKYDVIIIDEASMVDI
FT                   LLMNALLKAIPAGSRLILVGDADQLPSVGAGNVLRDIIDSGIVKVIRLKEIFRQQKESL
FT                   IVVNAHKINNGEYPTYNDKNGDFFFLSVATQEDMLKTILDLVTNRLPKAYGFHPVNDIQ
FT                   VLTPMKKGIIGVHNLNIELQKVLNPPSKDKAEKPMKEFTFRVGDKVMQIKNNYRMTWKR
FT                   GHEEGEGVFNGDIGIIQSIDEELQEVTVYFDDEKVVTYDFSDLDELTLSYAITVHKSQG
FT                   SEFPVVIMPVTYGPPMLLTRNLLYTAVTRAKKLVVLVGQEKYLKFMIDNNRISKRYSGL
FT                   LSRLKKTLIYIQ"
FT   misc_feature    502793..503890
FT                   /gene="RecD"
FT                   /locus_tag="TTE0489"
FT                   /note="Pfam match to entry Viral_helicase1, Viral
FT                   (Superfamily 1) RNA helicase, score 33, E-value 7.00E-09"
FT   gene            504055..504756
FT                   /gene="ComFC"
FT                   /locus_tag="TTE0490"
FT   regulatory      504055..504059
FT                   /gene="ComFC"
FT                   /locus_tag="TTE0490"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504070..504756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ComFC"
FT                   /locus_tag="TTE0490"
FT                   /product="predicted amidophosphoribosyltransferases"
FT                   /note="Best Blastp hit = gi|13472985|ref|NP_104552.1|
FT                   'hypothetical protein, similar to competence protein F
FT                   [Mesorhizobium loti]' gi|14023733|dbj|BAB50338.1|
FT                   (AP003002) hypothetical protein [Mesorhizobium loti], score
FT                   131, E-value 7.00E-30"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23770"
FT                   /db_xref="GOA:Q8RCE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE2"
FT                   /protein_id="AAM23770.1"
FT                   /translation="MTFLDLLFPPKTSCIVCNASIKSGYLCDRCKASLEIINGKRCRIC
FT                   GKPLKEGEICSDCLKTPHYFKQNVSPFEYEGVVKELIGKFKYFNERHLASFFADYMADA
FT                   VKNMGWNIEVIVPVPLHRIRLDERGYNQSELLARELSYRLNIFMSKALRRVKNTTTQTA
FT                   LHREERMENVKGAFKVTYKDTIEGKNVLLVDDVLTTGATLDECAKALKENGAKEVYVVT
FT                   IATGRM"
FT   gene            504777..505199
FT                   /locus_tag="TTE0491"
FT   CDS_pept        504777..505199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0491"
FT                   /product="flagellar protein"
FT                   /note="Best Blastp hit = gi|10176248|dbj|BAB07343.1|
FT                   (AP001519) flagellar protein [Bacillus halodurans], score
FT                   70.1, E-value 1.00E-11"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23771"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE1"
FT                   /protein_id="AAM23771.1"
FT                   /translation="MKIMEIRNCKRCGRPYIYTGKDLCPVCYQQDEEDFLKVRDYLDLH
FT                   PNATMLEISQNTQVSAKKIMDFLKEGRLILSPSNVNIGLKCERCGKPILSGRFCDECKL
FT                   ELAKELTKGYESKTTKDEDETKGERLYVYDTKKKKK"
FT   gene            505247..505535
FT                   /gene="FlgM"
FT                   /locus_tag="TTE0492"
FT   regulatory      505247..505251
FT                   /gene="FlgM"
FT                   /locus_tag="TTE0492"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        505260..505535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FlgM"
FT                   /locus_tag="TTE0492"
FT                   /product="Negative regulator of flagellin synthesis
FT                   (anti-sigma-28 factor)"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23772"
FT                   /db_xref="GOA:Q8RCE0"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCE0"
FT                   /protein_id="AAM23772.1"
FT                   /translation="MKIYNNNIDKIMSIYRVNSIEKVKPNKSEIKDKVEISEEALKLAK
FT                   NLSQFEKIKNQKIEDIKSRLSSGTYNVKAEDVADAIIKGVLLNKKI"
FT   gene            505508..506032
FT                   /locus_tag="TTE0493"
FT   regulatory      505508..505512
FT                   /locus_tag="TTE0493"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        505556..506032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TTE0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="Best Blastp hit = gi|732323|sp|P39808|YVYG_BACSU
FT                   HYPOTHETICAL 18.2 KD PROTEIN IN FLGM-FLGK INTERGENIC REGION
FT                   gi|7474842|pir||C70049 flagellar protein homolog yvyG -
FT                   Bacillus subtilis gi|451870|gb|AAB59018.1| (L14437) ORF160
FT                   [Bacillus subtilis] gi|1762337|gb|AAC44945.1| (U56901)
FT                   flagellar protein [Bacillus subtilis]
FT                   gi|2636068|emb|CAB15559.1| (Z99122) alternate gene name:
FT                   yviC; similar to flagellar protein [Bacillus subtilis],
FT                   score 60.5, E-value 1.00E-08"
FT                   /db_xref="EnsemblGenomes-Gn:TTE0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAM23773"
FT                   /db_xref="GOA:Q8RCD9"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RCD9"
FT                   /protein_id="AAM23773.1"
FT                   /translation="MNASERLLGLLKEEMAIYEILLELATKKTDIIIHGKIKELDETVQ
FT                   MERNFIKKLVELEEKRENTLKEMGKGEGVTISEVIKTLPLE