(data stored in ACNUC7421 zone)

EMBL: AE008923

ID   AE008923; SV 1; circular; genomic DNA; STD; PRO; 5175554 BP.
XX
AC   AE008923; AE011623-AE012091;
XX
PR   Project:PRJNA297;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Xanthomonas axonopodis pv. citri str. 306, complete genome.
XX
KW   .
XX
OS   Xanthomonas citri pv. citri str. 306
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
XX
RN   [1]
RP   1-5175554
RX   DOI; 10.1038/417459a.
RX   PUBMED; 12024217.
RA   da Silva A.C.R., Ferro J.A., Reinach F.C., Farah C.S., Furlan L.R.,
RA   Quaggio R.B., Monteiro-Vitorello C.B., Van Sluys M.A., Almeida N.F.Jr.,
RA   Alves L.M.C., do Amaral A.M., Bertolini M.C., Camargo L.E.A., Camarotte G.,
RA   Cannavan F., Cardozo J., Chambergo F., Ciapina L.P., Cicarelli R.M.B.,
RA   Coutinho L.L., Cursino-Santos J.R., El-Dorry H., Faria J.B.,
RA   Ferreira A.J.S., Ferreira R.C.C., Ferro M.I.T., Formighieri E.F.,
RA   Franco M.C., Greggio C.C., Gruber A., Katsuyama A.M., Kishi L.T.,
RA   Leite R.P.Jr., Lemos E.G.M., Lemos M.V.F., Locali E.C., Machado M.A.,
RA   Madeira A.M.B.N., Martinez-Rossi N.M., Martins E.C., Meidanis J.,
RA   Menck C.F.M., Miyaki C.Y., Moon D.H., Moreira L.M., Novo M.T.M.,
RA   Okura V.K., Oliveira M.C., Oliveira V.R., Pereira H.A.Jr., Rossi A.,
RA   Sena J.A.D., Silva C., de Souza R.F., Spinola L.A.F., Takita M.A.,
RA   Tamura R.E., Teixeira E.C., Tezza R.I.D., Trindade dos Santos M.,
RA   Truffi D., Tsai S.M., White F.F., Setubal J.C., Kitajima J.P.;
RT   "Comparison of the genomes of two Xanthomonas pathogens with differing host
RT   specificities";
RL   Nature 417(6887):459-463(2002).
XX
RN   [2]
RP   1-5175554
RA   da Silva A.C.R., Ferro J.A., Reinach F.C., Farah C.S., Furlan L.R.,
RA   Quaggio R.B., Monteiro-Vitorello C.B., Van Sluys M.A., Almeida N.F.Jr.,
RA   Alves L.M.C., do Amaral A.M., Bertolini M.C., Camargo L.E.A., Camarotte G.,
RA   Cannavan F., Cardozo J., Chambergo F., Ciapina L.P., Cicarelli R.M.B.,
RA   Coutinho L.L., Cursino-Santos J.R., El-Dorry H., Faria J.B.,
RA   Ferreira A.J.S., Ferreira R.C.C., Ferro M.I.T., Formighieri E.F.,
RA   Franco M.C., Greggio C.C., Gruber A., Katsuyama A.M., Kishi L.T.,
RA   Leite R.P.Jr., Lemos E.G.M., Lemos M.V.F., Locali E.C., Machado M.A.,
RA   Madeira A.M.B.N., Martinez-Rossi N.M., Martins E.C., Meidanis J.,
RA   Menck C.F.M., Miyaki C.Y., Moon D.H., Moreira L.M., Novo M.T.M.,
RA   Okura V.K., Oliveira M.C., Oliveira V.R., Pereira H.A.Jr., Rossi A.,
RA   Sena J.A.D., Silva C., de Souza R.F., Spinola L.A.F., Takita M.A.,
RA   Tamura R.E., Teixeira E.C., Tezza R.I.D., Trindade dos Santos M.,
RA   Truffi D., Tsai S.M., White F.F., Setubal J.C., Kitajima J.P.;
RT   ;
RL   Submitted (28-NOV-2001) to the INSDC.
RL   Departmento de Bioquimica, Universidade de Sao Paulo, Av. Prof. Lineu
RL   Prestes 748, Sao Paulo, SP 05508-900, Brazil
XX
DR   MD5; d7242028b277a8742683cd87b4d67467.
DR   BioSample; SAMN02603846.
DR   EnsemblGenomes-Gn; EBG00001235368.
DR   EnsemblGenomes-Gn; EBG00001235369.
DR   EnsemblGenomes-Gn; EBG00001235370.
DR   EnsemblGenomes-Gn; EBG00001235371.
DR   EnsemblGenomes-Gn; EBG00001235372.
DR   EnsemblGenomes-Gn; EBG00001235373.
DR   EnsemblGenomes-Gn; EBG00001235374.
DR   EnsemblGenomes-Gn; EBG00001235375.
DR   EnsemblGenomes-Gn; EBG00001235376.
DR   EnsemblGenomes-Gn; EBG00001235377.
DR   EnsemblGenomes-Gn; EBG00001235378.
DR   EnsemblGenomes-Gn; EBG00001235379.
DR   EnsemblGenomes-Gn; EBG00001235380.
DR   EnsemblGenomes-Gn; EBG00001235381.
DR   EnsemblGenomes-Gn; EBG00001235382.
DR   EnsemblGenomes-Gn; EBG00001235383.
DR   EnsemblGenomes-Gn; EBG00001235384.
DR   EnsemblGenomes-Gn; EBG00001235385.
DR   EnsemblGenomes-Gn; EBG00001235386.
DR   EnsemblGenomes-Gn; EBG00001235387.
DR   EnsemblGenomes-Gn; EBG00001235388.
DR   EnsemblGenomes-Gn; EBG00001235389.
DR   EnsemblGenomes-Gn; EBG00001235390.
DR   EnsemblGenomes-Gn; EBG00001235391.
DR   EnsemblGenomes-Gn; EBG00001235392.
DR   EnsemblGenomes-Gn; EBG00001235393.
DR   EnsemblGenomes-Gn; EBG00001235394.
DR   EnsemblGenomes-Gn; EBG00001235395.
DR   EnsemblGenomes-Gn; EBG00001235396.
DR   EnsemblGenomes-Gn; EBG00001235397.
DR   EnsemblGenomes-Gn; EBG00001235398.
DR   EnsemblGenomes-Gn; EBG00001235399.
DR   EnsemblGenomes-Gn; EBG00001235400.
DR   EnsemblGenomes-Gn; EBG00001235401.
DR   EnsemblGenomes-Gn; EBG00001235402.
DR   EnsemblGenomes-Gn; EBG00001235403.
DR   EnsemblGenomes-Gn; EBG00001235404.
DR   EnsemblGenomes-Gn; EBG00001235405.
DR   EnsemblGenomes-Gn; EBG00001235406.
DR   EnsemblGenomes-Gn; EBG00001235407.
DR   EnsemblGenomes-Gn; EBG00001235408.
DR   EnsemblGenomes-Gn; EBG00001235409.
DR   EnsemblGenomes-Gn; EBG00001235410.
DR   EnsemblGenomes-Gn; EBG00001235411.
DR   EnsemblGenomes-Gn; EBG00001235412.
DR   EnsemblGenomes-Gn; EBG00001235413.
DR   EnsemblGenomes-Gn; EBG00001235414.
DR   EnsemblGenomes-Gn; EBG00001235415.
DR   EnsemblGenomes-Gn; EBG00001235416.
DR   EnsemblGenomes-Gn; EBG00001235417.
DR   EnsemblGenomes-Gn; EBG00001235418.
DR   EnsemblGenomes-Gn; EBG00001235419.
DR   EnsemblGenomes-Gn; EBG00001235420.
DR   EnsemblGenomes-Gn; EBG00001235421.
DR   EnsemblGenomes-Gn; EBG00001235422.
DR   EnsemblGenomes-Gn; EBG00001235423.
DR   EnsemblGenomes-Gn; EBG00001235424.
DR   EnsemblGenomes-Gn; EBG00001235425.
DR   EnsemblGenomes-Gn; EBG00001235426.
DR   EnsemblGenomes-Gn; EBG00001235427.
DR   EnsemblGenomes-Gn; EBG00001235428.
DR   EnsemblGenomes-Gn; EBG00001235429.
DR   EnsemblGenomes-Gn; EBG00001235430.
DR   EnsemblGenomes-Gn; EBG00001235431.
DR   EnsemblGenomes-Gn; EBG00001235432.
DR   EnsemblGenomes-Gn; EBG00001235433.
DR   EnsemblGenomes-Gn; EBG00001235434.
DR   EnsemblGenomes-Gn; EBG00001235435.
DR   EnsemblGenomes-Gn; EBG00001235436.
DR   EnsemblGenomes-Gn; EBG00001235437.
DR   EnsemblGenomes-Gn; EBG00001235438.
DR   EnsemblGenomes-Gn; EBG00001235439.
DR   EnsemblGenomes-Gn; EBG00001235440.
DR   EnsemblGenomes-Gn; EBG00001235441.
DR   EnsemblGenomes-Gn; EBG00001235442.
DR   EnsemblGenomes-Gn; EBG00001235443.
DR   EnsemblGenomes-Gn; EBG00001235444.
DR   EnsemblGenomes-Gn; EBG00001235445.
DR   EnsemblGenomes-Gn; EBG00001235446.
DR   EnsemblGenomes-Gn; EBG00001235447.
DR   EnsemblGenomes-Gn; EBG00001235448.
DR   EnsemblGenomes-Gn; EBG00001235449.
DR   EnsemblGenomes-Gn; EBG00001235450.
DR   EnsemblGenomes-Gn; EBG00001235451.
DR   EnsemblGenomes-Gn; EBG00001235452.
DR   EnsemblGenomes-Gn; EBG00001235453.
DR   EnsemblGenomes-Gn; EBG00001235454.
DR   EnsemblGenomes-Gn; EBG00001235455.
DR   EnsemblGenomes-Gn; EBG00001235456.
DR   EnsemblGenomes-Gn; EBG00001235457.
DR   EnsemblGenomes-Gn; EBG00001235458.
DR   EnsemblGenomes-Gn; EBG00001235459.
DR   EnsemblGenomes-Gn; EBG00001235460.
DR   EnsemblGenomes-Gn; EBG00001235461.
DR   EnsemblGenomes-Gn; EBG00001235462.
DR   EnsemblGenomes-Gn; EBG00001235463.
DR   EnsemblGenomes-Gn; EBG00001235464.
DR   EnsemblGenomes-Gn; EBG00001235465.
DR   EnsemblGenomes-Gn; EBG00001235466.
DR   EnsemblGenomes-Gn; EBG00001235467.
DR   EnsemblGenomes-Gn; EBG00001235468.
DR   EnsemblGenomes-Gn; EBG00001235469.
DR   EnsemblGenomes-Gn; EBG00001235470.
DR   EnsemblGenomes-Gn; EBG00001235471.
DR   EnsemblGenomes-Gn; EBG00001235472.
DR   EnsemblGenomes-Gn; EBG00001235473.
DR   EnsemblGenomes-Gn; EBG00001235474.
DR   EnsemblGenomes-Gn; EBG00001235475.
DR   EnsemblGenomes-Gn; EBG00001235476.
DR   EnsemblGenomes-Gn; EBG00001235477.
DR   EnsemblGenomes-Gn; EBG00001235478.
DR   EnsemblGenomes-Gn; EBG00001235479.
DR   EnsemblGenomes-Gn; EBG00001235480.
DR   EnsemblGenomes-Gn; EBG00001235481.
DR   EnsemblGenomes-Gn; EBG00001235482.
DR   EnsemblGenomes-Gn; EBG00001235483.
DR   EnsemblGenomes-Gn; EBG00001235484.
DR   EnsemblGenomes-Gn; EBG00001235485.
DR   EnsemblGenomes-Gn; EBG00001235486.
DR   EnsemblGenomes-Gn; EBG00001235487.
DR   EnsemblGenomes-Gn; EBG00001235488.
DR   EnsemblGenomes-Gn; EBG00001235489.
DR   EnsemblGenomes-Gn; EBG00001235490.
DR   EnsemblGenomes-Gn; EBG00001235491.
DR   EnsemblGenomes-Gn; EBG00001235492.
DR   EnsemblGenomes-Gn; EBG00001235493.
DR   EnsemblGenomes-Gn; EBG00001235494.
DR   EnsemblGenomes-Gn; XAC0391.
DR   EnsemblGenomes-Gn; XAC0489.
DR   EnsemblGenomes-Gn; XAC0490.
DR   EnsemblGenomes-Gn; XAC0767.
DR   EnsemblGenomes-Gn; XAC0949.
DR   EnsemblGenomes-Gn; XAC0954.
DR   EnsemblGenomes-Gn; XAC0955.
DR   EnsemblGenomes-Gn; XAC0956.
DR   EnsemblGenomes-Gn; XAC0958.
DR   EnsemblGenomes-Gn; XAC1048.
DR   EnsemblGenomes-Gn; XAC1049.
DR   EnsemblGenomes-Gn; XAC1050.
DR   EnsemblGenomes-Gn; XAC1073.
DR   EnsemblGenomes-Gn; XAC1076.
DR   EnsemblGenomes-Gn; XAC1082.
DR   EnsemblGenomes-Gn; XAC1083.
DR   EnsemblGenomes-Gn; XAC1084.
DR   EnsemblGenomes-Gn; XAC1092.
DR   EnsemblGenomes-Gn; XAC1108.
DR   EnsemblGenomes-Gn; XAC1134.
DR   EnsemblGenomes-Gn; XAC1257.
DR   EnsemblGenomes-Gn; XAC1447.
DR   EnsemblGenomes-Gn; XAC1511.
DR   EnsemblGenomes-Gn; XAC1565.
DR   EnsemblGenomes-Gn; XAC1656.
DR   EnsemblGenomes-Gn; XAC1744.
DR   EnsemblGenomes-Gn; XAC1750.
DR   EnsemblGenomes-Gn; XAC1751.
DR   EnsemblGenomes-Gn; XAC1782.
DR   EnsemblGenomes-Gn; XAC1809.
DR   EnsemblGenomes-Gn; XAC2056.
DR   EnsemblGenomes-Gn; XAC2058.
DR   EnsemblGenomes-Gn; XAC2059.
DR   EnsemblGenomes-Gn; XAC2060.
DR   EnsemblGenomes-Gn; XAC2061.
DR   EnsemblGenomes-Gn; XAC2094.
DR   EnsemblGenomes-Gn; XAC2095.
DR   EnsemblGenomes-Gn; XAC2096.
DR   EnsemblGenomes-Gn; XAC2104.
DR   EnsemblGenomes-Gn; XAC2339.
DR   EnsemblGenomes-Gn; XAC2417.
DR   EnsemblGenomes-Gn; XAC2560.
DR   EnsemblGenomes-Gn; XAC2586.
DR   EnsemblGenomes-Gn; XAC2624.
DR   EnsemblGenomes-Gn; XAC2627.
DR   EnsemblGenomes-Gn; XAC2690.
DR   EnsemblGenomes-Gn; XAC2705.
DR   EnsemblGenomes-Gn; XAC3138.
DR   EnsemblGenomes-Gn; XAC3299.
DR   EnsemblGenomes-Gn; XAC3786.
DR   EnsemblGenomes-Gn; XAC3892.
DR   EnsemblGenomes-Gn; XAC3893.
DR   EnsemblGenomes-Gn; XAC3894.
DR   EnsemblGenomes-Gn; XAC3895.
DR   EnsemblGenomes-Gn; XAC3896.
DR   EnsemblGenomes-Gn; XAC3963.
DR   EnsemblGenomes-Gn; XAC4015.
DR   EnsemblGenomes-Gn; XAC4287.
DR   EnsemblGenomes-Gn; XAC4288.
DR   EnsemblGenomes-Gn; XAC4289.
DR   EnsemblGenomes-Gn; XAC4290.
DR   EnsemblGenomes-Gn; XAC4291.
DR   EnsemblGenomes-Tr; EBT00001580949.
DR   EnsemblGenomes-Tr; EBT00001580950.
DR   EnsemblGenomes-Tr; EBT00001580951.
DR   EnsemblGenomes-Tr; EBT00001580952.
DR   EnsemblGenomes-Tr; EBT00001580953.
DR   EnsemblGenomes-Tr; EBT00001580954.
DR   EnsemblGenomes-Tr; EBT00001580955.
DR   EnsemblGenomes-Tr; EBT00001580956.
DR   EnsemblGenomes-Tr; EBT00001580957.
DR   EnsemblGenomes-Tr; EBT00001580958.
DR   EnsemblGenomes-Tr; EBT00001580959.
DR   EnsemblGenomes-Tr; EBT00001580960.
DR   EnsemblGenomes-Tr; EBT00001580961.
DR   EnsemblGenomes-Tr; EBT00001580962.
DR   EnsemblGenomes-Tr; EBT00001580963.
DR   EnsemblGenomes-Tr; EBT00001580964.
DR   EnsemblGenomes-Tr; EBT00001580965.
DR   EnsemblGenomes-Tr; EBT00001580966.
DR   EnsemblGenomes-Tr; EBT00001580967.
DR   EnsemblGenomes-Tr; EBT00001580968.
DR   EnsemblGenomes-Tr; EBT00001580969.
DR   EnsemblGenomes-Tr; EBT00001580970.
DR   EnsemblGenomes-Tr; EBT00001580971.
DR   EnsemblGenomes-Tr; EBT00001580972.
DR   EnsemblGenomes-Tr; EBT00001580973.
DR   EnsemblGenomes-Tr; EBT00001580974.
DR   EnsemblGenomes-Tr; EBT00001580975.
DR   EnsemblGenomes-Tr; EBT00001580976.
DR   EnsemblGenomes-Tr; EBT00001580977.
DR   EnsemblGenomes-Tr; EBT00001580978.
DR   EnsemblGenomes-Tr; EBT00001580979.
DR   EnsemblGenomes-Tr; EBT00001580980.
DR   EnsemblGenomes-Tr; EBT00001580981.
DR   EnsemblGenomes-Tr; EBT00001580982.
DR   EnsemblGenomes-Tr; EBT00001580983.
DR   EnsemblGenomes-Tr; EBT00001580984.
DR   EnsemblGenomes-Tr; EBT00001580985.
DR   EnsemblGenomes-Tr; EBT00001580986.
DR   EnsemblGenomes-Tr; EBT00001580987.
DR   EnsemblGenomes-Tr; EBT00001580988.
DR   EnsemblGenomes-Tr; EBT00001580989.
DR   EnsemblGenomes-Tr; EBT00001580990.
DR   EnsemblGenomes-Tr; EBT00001580991.
DR   EnsemblGenomes-Tr; EBT00001580992.
DR   EnsemblGenomes-Tr; EBT00001580993.
DR   EnsemblGenomes-Tr; EBT00001580994.
DR   EnsemblGenomes-Tr; EBT00001580995.
DR   EnsemblGenomes-Tr; EBT00001580996.
DR   EnsemblGenomes-Tr; EBT00001580997.
DR   EnsemblGenomes-Tr; EBT00001580998.
DR   EnsemblGenomes-Tr; EBT00001580999.
DR   EnsemblGenomes-Tr; EBT00001581000.
DR   EnsemblGenomes-Tr; EBT00001581001.
DR   EnsemblGenomes-Tr; EBT00001581002.
DR   EnsemblGenomes-Tr; EBT00001581003.
DR   EnsemblGenomes-Tr; EBT00001581004.
DR   EnsemblGenomes-Tr; EBT00001581005.
DR   EnsemblGenomes-Tr; EBT00001581006.
DR   EnsemblGenomes-Tr; EBT00001581007.
DR   EnsemblGenomes-Tr; EBT00001581008.
DR   EnsemblGenomes-Tr; EBT00001581009.
DR   EnsemblGenomes-Tr; EBT00001581010.
DR   EnsemblGenomes-Tr; EBT00001581011.
DR   EnsemblGenomes-Tr; EBT00001581012.
DR   EnsemblGenomes-Tr; EBT00001581013.
DR   EnsemblGenomes-Tr; EBT00001581014.
DR   EnsemblGenomes-Tr; EBT00001581015.
DR   EnsemblGenomes-Tr; EBT00001581016.
DR   EnsemblGenomes-Tr; EBT00001581017.
DR   EnsemblGenomes-Tr; EBT00001581018.
DR   EnsemblGenomes-Tr; EBT00001581019.
DR   EnsemblGenomes-Tr; EBT00001581020.
DR   EnsemblGenomes-Tr; EBT00001581021.
DR   EnsemblGenomes-Tr; EBT00001581022.
DR   EnsemblGenomes-Tr; EBT00001581023.
DR   EnsemblGenomes-Tr; EBT00001581024.
DR   EnsemblGenomes-Tr; EBT00001581025.
DR   EnsemblGenomes-Tr; EBT00001581026.
DR   EnsemblGenomes-Tr; EBT00001581027.
DR   EnsemblGenomes-Tr; EBT00001581028.
DR   EnsemblGenomes-Tr; EBT00001581029.
DR   EnsemblGenomes-Tr; EBT00001581030.
DR   EnsemblGenomes-Tr; EBT00001581031.
DR   EnsemblGenomes-Tr; EBT00001581032.
DR   EnsemblGenomes-Tr; EBT00001581033.
DR   EnsemblGenomes-Tr; EBT00001581034.
DR   EnsemblGenomes-Tr; EBT00001581035.
DR   EnsemblGenomes-Tr; EBT00001581036.
DR   EnsemblGenomes-Tr; EBT00001581037.
DR   EnsemblGenomes-Tr; EBT00001581038.
DR   EnsemblGenomes-Tr; EBT00001581039.
DR   EnsemblGenomes-Tr; EBT00001581040.
DR   EnsemblGenomes-Tr; EBT00001581041.
DR   EnsemblGenomes-Tr; EBT00001581042.
DR   EnsemblGenomes-Tr; EBT00001581043.
DR   EnsemblGenomes-Tr; EBT00001581044.
DR   EnsemblGenomes-Tr; EBT00001581045.
DR   EnsemblGenomes-Tr; EBT00001581046.
DR   EnsemblGenomes-Tr; EBT00001581047.
DR   EnsemblGenomes-Tr; EBT00001581048.
DR   EnsemblGenomes-Tr; EBT00001581049.
DR   EnsemblGenomes-Tr; EBT00001581050.
DR   EnsemblGenomes-Tr; EBT00001581051.
DR   EnsemblGenomes-Tr; EBT00001581052.
DR   EnsemblGenomes-Tr; EBT00001581053.
DR   EnsemblGenomes-Tr; EBT00001581054.
DR   EnsemblGenomes-Tr; EBT00001581055.
DR   EnsemblGenomes-Tr; EBT00001581056.
DR   EnsemblGenomes-Tr; EBT00001581057.
DR   EnsemblGenomes-Tr; EBT00001581058.
DR   EnsemblGenomes-Tr; EBT00001581059.
DR   EnsemblGenomes-Tr; EBT00001581060.
DR   EnsemblGenomes-Tr; EBT00001581061.
DR   EnsemblGenomes-Tr; EBT00001581062.
DR   EnsemblGenomes-Tr; EBT00001581063.
DR   EnsemblGenomes-Tr; EBT00001581064.
DR   EnsemblGenomes-Tr; EBT00001581065.
DR   EnsemblGenomes-Tr; EBT00001581066.
DR   EnsemblGenomes-Tr; EBT00001581067.
DR   EnsemblGenomes-Tr; EBT00001581068.
DR   EnsemblGenomes-Tr; EBT00001581069.
DR   EnsemblGenomes-Tr; EBT00001581070.
DR   EnsemblGenomes-Tr; EBT00001581071.
DR   EnsemblGenomes-Tr; EBT00001581072.
DR   EnsemblGenomes-Tr; EBT00001581073.
DR   EnsemblGenomes-Tr; EBT00001581074.
DR   EnsemblGenomes-Tr; EBT00001581075.
DR   EnsemblGenomes-Tr; XAC0391-1.
DR   EnsemblGenomes-Tr; XAC0489-1.
DR   EnsemblGenomes-Tr; XAC0490-1.
DR   EnsemblGenomes-Tr; XAC0767-1.
DR   EnsemblGenomes-Tr; XAC0949-1.
DR   EnsemblGenomes-Tr; XAC0954-1.
DR   EnsemblGenomes-Tr; XAC0955-1.
DR   EnsemblGenomes-Tr; XAC0956-1.
DR   EnsemblGenomes-Tr; XAC0958-1.
DR   EnsemblGenomes-Tr; XAC1048-1.
DR   EnsemblGenomes-Tr; XAC1049-1.
DR   EnsemblGenomes-Tr; XAC1050-1.
DR   EnsemblGenomes-Tr; XAC1073-1.
DR   EnsemblGenomes-Tr; XAC1076-1.
DR   EnsemblGenomes-Tr; XAC1082-1.
DR   EnsemblGenomes-Tr; XAC1083-1.
DR   EnsemblGenomes-Tr; XAC1084-1.
DR   EnsemblGenomes-Tr; XAC1092-1.
DR   EnsemblGenomes-Tr; XAC1108-1.
DR   EnsemblGenomes-Tr; XAC1134-1.
DR   EnsemblGenomes-Tr; XAC1257-1.
DR   EnsemblGenomes-Tr; XAC1447-1.
DR   EnsemblGenomes-Tr; XAC1511-1.
DR   EnsemblGenomes-Tr; XAC1565-1.
DR   EnsemblGenomes-Tr; XAC1656-1.
DR   EnsemblGenomes-Tr; XAC1744-1.
DR   EnsemblGenomes-Tr; XAC1750-1.
DR   EnsemblGenomes-Tr; XAC1751-1.
DR   EnsemblGenomes-Tr; XAC1782-1.
DR   EnsemblGenomes-Tr; XAC1809-1.
DR   EnsemblGenomes-Tr; XAC2056-1.
DR   EnsemblGenomes-Tr; XAC2058-1.
DR   EnsemblGenomes-Tr; XAC2059-1.
DR   EnsemblGenomes-Tr; XAC2060-1.
DR   EnsemblGenomes-Tr; XAC2061-1.
DR   EnsemblGenomes-Tr; XAC2094-1.
DR   EnsemblGenomes-Tr; XAC2095-1.
DR   EnsemblGenomes-Tr; XAC2096-1.
DR   EnsemblGenomes-Tr; XAC2104-1.
DR   EnsemblGenomes-Tr; XAC2339-1.
DR   EnsemblGenomes-Tr; XAC2417-1.
DR   EnsemblGenomes-Tr; XAC2560-1.
DR   EnsemblGenomes-Tr; XAC2586-1.
DR   EnsemblGenomes-Tr; XAC2624-1.
DR   EnsemblGenomes-Tr; XAC2627-1.
DR   EnsemblGenomes-Tr; XAC2690-1.
DR   EnsemblGenomes-Tr; XAC2705-1.
DR   EnsemblGenomes-Tr; XAC3138-1.
DR   EnsemblGenomes-Tr; XAC3299-1.
DR   EnsemblGenomes-Tr; XAC3786-1.
DR   EnsemblGenomes-Tr; XAC3892-1.
DR   EnsemblGenomes-Tr; XAC3893-1.
DR   EnsemblGenomes-Tr; XAC3894-1.
DR   EnsemblGenomes-Tr; XAC3895-1.
DR   EnsemblGenomes-Tr; XAC3896-1.
DR   EnsemblGenomes-Tr; XAC3963-1.
DR   EnsemblGenomes-Tr; XAC4015-1.
DR   EnsemblGenomes-Tr; XAC4287-1.
DR   EnsemblGenomes-Tr; XAC4288-1.
DR   EnsemblGenomes-Tr; XAC4289-1.
DR   EnsemblGenomes-Tr; XAC4290-1.
DR   EnsemblGenomes-Tr; XAC4291-1.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC154065; 12730176.
DR   EuropePMC; PMC1563621; 16957248.
DR   EuropePMC; PMC180996; 12923078.
DR   EuropePMC; PMC2238763; 18053269.
DR   EuropePMC; PMC2246292; 17927820.
DR   EuropePMC; PMC3130047; 21750733.
DR   EuropePMC; PMC3131649; 21515727.
DR   EuropePMC; PMC3364877; 22404966.
DR   EuropePMC; PMC3366940; 22675525.
DR   EuropePMC; PMC344409; 14973021.
DR   EuropePMC; PMC3591321; 23505513.
DR   EuropePMC; PMC3838355; 24278159.
DR   EuropePMC; PMC3849588; 24069909.
DR   EuropePMC; PMC3911001; 24123743.
DR   EuropePMC; PMC4045669; 24897119.
DR   EuropePMC; PMC4076744; 25071734.
DR   EuropePMC; PMC4178650; 25085494.
DR   EuropePMC; PMC4692102; 26695179.
DR   EuropePMC; PMC4907191; 27107122.
DR   EuropePMC; PMC4960238; 27507963.
DR   EuropePMC; PMC548351; 15673718.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02222; sX2.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02224; sX5.
DR   RFAM; RF02225; sX6.
DR   RFAM; RF02226; sX7.
DR   RFAM; RF02228; sX9.
DR   RFAM; RF02230; sX11.
DR   RFAM; RF02231; sX12.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02233; sX14.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02236; asX2.
DR   RFAM; RF02237; asX3.
DR   RFAM; RF02238; asX4.
DR   RFAM; RF02240; Xoo1.
DR   RFAM; RF02241; Xoo2.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AE008923.
DR   SILVA-SSU; AE008923.
XX
CC   On or before Feb 26, 2009 this sequence version replaced
CC   gi:21106038, gi:21106046, gi:21106059, gi:21106069, gi:21106075,
CC   gi:21106087, gi:21106097, gi:21106112, gi:21106120, gi:21106130,
CC   gi:21106145, gi:21106156, gi:21106168, gi:21106177, gi:21106188,
CC   gi:21106197, gi:21106203, gi:21106211, gi:21106221, gi:21106232,
CC   gi:21106241, gi:21106249, gi:21106259, gi:21106269, gi:21106281,
CC   gi:21106292, gi:21106304, gi:21106315, gi:21106326, gi:21106335,
CC   gi:21106347, gi:21106358, gi:21106364, gi:21106377, gi:21106386,
CC   gi:21106397, gi:21106404, gi:21106414, gi:21106425, gi:21106435,
CC   gi:21106446, gi:21106456, gi:21106469, gi:21106477, gi:21106495,
CC   gi:21106503, gi:21106507, gi:21106514, gi:21106524, gi:21106533,
CC   gi:21106543, gi:21106553, gi:21106566, gi:21106580, gi:21106590,
CC   gi:21106600, gi:21106614, gi:21106627, gi:21106637, gi:21106642,
CC   gi:21106649, gi:21106663, gi:21106674, gi:21106684, gi:21106694,
CC   gi:21106705, gi:21106712, gi:21106718, gi:21106730, gi:21106741,
CC   gi:21106752, gi:21106761, gi:21106769, gi:21106779, gi:21106791,
CC   gi:21106802, gi:21106806, gi:21106819, gi:21106825, gi:21106833,
CC   gi:21106844, gi:21106855, gi:21106868, gi:21106874, gi:21106882,
CC   gi:21106891, gi:21106903, gi:21106912, gi:21106922, gi:21106930,
CC   gi:21106937, gi:21106945, gi:21106957, gi:21106967, gi:21106980,
CC   gi:21106990, gi:21107003, gi:21107014, gi:21107026, gi:21107039,
CC   gi:21107050, gi:21107061, gi:21107072, gi:21107087, gi:21107100,
CC   gi:21107106, gi:21107129, gi:21107140, gi:21107150, gi:21107161,
CC   gi:21107171, gi:21107181, gi:21107191, gi:21107203, gi:21107216,
CC   gi:21107223, gi:21107235, gi:21107248, gi:21107258, gi:21107273,
CC   gi:21107283, gi:21107287, gi:21107298, gi:21107308, gi:21107320,
CC   gi:21107328, gi:21107338, gi:21107348, gi:21107356, gi:21107366,
CC   gi:21107379, gi:21107392, gi:21107404, gi:21107413, gi:21107421,
CC   gi:21107430, gi:21107440, gi:21107450, gi:21107460, gi:21107464,
CC   gi:21107474, gi:21107482, gi:21107494, gi:21107504, gi:21107514,
CC   gi:21107527, gi:21107541, gi:21107553, gi:21107560, gi:21107570,
CC   gi:21107580, gi:21107590, gi:21107600, gi:21107609, gi:21107619,
CC   gi:21107629, gi:21107639, gi:21107650, gi:21107661, gi:21107674,
CC   gi:21107685, gi:21107697, gi:21107708, gi:21107717, gi:21107729,
CC   gi:21107740, gi:21107749, gi:21107759, gi:21107769, gi:21107780,
CC   gi:21107789, gi:21107805, gi:21107816, gi:21107825, gi:21107837,
CC   gi:21107847, gi:21107855, gi:21107864, gi:21107878, gi:21107891,
CC   gi:21107900, gi:21107911, gi:21107925, gi:21107936, gi:21107945,
CC   gi:21107959, gi:21107967, gi:21107975, gi:21107985, gi:21107994,
CC   gi:21108003, gi:21108014, gi:21108017, gi:21108023, gi:21108039,
CC   gi:21108049, gi:21108063, gi:21108072, gi:21108082, gi:21108090,
CC   gi:21108100, gi:21108105, gi:21108111, gi:21108119, gi:21108127,
CC   gi:21108138, gi:21108151, gi:21108157, gi:21108173, gi:21108185,
CC   gi:21108198, gi:21108211, gi:21108218, gi:21108229, gi:21108236,
CC   gi:21108246, gi:21108257, gi:21108268, gi:21108281, gi:21108287,
CC   gi:21108293, gi:21108308, gi:21108320, gi:21108325, gi:21108336,
CC   gi:21108347, gi:21108360, gi:21108371, gi:21108379, gi:21108381,
CC   gi:21108390, gi:21108400, gi:21108412, gi:21108420, gi:21108430,
CC   gi:21108435, gi:21108445, gi:21108456, gi:21108471, gi:21108485,
CC   gi:21108499, gi:21108507, gi:21108518, gi:21108529, gi:21108542,
CC   gi:21108552, gi:21108559, gi:21108570, gi:21108584, gi:21108594,
CC   gi:21108606, gi:21108620, gi:21108631, gi:21108642, gi:21108652,
CC   gi:21108664, gi:21108672, gi:21108683, gi:21108695, gi:21108706,
CC   gi:21108716, gi:21108728, gi:21108737, gi:21108746, gi:21108754,
CC   gi:21108760, gi:21108767, gi:21108775, gi:21108787, gi:21108797,
CC   gi:21108803, gi:21108809, gi:21108817, gi:21108827, gi:21108836,
CC   gi:21108849, gi:21108859, gi:21108869, gi:21108875, gi:21108888,
CC   gi:21108899, gi:21108910, gi:21108919, gi:21108937, gi:21108950,
CC   gi:21108962, gi:21108970, gi:21108978, gi:21108992, gi:21109004,
CC   gi:21109015, gi:21109026, gi:21109031, gi:21109041, gi:21109051,
CC   gi:21109059, gi:21109069, gi:21109078, gi:21109089, gi:21109097,
CC   gi:21109106, gi:21109120, gi:21109129, gi:21109140, gi:21109152,
CC   gi:21109159, gi:21109169, gi:21109180, gi:21109191, gi:21109199,
CC   gi:21109207, gi:21109217, gi:21109231, gi:21109244, gi:21109255,
CC   gi:21109266, gi:21109281, gi:21109293, gi:21109302, gi:21109310,
CC   gi:21109322, gi:21109337, gi:21109343, gi:21109350, gi:21109364,
CC   gi:21109372, gi:21109384, gi:21109393, gi:21109398, gi:21109405,
CC   gi:21109415, gi:21109422, gi:21109434, gi:21109444, gi:21109449,
CC   gi:21109461, gi:21109475, gi:21109486, gi:21109495, gi:21109501,
CC   gi:21109508, gi:21109516, gi:21109528, gi:21109536, gi:21109547,
CC   gi:21109560, gi:21109570, gi:21109579, gi:21109588, gi:21109601,
CC   gi:21109611, gi:21109622, gi:21109636, gi:21109649, gi:21109657,
CC   gi:21109664, gi:21109674, gi:21109682, gi:21109694, gi:21109704,
CC   gi:21109717, gi:21109725, gi:21109738, gi:21109747, gi:21109759,
CC   gi:21109775, gi:21109784, gi:21109794, gi:21109804, gi:21109809,
CC   gi:21109818, gi:21109826, gi:21109833, gi:21109843, gi:21109853,
CC   gi:21109861, gi:21109871, gi:21109882, gi:21109888, gi:21109900,
CC   gi:21109913, gi:21109918, gi:21109922, gi:21109933, gi:21109941,
CC   gi:21109951, gi:21109962, gi:21109974, gi:21109982, gi:21109993,
CC   gi:21110006, gi:21110015, gi:21110025, gi:21110037, gi:21110049,
CC   gi:21110061, gi:21110073, gi:21110086, gi:21110096, gi:21110107,
CC   gi:21110121, gi:21110134, gi:21110148, gi:21110156, gi:21110170,
CC   gi:21110187, gi:21110196, gi:21110207, gi:21110216, gi:21110228,
CC   gi:21110236, gi:21110245, gi:21110252, gi:21110265, gi:21110276,
CC   gi:21110288, gi:21110297, gi:21110305, gi:21110317, gi:21110326,
CC   gi:21110337, gi:21110351, gi:21110361, gi:21110372, gi:21110386,
CC   gi:21110400, gi:21110413, gi:21110425, gi:21110435, gi:21110447,
CC   gi:21110458, gi:21110465, gi:21110479, gi:21110491, gi:21110497,
CC   gi:21110507, gi:21110521, gi:21110530, gi:21110538, gi:21110546,
CC   gi:21110554, gi:21110560, gi:21110569, gi:21110580, gi:21110590,
CC   gi:21110601, gi:21110610, gi:21110620, gi:21110627, gi:21110636,
CC   gi:21110645, gi:21110649, gi:21110660, gi:21110667, gi:21110679,
CC   gi:21110688, gi:21110697, gi:21110711, gi:21110718, gi:21110727,
CC   gi:21110732, gi:21110738, gi:21110748, gi:21110761, gi:21110769,
CC   gi:21110778, gi:21110788, gi:21110800, gi:21110810.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5175554
FT                   /organism="Xanthomonas citri pv. citri str. 306"
FT                   /strain="306"
FT                   /mol_type="genomic DNA"
FT                   /note="pathovar: citri"
FT                   /db_xref="taxon:190486"
FT   gene            42..1370
FT                   /gene="dnaA"
FT                   /locus_tag="XAC0001"
FT   CDS_pept        42..1370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="XAC0001"
FT                   /product="chromosomal replication initiator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34893"
FT                   /db_xref="GOA:Q8PRG2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PRG2"
FT                   /protein_id="AAM34893.1"
FT                   /translation="MDAWPRCLERLEAEFPPEDVHTWLKPLQAEDRGDSIVLYAPNAFI
FT                   VDQVRERYLPRIRELLAYFVGNGDVALAVGSRPRAPEPAPAPVAVPSAPQAAPIVPFAG
FT                   NLDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNA
FT                   LRQANPAAKVMYLRSEQFFSAMIRALQDKAMDQFKRQFQQIDALLIDDIQFFAGKDRTQ
FT                   EEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIV
FT                   LAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLVARANFTGRSITVEFAQETLRD
FT                   LLRAQQQAIGIPNIQKTVADYYGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPE
FT                   IGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKLSE"
FT   gene            1647..2747
FT                   /gene="dnaN"
FT                   /locus_tag="XAC0002"
FT   CDS_pept        1647..2747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="XAC0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34894"
FT                   /db_xref="GOA:Q8PRG1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRG1"
FT                   /protein_id="AAM34894.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLT
FT                   GTDLEVEMISRTLVEDAQDGETTIPARKLFDILRALPDGSRVTISQTGDKVTVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRD
FT                   GLLRCVATDGHRLALCEMELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSH
FT                   IRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGV
FT                   RVEVSPGQLKISAHNPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALRDEHVVIQL
FT                   RDANSSALVREASSEKSRHVVMPLRL"
FT   gene            3799..4905
FT                   /gene="recF"
FT                   /locus_tag="XAC0003"
FT   CDS_pept        3799..4905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="XAC0003"
FT                   /product="DNA replication and repair RecF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34895"
FT                   /db_xref="GOA:Q8PRG0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PRG0"
FT                   /protein_id="AAM34895.1"
FT                   /translation="MHVVRLSIHRLRRFQTVELHPSSALNLLTGDNGAGKTSVLEALHL
FT                   MAYGRSFRGRVRDGLIQQGANDLEVFVEWKEGGGAAVERTRRAGLRHSGQEWTGRLDGE
FT                   DVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHVEPDFLTLWRRYARALK
FT                   QRNALLKQGAQPRMLDAWDNELAESGETLTSRRMRYLERLQDRLVPVADAIAPALGLSA
FT                   LTFAPGWKRHEVSLADALLLARERDRQNGYTSQGPHRADWMPSFHALPGKDALSRGQAK
FT                   LTALACLLAQAEDFAFERGEWPVIALDDLGSELDRHHQGRVLQRLASAPAQVLITATET
FT                   PPGLADAAALLQQFHVEHGQIARQATVN"
FT   gene            5020..7464
FT                   /gene="gyrB"
FT                   /locus_tag="XAC0004"
FT   CDS_pept        5020..7464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="XAC0004"
FT                   /product="DNA gyrase subunit B"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34896"
FT                   /db_xref="GOA:Q8PRF9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF9"
FT                   /protein_id="AAM34896.1"
FT                   /translation="MTDEQNTPPTPNGTYDSSKITVLRGLEAVRKRPGMYIGDVHDGTG
FT                   LHHMVFEVVDNSVDEALAGHADDIVVKILADGSVAVSDNGRGVPVDIHKEEGVSAAEVI
FT                   LTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEHLWLDIWRDGFHYQQEYALGEPQYP
FT                   LKQLEASTKRGTTLRFKPSVAIFSDVEFHYDILARRLRELSFLNSGVKITLIDERGEGR
FT                   RDDFHYEGGIRSFVEHLAQLKSPLHPNVISVTGEHNGIMVDVALQWTDAYQETMYCFTN
FT                   NIPQKDGGTHLAGFRAALTRVLSTYIEQNGIAKQAKVALTGDDMREGMIAVLSVKVPDP
FT                   SFSSQTKEKLVSSDVRPAVENAFGARLQEFLQENPNEAKAITGKIVDAARAREAARKAR
FT                   DLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKNQAVLPLRG
FT                   KILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLRYHRIILMTDADVDGSHIR
FT                   TLLLTFFYRQMPELIERGYIYIGLPPLYKLKQGKSELYLKDDAALNAYLASNAVEGAAL
FT                   IPATDEPPITGEALEKLLMLFTSANEAIARNAHRYDPALLTALIDLPPLDVEKLQAEGD
FT                   QHPTLDALQAVLNRGTLGTARYQLRFDPGSDNAPATLVAIRRHMGEEFTQVLPMGAFES
FT                   GELRPLREVSLALHDLVREGAQIVRGNKSHPITSFAQAHAWLLDEAKKGRQVQRFKGLG
FT                   EMNAEQLWETTVNPDTRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEDNALKVSNL
FT                   DI"
FT   gene            7685..8368
FT                   /locus_tag="XAC0005"
FT   CDS_pept        7685..8368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34897"
FT                   /db_xref="GOA:Q8PRF8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF8"
FT                   /protein_id="AAM34897.1"
FT                   /translation="MRGFGQVQAAKAQGLTPSPTEVMAAIGQPGVMVQLLTALVSTATP
FT                   ALLLYYWRRRATPAEQTASRAAARRASTWGWTALIAAAVFLLSNLVSVAASALGIKPVP
FT                   TNLPLMKEALQQWPLALTLFAVIIAPAYEELLFRRVLFGRLLAAARPWLGIVLSGAIFA
FT                   LVHEVPGISGNGPAAIAQLWLVYGSMGAAFAWLYWRTGTLWAPIAAHGINNATALAALY
FT                   FFGLG"
FT   gene            8552..9358
FT                   /locus_tag="XAC0006"
FT   CDS_pept        8552..9358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34898"
FT                   /db_xref="GOA:Q8PRF7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF7"
FT                   /protein_id="AAM34898.1"
FT                   /translation="MKARLLIVVAVLALTACATTTSPTGRRQVVGGVSQQQLDQLGAQS
FT                   FAQTKAKEKVSTDGKQNAYVQCVVNALVAQLPPQWRETKWETALFVDNEANAFALPGGK
FT                   VGVNTGIFTVAKTQDQLAAVLGHEIGHVISRHHEERITRQLGAQTGLGIIGALAGAAYG
FT                   DGAASAVNQVGGMTAQTVFLLPGSRTQESEADVVGQRLMAQAGFDPAQAVTLWQNMMAA
FT                   SGNRQPQWLSTHPDPANRIRELQADVAQLEPVYQQAKQSGRAPRCG"
FT   gene            9636..10829
FT                   /locus_tag="XAC0007"
FT   CDS_pept        9636..10829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34899"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF6"
FT                   /protein_id="AAM34899.1"
FT                   /translation="MKLLNRKQALLSLFIAASLGGAVVTDAVAQSDRSSERASRKSKSG
FT                   KAEELYPQSTRQAPTIKPSSKLSSKLQKLIETFNKGEDYQGVRTQADEILANSAANDAD
FT                   KALAAQLAAQAAYNLDDTAGAKKYLQQAIGLNALDNNGHFQSMLMLAQLQMQDDQQAEG
FT                   LATLDKYLEESKSQRPEDLILKGQALYQTERYKEAIPVLKQAIAASPEPKDSWNQLLMA
FT                   SYAEAGQTGEAVAAAEALAAKTPNDKKAQLNLANMYMQADQMDKAAGVMDKLRASGQLT
FT                   EEKEYKQLYSIYANTENKEKDVIAVINEGMQKGILKPDYQTYLALAQSYYYSDDVPKAI
FT                   ENWQKAAPLSKDGETYLNLAKVLHSEGRIPEAKQAAQQAIAKGVKKPEDAKKIINLK"
FT   gene            10983..11654
FT                   /gene="tonB"
FT                   /locus_tag="XAC0008"
FT   CDS_pept        10983..11654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="XAC0008"
FT                   /product="TonB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34900"
FT                   /db_xref="GOA:Q8PRF5"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF5"
FT                   /protein_id="AAM34900.1"
FT                   /translation="MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPA
FT                   VAPKAPAEKERTTMVTLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPPPEAP
FT                   VVDVPEPRPSDIVTPPSPPSPPAPPSDIGASVDISSKNMNPPKYPPAAFRAGVQGEVIL
FT                   IVDVDASGNVTNVSVEKSSRNRDLDRAAMDAARKWKFNASTVNGQKAAGRVRVPVNFAL
FT                   N"
FT   gene            11740..12501
FT                   /gene="exbB"
FT                   /locus_tag="XAC0009"
FT   CDS_pept        11740..12501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="XAC0009"
FT                   /product="biopolymer transport ExbB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34901"
FT                   /db_xref="GOA:Q8PRF4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF4"
FT                   /protein_id="AAM34901.1"
FT                   /translation="MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVV
FT                   LITLIAMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPASEPFS
FT                   KIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTRESTKLQSGMTLLATVG
FT                   ATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKVNSSVIAKFDTFAHDLHDFFATGSRVR"
FT   gene            12548..12970
FT                   /gene="exbD1"
FT                   /locus_tag="XAC0010"
FT   CDS_pept        12548..12970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="XAC0010"
FT                   /product="biopolymer transport ExbD1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34902"
FT                   /db_xref="GOA:Q8PRF3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF3"
FT                   /protein_id="AAM34902.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPEANLIQKEDAEKRAAPITLAVKEDGSLYWNDEPISKEALESRLSTAAQQTPQPPLNL
FT                   RGDRTTKMRTINEITKIAQGQGMLDVGFVATKVKGQ"
FT   gene            12974..13387
FT                   /gene="exbD2"
FT                   /locus_tag="XAC0011"
FT   CDS_pept        12974..13387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="XAC0011"
FT                   /product="biopolymer transport ExbD2 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34903"
FT                   /db_xref="GOA:Q8PRF2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF2"
FT                   /protein_id="AAM34903.1"
FT                   /translation="MAFSTGGSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQTTEPPPPIELRIDASNQVFWNNSPTPVDVLQQKMEEVVQADPTNQPEL
FT                   RIDANPDAEYEVMAKVLAAAKNSQMKKIGFMQQ"
FT   gene            complement(13649..14416)
FT                   /gene="pdxJ"
FT                   /locus_tag="XAC0012"
FT   CDS_pept        complement(13649..14416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="XAC0012"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34904"
FT                   /db_xref="GOA:Q8PRF1"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PRF1"
FT                   /protein_id="AAM34904.1"
FT                   /translation="MTTQLSVNVNKIAVLRNSRGGADPDVVQAARACIAAGAHGITVHP
FT                   RPDQRHIRADDVLALSALTREHGVEFNIEGNPFAPPRGDYPGLLQLCRATRPEQVTLVP
FT                   DGDGQLTSDHGFDFAQDTVQLAELITAFKRLGSRVSLFVDAGNPDIARAATLGADRIEL
FT                   YTGPYAHAHASGQADTALALFANAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEV
FT                   SIGHALISEALYQGLDASVRAYVDILRSGHVSA"
FT   gene            complement(14424..14756)
FT                   /locus_tag="XAC0013"
FT   CDS_pept        complement(14424..14756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34905"
FT                   /db_xref="GOA:Q8PRF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRF0"
FT                   /protein_id="AAM34905.1"
FT                   /translation="MPTWNRAGRGATLPPLNGELVMHWLFLLMALGALVLAFSTPHVWL
FT                   LVASLLVALLLLLLWTRGWFASRMGDTQRDTSSMIDPAELRRLRELAEARKSAALAAAR
FT                   DSEPQA"
FT   gene            complement(14768..16228)
FT                   /gene="cls"
FT                   /locus_tag="XAC0014"
FT   CDS_pept        complement(14768..16228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="XAC0014"
FT                   /product="cardiolipin synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34906"
FT                   /db_xref="GOA:Q8PRE9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE9"
FT                   /protein_id="AAM34906.1"
FT                   /translation="MLALAQGAWEWLATIPHLEALLLAAYVLYLLWIAGWIVLQKREPV
FT                   ATLSWVLSLAALPYLGLLIYYWLGPQKVKRQRLRRGRSRSGMESYSSVCPPDADCTELA
FT                   KIAQSTTGLAPSSATEVHWLVDGAATYAAIIEAIRGARDHIHLEYYIFQPDHSGTAICA
FT                   ALMERARAGVKVRLLMDAIGSSAMTRRALRTLREAGVETAWFHPSQLLKPFKRPWLNLR
FT                   THRKVIVIDGRIGFTGGINVTDDENEQVRKQAYRDLHVRLQGHVVRSLQLVFLEDWLYA
FT                   TSQGRAAFHGQQLWPDDMPTRAQGTVDAQVLVSGPDSSWEAIHRLMVAAIHEAKHRVWL
FT                   VTPYFVPGEAARMALTSAALGGLDVRLLVPRVSDSRLVTYAARSYFDELLEAGVRIYEY
FT                   GPRMLHTKALLADDDVCIVGSANFDSRSFRLNFELSMLFRDQAVAAEMAGLIGTDLQQA
FT                   QEVQFARHRPLWRSRLPEAFARLLSPLL"
FT   gene            16671..17330
FT                   /locus_tag="XAC0015"
FT   CDS_pept        16671..17330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0015"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE8"
FT                   /protein_id="AAM34907.1"
FT                   /translation="MAPPGIQEQPVSQADADQFAIYSSVYRSYGNIGTLNVKIDLANGT
FT                   VAPSSVSRMVEVASDESSAFASAFDVRREGATRQQVIQWLEKNDWQVPNTGENFIFFIQ
FT                   QVLSNAYKWRSSEDYSIRIDTTFNDKSRAIFAYDSAKRAIVYVEAYDSAGNLIGTSSSE
FT                   PINVDYSSYESPGAASRPDYQRGIDWLTSSGAATISGGTVTVGSGTVLVGDVVQVK"
FT   gene            17330..17920
FT                   /locus_tag="XAC0016"
FT   CDS_pept        17330..17920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0016"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34908"
FT                   /db_xref="GOA:Q8PRE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE7"
FT                   /protein_id="AAM34908.1"
FT                   /translation="MRTFRIRGRRLGLRFRETVLLAGTLACSVLFVATQRQIGLLCYAV
FT                   APILLLAFFVLQADLVWRGHKTAGAAFIMAVAAWLTFSVLATYAFSGLVHTHNFLGTWL
FT                   KALLGAGFFAVLFSLSVLLARKRSVSLYWYLAGSLAVVIAVAAVHPENSGDITVNCERG
FT                   SCAAGIIAFWPGAFQAADGKRPISVVLPHSGGD"
FT   gene            complement(18131..19258)
FT                   /locus_tag="XAC0017"
FT   CDS_pept        complement(18131..19258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34909"
FT                   /db_xref="GOA:Q8PRE6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE6"
FT                   /protein_id="AAM34909.1"
FT                   /translation="MQKNSFPSASAAAERDVRSSRTVIKGRGTTAYVPGRFSVTTAVEI
FT                   DDGWGALDADGKTAMRPKTVVAEEIARSIISRNNSPDIGFSQSVNPYRGCEHGCVYCFA
FT                   RPSHAYLDLSPGLDFETRIFAKPNAAALLRAEIARPSYQCSPIALGINTDAYQPAERRL
FT                   RISRQCLEVLAEARHPVSFVTKAALIERDIDVLAEMAQHNLVSVYFSVTTLDNRLAAKM
FT                   EPRAAAPHARLRAMQALHAAGVPVGVLVAPVIPMINDKELERILDAAAAHGARSAGYVL
FT                   LRLPHELTQLWREWLELHYPDRAKHVMSLVQQMRGGKDYDSRFGKRMVGEGPFAELIAQ
FT                   RFSIAYRRLGFGRLPRLDTTHFRPPRPDTPQLNLF"
FT   gene            complement(19442..20359)
FT                   /locus_tag="XAC0018"
FT   CDS_pept        complement(19442..20359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34910"
FT                   /db_xref="GOA:Q8PRE5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE5"
FT                   /protein_id="AAM34910.1"
FT                   /translation="MLPCTLHTRHGQPSHATSEAGRTHRLSAALHPPARCRHLAAYWDA
FT                   NNVAYRSSLRNAWRTLQPARQIAMVRRMSQPDFIQITDNAIAHEDCVAIVQRMRQSQQL
FT                   HPGRIGGGVFPDLKHSRDLRISGMAEWAEVENRLQQAVFEGVLTYLRQYPQALISPLML
FT                   QVTTADGRPHRLVAEDIVQMSDQALGDLARTCLRPGAINLQWYTADQGGYPYWHCELYP
FT                   RDANADTLHRHLLWTLYLNDDFAQGETEFLFQQRKARPRTGSLLIAPTAFTHTHRGNRP
FT                   VGGDKFIATSWILFQSAQALYGGE"
FT   gene            complement(20413..21753)
FT                   /gene="ompP1"
FT                   /locus_tag="XAC0019"
FT   CDS_pept        complement(20413..21753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompP1"
FT                   /locus_tag="XAC0019"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34911"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE4"
FT                   /protein_id="AAM34911.1"
FT                   /translation="MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAF
FT                   AGSGSAPDDASIIATNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVSGGNG
FT                   GDAGMIAPVPAMYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVGRYHGTKTELQAID
FT                   FNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSVLAARRVPGFAPGSADGYSRIKG
FT                   DSTEVGFTLGGLFSIDENTHIGFSYRSQVEHKITDGTADFTVPGSAAAVLSVAAPGTFV
FT                   DTKGRATVKLPASATASFTHNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFS
FT                   YRDTTFASIGADYRLSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSA
FT                   QTEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF"
FT   gene            21972..22664
FT                   /locus_tag="XAC0020"
FT   CDS_pept        21972..22664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34912"
FT                   /db_xref="GOA:Q8PRE3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE3"
FT                   /protein_id="AAM34912.1"
FT                   /translation="MFVSLPSRKKPTPRWAVPLLFATVWLAYLWSISRPGEARNTLWLD
FT                   WGALSSGVSNLGDWWATLRDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERILGP
FT                   WRLLLLFLVGGAASNLAAIFAIGTPDRVIIGASGAVSALIGTYLALFPGAKLGVVLPLG
FT                   VFLEFIRVPAPLLIGAWALLQVVFAYIGPAFGMVAWSAHIAGFVFGIVYGLYVRAAIAR
FT                   RLRKRHGF"
FT   gene            22773..23093
FT                   /locus_tag="XAC0021"
FT   CDS_pept        22773..23093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34913"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE2"
FT                   /protein_id="AAM34913.1"
FT                   /translation="MSKSLYKVTFLNHGKVYELYAREVTGSHLWGFNQIGELVFDVHDG
FT                   LVVDPTEERLREEFGNTRTLHLPMQSIVRIEEVEKKGQSVIRDATTGDKVVTPFPSPIK
FT                   PR"
FT   gene            23093..24085
FT                   /gene="serA"
FT                   /locus_tag="XAC0022"
FT   CDS_pept        23093..24085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="XAC0022"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34914"
FT                   /db_xref="GOA:Q8PRE1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE1"
FT                   /protein_id="AAM34914.1"
FT                   /translation="MRIVVPDDYQGAVAQLPCLQQLQDHQVQVLGALDAELDARAACLA
FT                   DADALVLIRERTRVDAALLQRLPRLKLISQTGRVGAHVDVAACTALGVAVAEGVGSPVA
FT                   PAELTWALILSASRRLTDYQHALQQGRWQALGDPGLGRVLHGRTLGIWSYGRIGQRVAG
FT                   FGRAFGMQVVVWGGEASCAQAARDGFAVAGSREDLFERSDVLSLHRRLTAQTRHDVTAQ
FT                   DLARMRADALLVNTSRAELIAPGALLAALDAGRPAQAALDVFEHEPVLDPRDPLLRHAR
FT                   VLATPHLGYVERDSYALYFDAAFDNVLAFAAGTPRNLVNPEVLATTQRV"
FT   gene            complement(24251..25777)
FT                   /gene="ctp"
FT                   /locus_tag="XAC0023"
FT   CDS_pept        complement(24251..25777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="XAC0023"
FT                   /product="carboxyl-terminal protease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34915"
FT                   /db_xref="GOA:Q8PRE0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRE0"
FT                   /protein_id="AAM34915.1"
FT                   /translation="MRVAVLSVALSLALFASPGWAQKAGPAAAQASADDPEANEAAVSK
FT                   VPLDEIRRFVAVYNAVKQAYVDPVEDKKLMHAAVRGLLSDLDPHSTYFDKEDAEAFDEQ
FT                   ATGAYDGIGVELLQQQDNTLKVIAPIDDTPAARAGIRAGDVIVAIDGKPIDASKAMEPL
FT                   RGESGSKVVLTIMRDKMPKPFDVTLQRETIRVASVRSKLLEPGFGYIRISTFQADTGAD
FT                   FQKNLKQLQAGGKLRGLVLDLRSNPGGLLTSAVQVADDLLDKGNIVSTRGRISISDAKF
FT                   DATPGDLLNGAPVVVLVDAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDN
FT                   GDSVKLTTARYYTPSGKSIQASGIVPDVLLTPEPQPGDADVPASLTDYSEATLPGHLRG
FT                   DDEGEEGYSAGDVLPGDGPITEALAELKQPGAAAKAQAARKAKAQAAQKAKAANKTGAE
FT                   PKPAAARPATTDKPRSAEPAGKAKPATTPPAPAEPVQPTTPTDKPAEPVN"
FT   gene            complement(25882..27117)
FT                   /locus_tag="XAC0024"
FT   CDS_pept        complement(25882..27117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34916"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD9"
FT                   /protein_id="AAM34916.1"
FT                   /translation="MWLAVGVLACTLLGSMGASAQSQRETERKLQQLRDELKTISADRR
FT                   ELEGKRGTAAQQLRQADEKVAKTARALSETEAAMRAQEQHLSTLQQERAQLQRGLQNQR
FT                   AQLAALLRAADQVGRNAPLKVLLSQDTVGDATRMLADHRYVQNARAQRIHALTTQLDAL
FT                   ATVEQDIATRRQALDAARAQQKAQAATLQKDRSQQAATVAQLDDRYKQRAEREKAIGQD
FT                   AKALEQLLANLRAAAAKAEAERRAAARRAAAEAAAQAKRSKTERSDRPGKTPSKVVANA
FT                   PAPKVGGLSWPVAGNLLARFNATLPDGHTSKGVLIGAPKGTTVTAVADGTVVFSDWMTG
FT                   YGMILIVDHGNGYMSLYAHNDTLLRDAGATIKRGDAVAKVGSSGGQGVPALYFELRRNG
FT                   QPVDPSSWLQRR"
FT   gene            27278..27934
FT                   /locus_tag="XAC0025"
FT   CDS_pept        27278..27934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34917"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD8"
FT                   /protein_id="AAM34917.1"
FT                   /translation="MKPQILLLALSLACTSAWADEDVSKVNGKISADAGKTYGALETVN
FT                   GSIEIGAGAQTKNVETVNGGIRIGDNARTGGVETVNGSITLGQKVTVSGGLETVNGSIL
FT                   AERGSQISGGVETVNGSIGLVGTELGKGIETVNGDITVGVGSHVRGGIEVSKPSFGFSF
FT                   QPSRKPRVVIGPDAVVDGPLHFEREVNLYVHRSAKIGAVSGATARSFDSDVAPKD"
FT   gene            28096..29892
FT                   /locus_tag="XAC0026"
FT   CDS_pept        28096..29892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34918"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD7"
FT                   /protein_id="AAM34918.1"
FT                   /translation="MPRKILLCLAATLALAGCKREPADAPSAPAAQTPTDSAPSAPVSR
FT                   HTFSPDMTTGDFAELVKTLASDDFEGRGPGTPGEEKTVTYIRDQMQRIGLQPGNGDSWF
FT                   QEVPMVETTADASTAPSLRSGEQTRTLAFGTDIVVGTRTGQAEVKLDNSELVFVGYGVD
FT                   APEQQWNDYAGQEWKGKTVVMFVNDPGFHTDDAKLFDGKRMTYYGRWTYKFEEAARKGA
FT                   AAALIVHDTPGASYGWDVVKNSWSGPQYDLPAKDDPDPRLPVQGWISAETARQLFANAG
FT                   LDLTQAYKDASKRGFKPVPLKASWSVDLKSTIAAKTSRNVVGVLPGTSHADEAVLYMAH
FT                   WDHLGKHPGERGDNIYNGAVDNATGVAGILEIADAFAHQDPKPTRSVVFLAVTLEESGL
FT                   LGSKYYVANPSFPLDKIAAVINLDAMSVAGRARDVTVVGMGSSELEDILKPIAAMQGRT
FT                   LHAEATPQSGSYFRSDHFNFAKAGVPALYADGGEDLREGGTAAGRAAAEDYGRHRYHAP
FT                   GDEYDAATWKLDGTIEDLQVVYGVGKEVAAGERWPNWYPGNPFKAARDRMMAGRPGTSA
FT                   ASAQPADATSRATQTNMAKPPR"
FT   gene            complement(30212..30655)
FT                   /locus_tag="XAC0027"
FT   CDS_pept        complement(30212..30655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34919"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD6"
FT                   /protein_id="AAM34919.1"
FT                   /translation="MTQRLMKTALIGVLALVSQGALAQAADKPAKALTSGEVTSMLTAK
FT                   GYTKVHDLKFEHGVWTADARSGDGKDVDVHIDPVTGRVYGDQTTSKLSEADVRASLSTG
FT                   GYADVHDLKFNDGLWKADAKRNGQKVELHVDPEDGHVVSVEND"
FT   gene            complement(30948..32081)
FT                   /gene="egl"
FT                   /locus_tag="XAC0028"
FT   CDS_pept        complement(30948..32081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="XAC0028"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34920"
FT                   /db_xref="GOA:Q8PRD5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD5"
FT                   /protein_id="AAM34920.1"
FT                   /translation="MSAVCFSLRALLRSTLLFIVFGSLPLAHAQTRALTYAGVNLSGAE
FT                   FASSKKPGVLNKDYMYAAASDYTYFAGVGMNTIRLPILWERLQPTASGELDPAQLALLQ
FT                   QAVARAKAAGMYLVIDIHNYAKYYGYKIGSPEVPVATFTDLWRRLALAFNSDNAVMFGL
FT                   MNEPNNISASDWAGAAQAAIDAIRRTGANNLILVPGELWTGAHSWYSTTNDGYSNATAL
FT                   TSIYDPLDRYAFEVHQYLDADSSGTSSTCVSSTIGAERLRNFTQWLRTNRKRGFLAEFG
FT                   TANNAVCNQALQGMLAYMETNADVWLGWTWWAAGSWWNLSYAYSVHPNKDGTDKPQMAI
FT                   LSPQATLATRAPVAAAAARTSAASTSATSTSVARTAR"
FT   gene            complement(32718..33770)
FT                   /gene="egl"
FT                   /locus_tag="XAC0029"
FT   CDS_pept        complement(32718..33770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="XAC0029"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34921"
FT                   /db_xref="GOA:Q8PRD4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="PDB:5HOS"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD4"
FT                   /protein_id="AAM34921.1"
FT                   /translation="MKSLTTHTRRLRCRALSFLLLAAMPLAQAQSATGLKYAGVNLSGA
FT                   EIKSSQKPGVLNIDYRYPAADEYAYFAGKHMNTVRLPILWERLQPRAGGELDPAQLALI
FT                   RQAVANAKAAKMYVIVDVHNYAKYYGHTIGSTKVPISTFNDLWRRLAIAFKSDNAVIFG
FT                   LMNEPYDIDPQAWATAAQASIDTIRKTGATNLILVPGALWTGAHSWYSTVAGQSNAVAM
FT                   ASIRDPLNRYAIEAHQYLDADSSGTSGGCVSATVGVERLRSFTEWLRLNKKRGFLAEFG
FT                   TGNTVTCNLALNGMLGYMESNSDVWMGWSWWAAGAWWSGAYPFNVQPDAQGRDKPQMSI
FT                   LSPRARRITD"
FT   gene            complement(34548..35621)
FT                   /gene="egl"
FT                   /locus_tag="XAC0030"
FT   CDS_pept        complement(34548..35621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="XAC0030"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34922"
FT                   /db_xref="GOA:Q8PRD3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="PDB:4W7U"
FT                   /db_xref="PDB:4W7V"
FT                   /db_xref="PDB:4W7W"
FT                   /db_xref="PDB:5HNN"
FT                   /db_xref="PDB:5HPC"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD3"
FT                   /protein_id="AAM34922.1"
FT                   /translation="MFRTPPYFPRLRIAALALTLLAAGPLAQAKEPPGPRRETAGLKYV
FT                   GVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLD
FT                   QAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKD
FT                   DKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYG
FT                   VSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQK
FT                   GFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGS
FT                   DKPQMAILSKYARRAGK"
FT   gene            35929..36987
FT                   /gene="yahK"
FT                   /locus_tag="XAC0031"
FT   CDS_pept        35929..36987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="XAC0031"
FT                   /product="alcohol dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34923"
FT                   /db_xref="GOA:Q8PRD2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD2"
FT                   /protein_id="AAM34923.1"
FT                   /translation="MSTAHAYAAQAADQPLAPFVFERRAPGPNDVQIDIAYCGVCHSDL
FT                   HTARNEWHNTLYPSVPGHEIVGRVTAVGNAVTGFKVGDLAGVGCMVDSCRSCASCQEGE
FT                   EQYCEAGFTGTYNGPMFGGGENTYGGYSDHIVVDQKYVLRITHSDNLAAVAPLLCAGIT
FT                   TYSPLAHWKVGPGQKVGVVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADALRLGASE
FT                   VVISKDEAQMAAQYNTLDFILNTVAAPHNLDPFLNALKRDGAIVLVGVPEQSHPSPAVF
FT                   NLVMKRRTLAGSLIGGIRQTQEMLDFCAKHNIVSDIETIRADQINEAYERMLKSDVKYR
FT                   FVIDMATLDQAA"
FT   gene            complement(37522..39003)
FT                   /gene="gltD"
FT                   /locus_tag="XAC0032"
FT   CDS_pept        complement(37522..39003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="XAC0032"
FT                   /product="glutamate synthase beta subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34924"
FT                   /db_xref="GOA:Q8PRD1"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD1"
FT                   /protein_id="AAM34924.1"
FT                   /translation="MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGRFDKADAQYQ
FT                   AGRCLDCGNPYCSWKCPVHNAIPQWLQLVQEDRIIEAAALCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVQASGHRVAVIGAGPAGLACA
FT                   DRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEVGR
FT                   DVSIEQLLGEYDAVFLGTGAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRP
FT                   IAGWEDQLALPDLTGKRVVVLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSARE
FT                   VANAREEGVRFLFNRQPLSIESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLL
FT                   EADVVIIAFGFSPTLPDWLASQGVDAGSNGRIVAPSDGNGRLPYQTTNPRLFAGGDCVR
FT                   GADLVVTAVAEGRDAAGSIVQLLGVKAQVKEPAAA"
FT   gene            complement(39132..43604)
FT                   /gene="gltB"
FT                   /locus_tag="XAC0033"
FT   CDS_pept        complement(39132..43604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="XAC0033"
FT                   /product="glutamate synthase alpha subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34925"
FT                   /db_xref="GOA:Q8PRD0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRD0"
FT                   /protein_id="AAM34925.1"
FT                   /translation="MAPRTRQGLNDDGLYNSVRDERDACGFGMVAQLDDQPSRALVDTA
FT                   IAALSRMTHRGGVAADGLTGDGCGLLIRKPDAFLRGLARDAGITLGTRYAAGVVFLPLD
FT                   EADAARCRAELEAQLHNAGVHFRGWRVVPTDDSVCGQLARDTLPRMEQVFVDAGAEQTE
FT                   DGFTLALFLARRRAEQALHAVEHFYVTTLSPNGISYKGMVLPDKLSTFYPDLQRSDLSS
FT                   SAIVFHQRFSTNTLPRWPLAHPFRLLAHNGEINTIEGNRRWAQARSKVWQTPRFDIAQF
FT                   DPVISMHGSDSQSLDNMLELLIAGGMDLLQALRILVPPATQSLEFKDADLAAFYEFYGL
FT                   NTEPWDGPAGIVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITR
FT                   KGKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELIDPSLVEEP
FT                   FSEQTLRSYHKLFQLSTEEVEQVLRPLAETEQEATGSMGDDTPMAVLSRQTRPLYDYFR
FT                   QAFAQVTNPPIDPLREGIAMSLTTQLGRETNIFHAGAETVNHVILNSPVLSQRKLRQLL
FT                   KMEQYVERNRLIDLSYSLEEGLKAGLERICQEVEAAARAGAVMLLLSDRYPVPDRPMAH
FT                   ALLATGAVHHHLCKVGLRCDVNLIIETGTARDPHHMACLLGVGATAVYPYLAYQTLFDL
FT                   GRRGILQLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLDPDV
FT                   VDLCFADTPARIGGVDLARLDTEARELTVRAWNDQLKPEVGGLLKYVHGGEYHMYNPDV
FT                   VMTLQRATRTGDAGDWQKYVDAVHARPASTLRDLVQLKRADTPTPLDDVAPAEDVLRRF
FT                   DSAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTEKRSKIKQVASGRFGV
FT                   TPEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYS
FT                   IEDLAQLIYDLKQVNPTALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPV
FT                   SSIRYAGVPWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGADSFGFGT
FT                   APMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVEHFFRLLAEEVRQWLSY
FT                   LGVRSLDEIVGRTDLLEQLDISPRPGVKVDLSRLLTHAQYDGSHCAAQRLYESPDSLAT
FT                   QMDGLLADAIANKSGGDHRFLIHNTDRSIGARLSGAIARAHGNHGMSDAPLNLRFRGTA
FT                   GQSFGAFNAGGLQLELEGEANDYVGKGMAGGRLVVRPPRGARFEARNTPIVGNTCLYGA
FT                   TGGELFAAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGG
FT                   LAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELTGSIWAQQILDE
FT                   FRDYIGKFWLVKPKAASIESLTESLRRAA"
FT   gene            complement(43807..44220)
FT                   /locus_tag="XAC0034"
FT   CDS_pept        complement(43807..44220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34926"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC9"
FT                   /protein_id="AAM34926.1"
FT                   /translation="MLARPPLLESSMRAVLPIARLACTLVVLTALTACNKPQPDEQEAV
FT                   TAKAQHAAEQASAPAPDAAPEAPPIGSCDATQVQSLVGQPLTDAVGEQARSDAGAKSVR
FT                   VLKPGQMTTMEFNGERLNLEVDAKNVISSVRCG"
FT   gene            44433..45521
FT                   /locus_tag="XAC0035"
FT   CDS_pept        44433..45521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34927"
FT                   /db_xref="GOA:Q8PRC8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC8"
FT                   /protein_id="AAM34927.1"
FT                   /translation="MASAAAVAQAKATARAAGLTYVNDQQPGISRRKAGKSFSYRDADG
FT                   QRIADAETLQRIRSLAIPPAYTEVWICAKPNGHLQATGRDARRRKQYRYHADWALVRGE
FT                   GKFERVIAFGTALPKLRRRLRRDLLLPGFPREKVLAIVVALLADTLVRVGNAEYARSNR
FT                   SYGLTTLRNRHMEFLKGGRARLKFRGKSGQDHDIEVDDKQLVKLIRQCQQLPGQSLFQY
FT                   RDDDGQLQPVDSGEVNDYLREAMGEDFTAKDFRTWGGTLAALQRLARLPLPERSSERAL
FT                   TQVQNDVIREVADALGNTPSVCRKAYIDPCVFEGWRAGQLQAMATGVRGERQWEAATLR
FT                   FLSASRSKLKAQAKPASKRKSA"
FT   gene            complement(45728..46072)
FT                   /locus_tag="XAC0036"
FT   CDS_pept        complement(45728..46072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34928"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC7"
FT                   /protein_id="AAM34928.1"
FT                   /translation="MIRILAPLAAAALLSACASNQVAQIQPIDGAISGQCHSDKVRGAV
FT                   GLAAAAQTIERARVDSDSQTVIVRRGERATGGTTASGLADPAQGASESGGDQLTIETGP
FT                   NNSITAIYCG"
FT   gene            46368..47507
FT                   /locus_tag="XAC0037"
FT   CDS_pept        46368..47507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0037"
FT                   /product="penicillin acylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34929"
FT                   /db_xref="GOA:Q8PRC6"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC6"
FT                   /protein_id="AAM34929.1"
FT                   /translation="MTAGAWRTSMQRPTTTRSSCKASMWRATAWFSWICCVAKAWATCR
FT                   KRSGQPMWRRIVPRGCFCISTALPWSENPKAGFITTSNEMNLPRDDPVAQRKLGFEWAN
FT                   DARHARIIQVLSQLPKPRLEDSEKLQNDQVSLPAQRLVALLQPLQSHDPDTSAALALLR
FT                   PWNGDASAASAAAALEEVWFSRYLGDAYKALRLRPSEAASFGAPDAAAMLDALEHPGAA
FT                   FGATPAARRDQLLLESLRNAYHALGSLQGPDTRQWQWGNLHTNKIAHAMSAVAGADRAL
FT                   LDVGPFAKGGSPYTPNQSSYDPADFRQTIGPSARLIIDLSNWDNARAMNFPGQSGDPAS
FT                   PHYRDLAPLWLNGSYFPLLYTRAAVDAATEQIFDLVPAQ"
FT   gene            complement(47588..48457)
FT                   /locus_tag="XAC0038"
FT   CDS_pept        complement(47588..48457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34930"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC5"
FT                   /protein_id="AAM34930.1"
FT                   /translation="MSILVTGATGTVGSLVTQGLADAGAQVKALVRQHGKRPFPAGVTE
FT                   VVADLTDVASMRAALASVRTLFLLNAVTPDEVTQALIALNLAKEAGVERIVYLSVIHAD
FT                   TYTNVPHFTGKHTVERMIESLEIPATILRPAYFMQNEGMVQQTITDYDVYPMPIGAQGI
FT                   AMIDARDIADIAVVELLRRDRADGPLPRVTLELVGPRALTGTDVAKVWSAALGREIAYA
FT                   GDDVAAFEAQLAKYGPPWLAYDMRLMMGGIQRFGMHAAEGTVAKLKAILGRPLRTYEDF
FT                   VREATAKA"
FT   gene            48629..49504
FT                   /locus_tag="XAC0039"
FT   CDS_pept        48629..49504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0039"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34931"
FT                   /db_xref="GOA:Q8PRC4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC4"
FT                   /protein_id="AAM34931.1"
FT                   /translation="MDLNALIDFALVAANQGLGKASRASGRSKATLSRRITELEEQLGV
FT                   RLVERSARGLKLTEAGQQLMARTEVPLSEVAEAMTAAREGLSTPRGRLRVASPVLFSQL
FT                   AMGRIGADFCAAYPEITLEVVAEDRTVDLVEEQFDVAIRINPRPDSSLVGRCFAKDRLV
FT                   VVAAPSIAMPSGDAMHPVPGVVMSSFQPTTWVLDDGRLALEPVPRMQFSSFLMVRDAVI
FT                   AGGGVALIPQSIAWEQLARGELLQWGTISGVEPALWVLHTSRRLAAPKVRAFVDFICAR
FT                   YPDMSLVLKG"
FT   gene            complement(49519..50031)
FT                   /locus_tag="XAC0040"
FT   CDS_pept        complement(49519..50031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0040"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34932"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC3"
FT                   /protein_id="AAM34932.1"
FT                   /translation="MLLVATSSVYPLPETAATEAISVATPTSIHAGCAVSSPKERVGHG
FT                   KNPSGRRSDQRQGRAWSNPLHCTTASRSTCRLCLSAHVGALAHSDMRAAAGQRRQPGGL
FT                   ARSQAMLSGSLADPAQGASENGSHQFIVGTGPNDRGPAMYRGHVVADGLAPHPCCRLDL
FT                   SILHRRS"
FT   gene            50146..51288
FT                   /gene="wbdB"
FT                   /locus_tag="XAC0041"
FT   CDS_pept        50146..51288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbdB"
FT                   /locus_tag="XAC0041"
FT                   /product="mannosyltransferase B"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34933"
FT                   /db_xref="GOA:Q8PRC2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC2"
FT                   /protein_id="AAM34933.1"
FT                   /translation="MHIILATESIRHPLTGVGRYTQELAAHLAALPQIESLQYLHGRRL
FT                   LQQRPSPGPASAAASWMRDRFSRIEVATDAYRRLSNLAKARALHGQRPALFHGCNYYLP
FT                   AYDGPSVATFHDISIYRWPQCHRADRVRYMRKELALAVQRAQLILTVSDFSRREIAAHF
FT                   ALPLERIRAIPLAADAAFRPHAQAELAAPLQALGLQTDAYCLCVSTIEPRKNIDVLLTA
FT                   YAALPAAVRARYPLVIAGHSGWSSEALHARMRSAEQAGWLRYLGYVPQDGLPALVAGAR
FT                   LFVFPSFYEGFGLPVLEAMASGTPVICASASSLPEVAADAAMLFDPADVSALTLALARG
FT                   IDDSDWREAARQTGLQRAAQFSWQRCAVATADAYRDVLAA"
FT   gene            51285..52457
FT                   /gene="wbpZ"
FT                   /locus_tag="XAC0042"
FT   CDS_pept        51285..52457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbpZ"
FT                   /locus_tag="XAC0042"
FT                   /product="glycosyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34934"
FT                   /db_xref="GOA:Q8PRC1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC1"
FT                   /protein_id="AAM34934.1"
FT                   /translation="MSLTSSPLRVLQVYKTSLPETMGGTEQVVRTLATQSHQHAVESEV
FT                   VTLCADGRLAGISVQGPYTLHRFRRDFEVASMPVSLRLLRQFAALARRFDLIHYHFPWP
FT                   FMDVLHLAGAARTPSVLTYHSDIVRQRRWLRLYRPLQQRFLERVDHIVATSPNYRATSP
FT                   VLANFQTKLSVIPIGLDPSSHYTPDAERARAWRTRLGPRFFLFVGVLRYYKGLQYLLQA
FT                   VRDTQIPVAIVGDGPEGARLRQQARQLGLSHVHFLGVLDDADKHALLSLCDGLVFPSHL
FT                   RSEAFGITLLEAAMHAKPMISCEIGTGTSFVNVAGQTGLVVAPADPVALCDAMRYLWNH
FT                   PQVADALGQEALRRYRQYFTGAAMVRSYAALYRQVHSAAGGAATLGEKQG"
FT   gene            52524..53933
FT                   /gene="wcaJ"
FT                   /locus_tag="XAC0043"
FT   CDS_pept        52524..53933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaJ"
FT                   /locus_tag="XAC0043"
FT                   /product="UDP-glucose lipid carrier transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34935"
FT                   /db_xref="GOA:Q8PRC0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRC0"
FT                   /protein_id="AAM34935.1"
FT                   /translation="MSALDPLLPRVAIAPRRSGDLLGSVAGLAKIADMGVVVGSGLLAY
FT                   AMRVGRPAWPEAPRYADALLAAAALTLLVFGRLSLYRQRPHLAATMVAGRVLTGWAIVL
FT                   SVLMSIGFLSATGAGFSRLWFLYWAGCGGAGLLCVRSAMKGALAWLHRHGIGRRRIALL
FT                   GPPERSDALVASVQQHPCAGVELVQVPSELALGGTAGLSCWLEARHVGEVWVTWPMREE
FT                   AQLRSSIAQLDACCVDACWIPDLFAFRPGESCLEEMTGLPMVALSVRPLTGLSRVLKEA
FT                   TERVLACAIVLASAPLMLALAAGVKLSGPGPVLFRQIRQGWDGRPFELWKFRSMQVHDA
FT                   ATAAPQTSRGDQRVTRFGAFLRRTSLDELPQFLNVLQGHMAIVGPRPHALAHNAQYQEL
FT                   VPNYLQRQRVKPGITGWAQVNGLRGETDTLEKMRSRVQHDLAYIQHWSLWLDMSIIAQT
FT                   CVIVLFDRDAY"
FT   gene            53953..55071
FT                   /gene="bplD"
FT                   /locus_tag="XAC0044"
FT   CDS_pept        53953..55071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bplD"
FT                   /locus_tag="XAC0044"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34936"
FT                   /db_xref="GOA:Q8PRB9"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB9"
FT                   /protein_id="AAM34936.1"
FT                   /translation="MHITYVLGTRPEIIKLASLIAASLRDGLNFSIVHTNQHYDEAMDR
FT                   VFFDELGLPPADYNLGVGSAPHGVQIGRMLCGIEPVLATLQPDVVVVQGDTNSALAGAM
FT                   AASKLEIAVAHVEAGLRSRDRSMPEEVNRVLIDHLSDYLFCPTALQAQILRDEGLTGAR
FT                   IRITGNTVADATLAHAQTALRRSTILQRLGLREGGYHLLTCHRRSNTEDPAHFAALMQA
FT                   VTSISEDQGLPLVFPMHPRLDALGSVAAARHRVLRAIGPVGYLDMLALQQGAALIMTDS
FT                   GGIQEEACILQRKCLVLRTNTERPETLQIGGAELPHGLDQDALRSAADRLLARSVAWRN
FT                   PFGDGHAFRCILDTLLARDEHPSASRPRLQHA"
FT   gene            complement(55159..56427)
FT                   /locus_tag="XAC0045"
FT   CDS_pept        complement(55159..56427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0045"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34937"
FT                   /db_xref="GOA:Q8PRB8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB8"
FT                   /protein_id="AAM34937.1"
FT                   /translation="MTAGAPARQPAQTGLVAVCLGLYLLFCLQQVVLTGRYFGVGLSLG
FT                   SMAIRGVALGLSAWALWRHGVPACLRWPLLSILLCMTALAASVLASDHSALAFKYAVRY
FT                   ATALLWLWALLNLAVAWPQWPRAAALAALIAVWINLALGMAVRLQWPPALEWSLAFHAQ
FT                   GSFKYLPRVSGMYDHPALLAATAVIVGLLTIQLYQRHAVGRAQLAAAVLAAIGALALSE
FT                   VRNPLLPVAGLILWWAWSRRAGERPRRRTVWAAALGLLAVAGFVLWQRYAEMTSAVHES
FT                   PLTAFSLGRTYLWSGAIEAWRSHPWFGLGAGVFQFLVPDYTGGRFDRGELHAHNGLLAV
FT                   LSETGLCGLLACVCMLWALWAPLLRNPAERGWALIWLLFLLGLNVFDFYPLFYPFSLHA
FT                   ALAVALLYAHHVELNGAPKSGMS"
FT   gene            complement(56424..57200)
FT                   /gene="rffM"
FT                   /locus_tag="XAC0046"
FT   CDS_pept        complement(56424..57200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffM"
FT                   /locus_tag="XAC0046"
FT                   /product="UDP-N-acetyl-D-mannosamine transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34938"
FT                   /db_xref="GOA:Q8PRB7"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB7"
FT                   /protein_id="AAM34938.1"
FT                   /translation="MTTSPARLSFLGCPLDLLPPEQILLRAQHAAEGGAPIRVEGLNVA
FT                   KLIDARAQLRQALEQAEVVHIDGAGISLGVRWFGVDVPPRRAGIDLMQDMCGQAARSGA
FT                   GVYLLGARPAVVAAAAERLCTHWPGLHIAGMRDGYFSDAEEDAVIAAIRQSGARYLFIG
FT                   ISSPKKELLLEKHWQTLGVPVAMGVGGSFDVLSGMLPRAPRLMQRCGMEWLFRLALEPR
FT                   RLAWRYLRTNAAYLLLLLRARLSRRYRARALTTWPT"
FT   gene            complement(57197..58276)
FT                   /locus_tag="XAC0047"
FT   CDS_pept        complement(57197..58276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0047"
FT                   /product="galactosyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34939"
FT                   /db_xref="GOA:Q8PRB6"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB6"
FT                   /protein_id="AAM34939.1"
FT                   /translation="MRILHVYKDFAPHSGGGGVARHIHGLAVTLADAGHTLRIVAPLAE
FT                   DGISPHGYTVVRATASQLWHHVGWADVVHVHGARTPIAAIAGALARLRGKRVIYTPHCY
FT                   YDDDLAASKRARKWCWDRLIEKPLLQSAQPTVLLSAYWQQYLSQRRLPPKRALLLPNAV
FT                   LAAEQCLPATSRQPLLGAPALLSVGRLDAVKRLQDAIAALTQPNMDAAVLHVVGRGPDR
FT                   ARLEACAVALGVAARVHFHGFVSDAEVAAMAAQADVFVLPSAVEGMPTVLIEMLLHGCP
FT                   VVASDIPGNRSILAQIGLQAALHRLGDSAALAGCIRVQRQQRIGPERIARVRADFTWEG
FT                   LRAQVLALYDAQVVKEPAT"
FT   gene            complement(58280..59671)
FT                   /locus_tag="XAC0048"
FT   CDS_pept        complement(58280..59671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0048"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34940"
FT                   /db_xref="GOA:Q8PRB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB5"
FT                   /protein_id="AAM34940.1"
FT                   /translation="MAAADLRGRCAMAAPSGSDPVKRAYLLLAVLLAIHLGDLLVAWLY
FT                   HGGALPAAALLRPMRDGTLIVLAAIALATVRMPRALLAIILVFGMIGLAYAPVGYAHGL
FT                   PAGIVVGSLGTLLLPMLLVLAGYWCMPHPHDVRRGARWLVWLGIVSALFGAWDLAHTDF
FT                   WVQTVRLPDYLAEVKGVLPKDTDPDTGLPWNFFGGEDYARRAGGLVAAPLAQGQFLITA
FT                   ALAALGLWQRRWPWRALLTCLGLLVGVWMSGTRGAMLAGIVGVLGYLVSSRGLVRSPWA
FT                   RLLLVGGIAAMLAAASYGIVVTSVNFRDGSTIGHWYALQRNLADLHQVVLWGGGLGRQG
FT                   AVAARQALTDLGGGEGAIFTIAYQMGLPTALLFLGFIGWSLRALWRAYRQRDNHLALAM
FT                   FWLLCGMATTLISSDNAMTVSGAGGFWLLLGGALRHCQCPLPTRRAIVRTRRDHTAPAA
FT                   GMAAG"
FT   gene            complement(59608..60900)
FT                   /locus_tag="XAC0049"
FT   CDS_pept        complement(59608..60900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0049"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34941"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB4"
FT                   /protein_id="AAM34941.1"
FT                   /translation="MATASCARTRCTMDFADFQQAVHAQFGAEAAAVRHEIYFLTRRRG
FT                   AGLRAALAVLRDAWLCLRLPQRPPVLSEWTALATLPGSNGWGALAPYLADLQRQGAACT
FT                   VLIHPRLRGSVEGQLPARPTWAGWQAALRALALRRTPLGPAVASLWIVRACVLRQRLWH
FT                   GAWQRTLGAAPAGATLLLHNDFDMYAAAALHAAGDGWRSVCVQHGLPTDEFFPVRARHH
FT                   LLWGPSSAQVYRKHGVAPAAIGYGPAMALTDLDTATVPTTLYLMSQSHTPIYGPTLAAH
FT                   LLALAHALPALEADGVAVRILLHPEEVRGTHPYAEPALQRRCQAPPHAILEADAGPALV
FT                   VGFCSTALLQAACRGHYVIGMAWPASASHDALAVGRPAHQVADADALAALVRALRSDAG
FT                   ARARFAAQQRHWLQQTFAADARWPHHLEATP"
FT   gene            complement(60851..61633)
FT                   /locus_tag="XAC0050"
FT   CDS_pept        complement(60851..61633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34942"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB3"
FT                   /protein_id="AAM34942.1"
FT                   /translation="MGSQRRFFAWRGDRWIAHNRLQRIAPALAPAARVLEVGSGFGAFL
FT                   GAAAATRPDLRLSACEPDVTHRHVLLDGAAVTFLPALDTLADGEFEAVVAFHVLEHLTD
FT                   PRAFLSSLARILVPEGQAWIEVPDLMSGWRSRNYVHPAHLSYFSAPLLRRLANAAGLEV
FT                   VSCGPYSDRGVLAGNIWLHLRQPAQPHAAASLALADSHEVDAVDARLDMVRWSRRDRLQ
FT                   RRLKHGLIRVLGRGLFGELQRWRGYRQLRKDQVHDGLR"
FT   gene            complement(61865..63706)
FT                   /gene="asnB"
FT                   /locus_tag="XAC0051"
FT   CDS_pept        complement(61865..63706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="XAC0051"
FT                   /product="asparagine synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34943"
FT                   /db_xref="GOA:Q8PRB2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB2"
FT                   /protein_id="AAM34943.1"
FT                   /translation="MCGIVALRSFVAEAPLQALAERALDALSRRGPDAQGLLCLEQPVP
FT                   TALGHRRLAILDLSAAATQPMRCAETGNVLVFNGEIYNFLELRRELEGLGHQFRTDSDT
FT                   EVILHGWRAWGEGLFPRCNGMWALVLLEQASGDLIYCRDRLGVKPLYLHHDGRQLVLAS
FT                   EIRAIAASLGGYPPPNPAAVFDFLVTGLSDHTSDTFYAGIRAVPPGWLYRVSPAGHSRR
FT                   TPYHQWPLPGAVAPLDAQATMELLEDSTRLRLRSDAPTVSLLSGGLDSSILTTLSVQAG
FT                   ALPRTCFAGAFTYGYDDTEQAGFDETEAAASLMQTLGQSERHFVHRARAIPDEEELLAL
FT                   VAAQEEPFCTPSILASFRMYRAIRAAGYKVVLNGEGADELFGGYVRLYLALSARSALHQ
FT                   ARLPTAIRLLSTGAVDPRLLLNRLAWDLPAGALGALLRRQRPSVACMSSALWHDQAARL
FT                   QSLQVDRRVDIEARLRRDVLSTNLPMVLRMTDRNSMSAGIEVRAPFLDYRVVERALSTP
FT                   ALQRMGDYHGKAMLRHAFAERLPARVTTQRKSTGFGHAEQFLVDRMPLQQALATLPEGV
FT                   NELLNVARLRREFASGRSHSTLWFAVSVALWYRSVYA"
FT   gene            complement(63759..65141)
FT                   /locus_tag="XAC0052"
FT   CDS_pept        complement(63759..65141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0052"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34944"
FT                   /db_xref="GOA:Q8PRB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB1"
FT                   /protein_id="AAM34944.1"
FT                   /translation="MPCTDACIRRAAMIAAQRMRAGFVAGAVLYALGQGCALLFQWPLL
FT                   RRFGLQGYGDVGLAHLGLVTVLFLADLGYASLFLREDPAAPGWNARWRQALWHRLLATL
FT                   VLDLLWIAGVWWSGRGQGEGFRYLLAALSATVFGLVGYSAPLLARGRMLAGFIVQQVAM
FT                   PATILAWFVLQQLPGWDGGLGAGLAVSLGYLLQALVNIAVFGAPLQLLWPRRGGGRRML
FT                   RPALQLSLLSIAGTLHDRLTPLLLASVAPAFLPVYLFLNYLLNGASGVFNQFNRLLVAD
FT                   ARGPAGEHWAGALVSLVLGAAAVGALALLVVAAAWGSAEQRAWLPWVTPVLAAGATTLL
FT                   SSVLAALLIGRHREATMVPLLLGGALCSALLQVAAAAAHAPQWMLWLRFLCVLAMAAAS
FT                   LHLCGLRLNAGGYAALLSAVLAVSLGGGPVTMTLAALLLVPVAWTVWQRRSLLHTTLSA
FT                   RA"
FT   gene            complement(65102..65941)
FT                   /locus_tag="XAC0053"
FT   CDS_pept        complement(65102..65941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0053"
FT                   /product="methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34945"
FT                   /db_xref="GOA:Q8PRB0"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRB0"
FT                   /protein_id="AAM34945.1"
FT                   /translation="MSVWKVLPAIALARPQPGYSHCGLPVLAKVSGLSATTIERLKFAY
FT                   RRLRVGANLHRNDALGALFRAWAYTHATQLTGDYYEFGVYRGNSLAHAWLCYRHHRRHL
FT                   ERSARLPYRRQGTVSAFLAQRPRFYGFDTFAGMPANLEGEDSLAGGSFLASLAQAQARC
FT                   AAVGLKAPDLQLVQGLFADNAAAIGHTHAAIVHVDCDLYSSAHDALTLIAPRLVQGSVL
FT                   LCDDYDLFRADNRQGERRALQECADHVGIAFEPWFAYGAASRAFLCHVPTPASAAQP"
FT   gene            complement(66191..67147)
FT                   /gene="rmd"
FT                   /locus_tag="XAC0054"
FT   CDS_pept        complement(66191..67147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmd"
FT                   /locus_tag="XAC0054"
FT                   /product="degenerated UDP-glucose epimerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34946"
FT                   /db_xref="GOA:Q8PRA9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA9"
FT                   /protein_id="AAM34946.1"
FT                   /translation="MMRVLVTGAAGMIGRRVASALLQRGDAVAGLDDLSSGMSLPHGLH
FT                   AAIVADVGERETVAVALREFRADALIHLAAIHHIPTCETQRMRCLQVNVVGTESVLHAA
FT                   SDAALRQVVIASSGAVYAWGDGALDEHVSATDARDNYALSKLCNEAQLRLWCAAANGRR
FT                   GRAARLFNTIAHDDPNAHLIPDVLAQLAADPAATPTLRLGNLQPCRDYLHADDAAAGLI
FT                   ALLDDARPDPAFDVFNLCSGVEHSVAELVEQIGAVLGRSPRLEVDPQRQRRIDRLHQLG
FT                   DPGKAARVLGWRARWSLREALQRVLGVTDAPTAGQHA"
FT   gene            complement(67144..68472)
FT                   /locus_tag="XAC0055"
FT   CDS_pept        complement(67144..68472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0055"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34947"
FT                   /db_xref="GOA:Q8PRA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA8"
FT                   /protein_id="AAM34947.1"
FT                   /translation="MLAIRRGASMPPLNRSDDLMPGIDEIPERRDEVSLGDLLLEVLRF
FT                   YQQFGRLLIPLAVLCGVLAGVVVATRPLYAVTALLETPQMSLEQWRKLQPMLADRQLVA
FT                   ASLASMTELPPEQRERLQRAFVLKKYWDTRVTYRSAVERDDIRQQVNIDAKSVGALGLE
FT                   VSLYARDDAAANQQLDAIAQHVRQVVLWGGLRDYLDSLRQQTLEQRPQLQIDQIQQRYA
FT                   IEQNERQAADMQQLLERYPELRRNEVNTVVSVGDGGGRYLSPLAQIVALQSTIAGTRTT
FT                   LRQVERELEQLDGKQRFLARVDQRAPGLHLGRALADWVQSCRRAVFGSGTPSGSALSQV
FT                   ASEIDLALSQQRWRAQLVRYRAIPALSPAPVPSRRPALVALAVFLGVLLVASLGLAMYV
FT                   IARRNGDRHASWSAHADPLFAWLPQRMRGLLLGPTDARPLGSG"
FT   gene            complement(68506..69735)
FT                   /locus_tag="XAC0056"
FT   CDS_pept        complement(68506..69735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0056"
FT                   /product="polysaccharide export protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34948"
FT                   /db_xref="GOA:Q8PRA7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA7"
FT                   /protein_id="AAM34948.1"
FT                   /translation="MTPHLSPAWRGLVRGLSAQWLSILFTAAVSLALSVWLARGMGPAG
FT                   FGRYAYLLNLATLLALLQDAGMRTLVLREGVAAGIPATLARALPGLARGHLLWSTLLLV
FT                   AATLAATRAGSDPALVWAVLCFGAVTLTQLVSAQLKAAGQWQRDASWLAGARALSALLV
FT                   VTAVLLLGHAPGVVFAAWAGGLLLAYVWLGRGLHERPHWRPQPLAYRAAAGFFWIDTAT
FT                   GLYRRSDVVILQHTVPAAEVGQYAAAYRVFDGVLLLAMPVALLLFRQLRLARAQAGRAR
FT                   RLEDRALWLAAAAGLALAASGAWLGNWLMELLYGASYRAVAGQLLGWLFAAFVFVLPNY
FT                   VLTQAAIACDQQRWYVLGASVAAVVNIALNLLLTRRYGVHGAAIAVIATEAVLTATLWC
FT                   GLRTAGRARA"
FT   gene            complement(69732..71480)
FT                   /gene="hetA"
FT                   /locus_tag="XAC0057"
FT   CDS_pept        complement(69732..71480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hetA"
FT                   /locus_tag="XAC0057"
FT                   /product="transport protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34949"
FT                   /db_xref="GOA:Q8PRA6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA6"
FT                   /protein_id="AAM34949.1"
FT                   /translation="MRVVHGMARLLRWAPGRQRLGLFVLMVLAGATEGIGMLLLVPLLG
FT                   ALQGDAAATDGLAGQLLRVPIALGLPTSSPIPLLLLFCTVVLVRTAIQLGRERAAAQLQ
FT                   QDVGERLRMASFAALLGAQWRWLVGQRTADHASLMLSDVSRAEVGLGQGLALLAAGTTA
FT                   LLYLLAAIALSWQLALVALLSGAVLLLSTDQRRRGTVVLGRQLTQANQRLHAGLHDRLS
FT                   GLRLAKILGAEARHLAAFGRTARAMHDQQLRFAHGLSSSKALLHGAGAVLLACYVYAGL
FT                   QLLHMAMAELLVLVAIFARLLPLVSNIQQQRQYCLHAMAAFDEIEGRLQESRTWAEPPL
FT                   PEATPPIRLTASIALSAVQIQYPGRGTPALQDLSLLLPARTTTAVVGASGAGKSTLADV
FT                   LSGLLGPDQGTLEIDGVALDAAARRAWRRSVAYVSQDAFLLNDSVRNNLLIACPDASEQ
FT                   ALHAALEQAAAQFVHALPQGWDTPVGEGGMPLSGGERQRLALARALLQRPALLILDEAT
FT                   SALDHDNETRIRSAIQGLHGELTVLLIGHRLALLEQADTVLVLDQGRLVAQGPCQAVAP
FT                   IWIGAR"
FT   gene            complement(71477..71965)
FT                   /locus_tag="XAC0058"
FT   CDS_pept        complement(71477..71965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0058"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34950"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA5"
FT                   /protein_id="AAM34950.1"
FT                   /translation="MPRLLVRGCRMLAAVGRLPRFERLLLVPAWVLLGLVRAAVRWLGF
FT                   RRLAPWLGDQVSVPPALPGLDARAERRALQIGRTVRLAARYTYWDSNCLAQALAAHYLL
FT                   GLFRVAHLLCLGVTRSDDGAQLQAHAWVLAGSARVTGGRASERFTRVGCFVPRARQAR"
FT   gene            complement(72303..74228)
FT                   /gene="asn"
FT                   /locus_tag="XAC0059"
FT   CDS_pept        complement(72303..74228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asn"
FT                   /locus_tag="XAC0059"
FT                   /product="asparagine synthetase like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34951"
FT                   /db_xref="GOA:Q8PRA4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA4"
FT                   /protein_id="AAM34951.1"
FT                   /translation="MSDFAGVWRLDGAPVAPGDIQRLGQALDARGIGPVRVWQDGPVAI
FT                   VHRQHVFTPQDADEAMPWVGASGAVLAADVRLAARQELASALQHPANVTLPDGVLLLEA
FT                   LQCWDTAALPRLHGCYALALYRPDRHRLLLARDPIGLRSLFVHRGPHLIAFATRLRALL
FT                   ALPQVPKDLDERALADKLIMDRARPERTIYRAIDRVPMAHAVVLTPEATHCQRWWSPPE
FT                   AGSLRLRNDAEVEAAAAEVLDRAVADALRARGPVATCLTGGLDSGSITLSAARQQAPSP
FT                   LLVLTRQPLPATAAATATHYYDESPRARRLAASHPGIDWHLVGDDDADWGEHDPACWWR
FT                   EGAQPVRSPSNMAWFFPLYRFLHARGSQVMLGGELGNAFFSYDGLLRLPQLARQRQWRV
FT                   LAGQVGALAGSLGLSRRKTVQRYLLRPFAPVALLRLWHGLPAAVWEAQAALQPALAQSL
FT                   GMQQSLDRSRYRLRLGGGHTSLPTFREWMLGDAGPMDLVNTLRAVSGVDTRYPLADRRV
FT                   IEFFGSLPLDQFLRDGVSRSLPRRLLAARGAPPEIHANRAVGVQQGDWFARLNAQRDAL
FT                   HAQLSQARTSPLANRVVDLQRLQALLDHWPQDAAAAEARRFEYLQLLASGLQMAGFLAW
FT                   HERGGA"
FT   gene            74626..75426
FT                   /locus_tag="XAC0060"
FT   CDS_pept        74626..75426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0060"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34952"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA3"
FT                   /protein_id="AAM34952.1"
FT                   /translation="MLKSALRSVLLHAPRIGQMTIQRSRWRSLLPIPVAVRLLYRALRS
FT                   RQGRGYARLQLSSPVPLFQDHATTSMDRYPALFGFVQQTLGADSQARLLSFGCASGEEV
FT                   FSLRSYFPKAMITGLDIHPDAIRACYRHLGARPDTGLGFRVAGNTAEEGDGSYDAIFCL
FT                   AVLRRGDLAAHRGDRCDHLIRFEDVQAQLLDFVRCLRPGGLLVLRHANFRLRDTEAARW
FT                   FDTVLCLPTPARADTPLFGPDNRRLPVQADEQSVFRRRATAWPP"
FT   gene            75448..75774
FT                   /locus_tag="XAC0061"
FT   CDS_pept        75448..75774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34953"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA2"
FT                   /protein_id="AAM34953.1"
FT                   /translation="MHPGKLLFPYRLGPWMRIAPSTIVARTSGCLAAEMGDELVLMSTE
FT                   HGLYLSLDAIGKNIWSHLDPPCAFATLCDRLSAEYSAPRATIETDVTAMLHTLRDAGAV
FT                   EMRA"
FT   gene            75798..76718
FT                   /locus_tag="XAC0062"
FT   CDS_pept        75798..76718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34954"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA1"
FT                   /protein_id="AAM34954.1"
FT                   /translation="MPTTQLHHHYVLCGWHVRSALTLPELPPWSATATPVDADVVIEEG
FT                   EVPDRLDLHDPVESWLSVGRDGSVLLQVPQVVRIHVHAGRAMRVQRLNRHDESWRLFLL
FT                   GSALGYLCLQRSLFPLHAACLRIGTQTVAFAGHSGAGKSTLAAALLKRGHGLLSDDLTV
FT                   IRLDSAGAIMVLPAFPRLKLWRDTLESLQLPVTDAPPVRPGMEKFDLRPSAGFDAAPVR
FT                   LDAVVVLGDASEPHLQRLSPQHALPLLHGYLARPQAAVRMGLHAATFAHAAAIARQVPV
FT                   WRLRRPRRFDALDITVDLIEAHVGA"
FT   gene            76715..77539
FT                   /locus_tag="XAC0063"
FT   CDS_pept        76715..77539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0063"
FT                   /product="aryl sulfotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34955"
FT                   /db_xref="GOA:Q8PRA0"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PRA0"
FT                   /protein_id="AAM34955.1"
FT                   /translation="MSRRGIVWLASYPKSGNTWVRCLIASLRSGAAAMQLEELAPALPN
FT                   AASRAWLERHLDVDIGDLTPDELHLLRGTAYRRCAMQASSVLKVHDRYDAALFPAVATL
FT                   GIVYIVRDPRDVAPSWADHAGIDLDAAIGQLGQSATTVSSTLSRYRPQARQRFGSWSEH
FT                   VASWLHAPGPRLLLRYEDLLDNPLRETARLAGFLGLSTQPVQIAQAVAACRFEALRDSE
FT                   ERHGFAERQHGQARFFRQGRAGAWRSALSAAQAARVRAQHGPTMAWLGYRDA"
FT   gene            complement(77555..78121)
FT                   /locus_tag="XAC0064"
FT   CDS_pept        complement(77555..78121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0064"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34956"
FT                   /db_xref="GOA:Q8PR99"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR99"
FT                   /protein_id="AAM34956.1"
FT                   /translation="MHLRYRRHLPAKAVILLRFACPASLVARGMAIRAEHEADLPTLRA
FT                   LFRTQRWAEFALLPWDDAAREAFIDQQFDAQRRHYILGQEQVLFLVVTEGDHVIGRLYL
FT                   GGDAATTVCLLDILLLACRRGQGIGTALIEALVAQVTRDGRNVVLQVDKHNPALELYRR
FT                   LGFRAYDETGVAWKMAWSHGVSHAR"
FT   gene            complement(78079..78666)
FT                   /locus_tag="XAC0065"
FT   CDS_pept        complement(78079..78666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0065"
FT                   /product="microcystin dependent protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34957"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR98"
FT                   /protein_id="AAM34957.1"
FT                   /translation="MSNSFIGEVRAFPYNFAPEGWLDCMGQTVSINQYQALFGVIGFAY
FT                   GGDKQTTFGLPDLRGRAVTGQGQGPGLSNYTIGQLQGTDSVALVSSTQLPAHTHSITTM
FT                   FLPPATAPGAAVNTPSSSSYLSRLLNPTTSPPTSYKAYAPATTTPMVQLSPNALAPFPS
FT                   GSQAVQAHENRQPFTTIRYCICATDGIYPPRP"
FT   gene            complement(78691..79242)
FT                   /locus_tag="XAC0066"
FT   CDS_pept        complement(78691..79242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0066"
FT                   /product="microcystin dependent protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34958"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR97"
FT                   /protein_id="AAM34958.1"
FT                   /translation="MDAYTGQIILFAGNYEPQGWAFCDGRQLQINTYMALYSLIGTTYG
FT                   GDGRTTFNLPDLRGRVAISQGQGIARAPTPQLTARVLGQQFGTETVSLQLAEMPAHRHT
FT                   LQAFNSPASSLTPTGQLPAVTQGGNTGYLTPPAGSTPAASTLATNAVNVAGASQPHDNH
FT                   MATQTLSYLICLNGFYPQRP"
FT   gene            complement(79267..79791)
FT                   /gene="mdpB"
FT                   /locus_tag="XAC0067"
FT   CDS_pept        complement(79267..79791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdpB"
FT                   /locus_tag="XAC0067"
FT                   /product="microcystin dependent protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34959"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR96"
FT                   /protein_id="AAM34959.1"
FT                   /translation="MGEIRLFPIDWAPAGWLPCDGRTLPITSNVALASLLGTQFGGDGK
FT                   TTFNLPDLRGRTPVSQGVNPLTTPPVSYTVGTYGGLEGVALTATQVPPHTHMVNAVAAA
FT                   ATTAAVASNANVLHAETPTPQFLYAPTGALIPLAGDSVSQEGAGAAHNNMQPSLVLNFC
FT                   ICTVGIYPQRP"
FT   gene            80281..81369
FT                   /locus_tag="XAC0068"
FT   CDS_pept        80281..81369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0068"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34960"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR95"
FT                   /protein_id="AAM34960.1"
FT                   /translation="MATPPDAVAFERSLAQHRMALALPAADTLGPSIPVALRQALRRRQ
FT                   RRLLLQSLQQTAAIGELVTALQQAGIRCCLLKGLGYVAQFGRLHRREACDIDVLIEPQA
FT                   SQQALSALAALGYVLQSDAACDPVEYCRYNHALPLRHRDTGVVLELHLRLANHERQFPL
FT                   GQQIWRDHLGTVELGGVHVPTLSPPAAVVYAAFHGTKHHWHRAFWLVDMAHAMGSAELD
FT                   WEAVLALARRLGVERQLALSALLAEASLGIALPAALRQQTALLRKARPVAAALLPCLDA
FT                   LGSDRGADLAVRLGLFAYLRHLLSLQSTWRGRLHVLPVLLVPTDMDRQAVPLPRALHWA
FT                   YFGVRMFRLVKQHLLKRRQMQG"
FT   gene            81857..82243
FT                   /gene="mecI"
FT                   /locus_tag="XAC0069"
FT   CDS_pept        81857..82243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecI"
FT                   /locus_tag="XAC0069"
FT                   /product="methicillin resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34961"
FT                   /db_xref="GOA:Q8PR94"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR94"
FT                   /protein_id="AAM34961.1"
FT                   /translation="MRGKTIGDQELALLQYIEEQRHASVGEVAAAFGEPRGLARSTVLT
FT                   MMERLRAKGFLRRKQVDGVYRYSATAGQDDVVRGAVGQFVEKTLQGSVSPFVAWMSQRA
FT                   EVSDTELAELEALVAKLQSQRKED"
FT   gene            82247..83968
FT                   /locus_tag="XAC0070"
FT   CDS_pept        82247..83968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0070"
FT                   /product="ankyrin-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34962"
FT                   /db_xref="GOA:Q8PR93"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR93"
FT                   /protein_id="AAM34962.1"
FT                   /translation="MSPLIEAVLWKLGATSVQTAVLVLVVWALCRGVRRLPAATQTWLW
FT                   WLVGVQAMVGLVWSNPVQLPVLPAHSVTSALGSADSLAPLANATAAASTAAHAGATAQA
FT                   MQAGAWSTWPVVLLALWAAGVLVLAAGTARAYLRSRALVRVAQPCNDKALVQALQMAAE
FT                   AHGLSRPPALRLSAQIDSPLLIGPWQPVLLLPAARLPHMADDDLDMALTHELIHLRRRD
FT                   LWWGLLPALAQHLFFFHPLVHLAVREYAIAREAACDAAVVAGHRHCRHDYGRLLLQLGV
FT                   APRPRGGVASASPSFISLKRRLSMLQDTHAFPRLAAAMILAAVAVCGVLPLRLVAMPVP
FT                   APVTSAGMQPVVVTAPPAPRAQVSSTAEAADAAAPMRALPAPALPAAPAEAAAPATHGV
FT                   IVDVLGAEPLHDEDADPMDSGWNLDLDRIRRDASRDAQAAVHDAFAADNHDLERQQDRM
FT                   QAAQDALQEAREQLASLGPELAQAKQEAQQQAREAQQQIRDVAQQHRQAQYAYAAAVRQ
FT                   ADALSRHQVELAKQAALQGRAEARRGQREAAQAQVEAEKAQAEADQAQAEAERANN"
FT   gene            84643..85683
FT                   /locus_tag="XAC0071"
FT   CDS_pept        84643..85683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34963"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR92"
FT                   /protein_id="AAM34963.1"
FT                   /translation="MIQTTSPVLCLRSALLVALAAVAGSAAIVHASAVPAVAGVRTSPA
FT                   APVFAGFATPSTTQAAPIADVVRVGGIATPAVTPEMNFARTAPVVAALRAPATTPLAAT
FT                   TPTAPALAIAGAARAAPAAPPANAGPAGPAAPAISPATPVAPTAAAAPARPRVGTHESC
FT                   GHATANTQSQGDAYVLVHGEGEVMHGTPDDLHTARRYAGDGRRVLWFRADGKQYLVRDP
FT                   TLLHQLAVAYLRSQQLADAQARLAARQQALSERQAALAAQLSAHAEPRLLQASTRTASA
FT                   TTSTAAQPPATPDALQALARQQQALAQRQAVLASKQAGASRLATQQALKVLREALRSGL
FT                   ATRIDG"
FT   gene            85767..86897
FT                   /locus_tag="XAC0072"
FT   CDS_pept        85767..86897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34964"
FT                   /db_xref="GOA:Q8PR91"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR91"
FT                   /protein_id="AAM34964.1"
FT                   /translation="MTYRVVVLGGFGHFGARIVRALAATAQIHVIAAGRRPGDAATTWP
FT                   GVAPGRISTCRLDIDASDFSAQLAATGADAVVHTAGPFQGQQYAVARCCLQAGMHYIDL
FT                   ADGRAFVRDFAAAMDPAARQAQRVAISGASTLPALSSAVIDALLPRFSALHEIGIVIAP
FT                   AQGTPLGLATVRAVLSYCGTPFNWWQAGRWQQVVGWARPTRVQFAQLAPRLASPCDVPD
FT                   HDLLPQRYPGVQTVQFRAALEVPFLQRCLAGVAWLRRRGVPLPMQRLADVFANAGRWFD
FT                   RFGTDLGGMRVELRGTCDGRDGTSRPLVLHWDLTAAMLHGPEIPCFAAVLLIRKLAAGH
FT                   RLPIGAHACMGLLTLAEFEQEFAAWQMSTAVTQAHR"
FT   gene            complement(87037..87822)
FT                   /locus_tag="XAC0073"
FT   CDS_pept        complement(87037..87822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34965"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012390"
FT                   /db_xref="InterPro:IPR015069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR90"
FT                   /protein_id="AAM34965.1"
FT                   /translation="MSSFLDTRISRRHLMAATGASLLTTGLPTRAMTPPPSDVGRKFLR
FT                   SRRPMPFAGNTFVGHLEQQGDGYDSFDRVLNIYRQFPEQRFAHKFAVLPPSSYHVTLLG
FT                   GVNEIDRARGPWPSDLPRDHALADINVAYLARLKERAAPPLGACRFLVNPTAVRTGNND
FT                   NLLIPLKPVDTQTAQRLEAARQALMQLTRLQRPDYTNFQFHISLAYLCDTLDAAEQTAY
FT                   RTAVRGWLTQLAAAGPITVPRFHFCTFNDMDAFRTVLEV"
FT   gene            complement(87833..90448)
FT                   /gene="cirA"
FT                   /locus_tag="XAC0074"
FT   CDS_pept        complement(87833..90448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="XAC0074"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34966"
FT                   /db_xref="GOA:Q8PR89"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR89"
FT                   /protein_id="AAM34966.1"
FT                   /translation="MSRPPHPHALSLALGLALIAWLPWQSTAADMSGGADALTMDAVQV
FT                   RNPFQSQNTRAIATKQAAPTIVDSVAADSIGQLPDFNVGDALRRVTGVSTVEYQGEPRY
FT                   VTVRGLNGNYNSMLIDGFAFASNDIGSRQALMDVLPANFVDRIDVVKSLLPENDGGAIG
FT                   GVTDLVTATGFARPDGLLTASAKGGANLMGSRYGGRTPVGEGELKWGKRFGRDGQFAFL
FT                   GAASIWRREISVPQQENGGALNWYNADGTRAPSAYGGTGAAVPSERRWYNYDNTRERRG
FT                   VTARVDWQPDGPLSGHVSGYTFNQHEASDRNAQVAQVQNSARLTRSGAQSGTLDNLNQL
FT                   VELGQLRWKRGLSGINGELLAELPGQWRGALRASTSRATVDNPQTWDRFQQNRLAYGFD
FT                   WNGTLPAFTALDPALADDPTRYANLNHQQERTTYAERVSDLQLELRRNMDEDSRGLGLA
FT                   FGLRQVRTHMQTAFQRTTWSGLPYSLADVLGDPTCALGCNAPMWTIDPDLADARWDAAS
FT                   GQARGVADITAQNSGTYTVDEQVRAGFAQAQWRGERWRLAGGVRLEQTRFGSSGQQLSG
FT                   TVWAPVSAQRTYRNWLPSLAGQVQTSANGTLRFGASRSIGRPRLDQMALNGGVLALGSN
FT                   PPTLNQGNPDLQPRRSQNLDLGHDWTFDDGGSLLSIALFHKTIDNEIFRYGQLQNIDGE
FT                   QVLVTQPRNTDRPVRMRGAELGAIKELGPWLPALAGLSVGANVTFLDVDYPVVLGDGSR
FT                   TTLSVLPQQPKQLWNLTLNYARGPLRGTLAWSRTGELWDDRYPNYSNQQEFYRNRYQQP
FT                   LDRLDLKLAWDVSPAVAVSLDVLNLTGQGYEYRIGRHQEYVQSAWKMAPTVMLGVNVKL
FT                   "
FT   gene            90593..91750
FT                   /gene="xylR"
FT                   /locus_tag="XAC0075"
FT   CDS_pept        90593..91750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="XAC0075"
FT                   /product="xylose repressor-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34967"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR88"
FT                   /protein_id="AAM34967.1"
FT                   /translation="MPSLFANAAIRSHYRRRSDGQAAGSSERLLLDLIRRAGQFERADL
FT                   PRASGLSVPGIKGIVDPLVAHGLLQLRPSLRRGRGQPSAQVSLVPGYAYSVGVSVMVDG
FT                   FAVVLIDFAGQVRGMRQLTAFPLTLAVVRARLPALVEALLRTAGVDRQHVFGVGLSMTG
FT                   PRIGDGTRVNPPLSLAAEWMQVELDRFVADCLQLPVWMDNDAHCAALAEAVYGIGRQSP
FT                   DLVYLSISDGFAAGVIAAGNVRRGAHGNVGELGRISAITGMARPTLESLRQALVADGHA
FT                   LPDLYTMLQHYDAAWPQIDAWLDAVQPTVTLAVAAIIALIDPRVIVFGARLPTDLAQRL
FT                   IARIAFEPAPRRGVALPYPTLQVGQVTAHATVLGAAMLPFKETLF"
FT   gene            91940..94084
FT                   /gene="avrBs2"
FT                   /locus_tag="XAC0076"
FT   CDS_pept        91940..94084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avrBs2"
FT                   /locus_tag="XAC0076"
FT                   /product="avirulence protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34968"
FT                   /db_xref="GOA:Q8PR87"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR87"
FT                   /protein_id="AAM34968.1"
FT                   /translation="MRIGPLQPSVAHTAAPALPTHTSVVSPTQVPHMPGDIPPLRERPR
FT                   RRADSAPPLVPLNDSAMTGKPALVALDSEFSEQRLAEVQARQITVQTLQTKLATHLAQA
FT                   GTPLKPDSIAARFAAGTLEPVYLDTAAFNAMSRGLPARARAAAGPVLIDAQQGRIIFNL
FT                   QRAFAPGDSSSDAALAALGKQLNLSGHGLATPNWLQPAARTPARRKLQQAARYHGHEVP
FT                   ARDGGAGFFKANDHRLLEGKQALLRNHRQSLVHDHYFEAPSTRAFGKDVMVHRGLFDNH
FT                   AGIPENSLASIDHAYEQGYRNLELDVEVSADGVPVLMHDFSVGRMAGDPQNRLVSQVPF
FT                   AELREMPLVIRNPSDGNYVKTDQTIAGVEQMLEHVLKKPEPMSVALDCKENTGEAVAML
FT                   LMRRPDLRKAAAIKVYAKYYTGGFDQFLSNLYKHYQINPLHSQDAPRRAALGRLLAKIN
FT                   VVPVLSQGMLNDERLRGFFRSNEQGAAGLADTAMQWLDSWTKMRPVIVEAVATDDSDAG
FT                   KAMEAARARMRQPDSAYAKAAYSVSYRYEDFSVPRANHDKDYYVYRNFGELQKLTDEAF
FT                   GVKRTTAGAFRDDGESLLTDQPEAELLAILENRTLARGHTGNELDVPPETPIDINRDAE
FT                   IVKQRTQQFQASSIPADPNHIAAVREGRQRDHTADMVNDPAATRAMDKRAKALGVLTDK
FT                   YRGAPVTHYLNEQAKQTETD"
FT   gene            complement(94574..95551)
FT                   /locus_tag="XAC0077"
FT   CDS_pept        complement(94574..95551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34969"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR86"
FT                   /protein_id="AAM34969.1"
FT                   /translation="MRHKPALPSTVDVDVDVDVDVDVDAIIAVDADGASHWPTARGTTT
FT                   ASPASMSPAHPAQRRTDIAGLRKMIGLRERAVSAHAPVRAPSTDRSLPGNEIAPGLHLI
FT                   QAFLPQAIPTEALSLAFAKRDDAVDPMDLLFFDTETTGLAGGTGTRAFMIGVADWVVDA
FT                   VQGSGLRVRQLMMSTMAAESAMLDLFRTWLTPRTVLSSYNGRCYDAPLLKTRYRLARRG
FT                   DPLSALDHVDLLFPTRRRYRGTWENCKLATIERQLLRVVREDDLPGSEAPAAWLSYLRG
FT                   GSARNLRRVAEHNHQDVVTLSLLMQRLVAVDAQERNALTLACRP"
FT   gene            complement(96058..98466)
FT                   /locus_tag="XAC0078"
FT   CDS_pept        complement(96058..98466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0078"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34970"
FT                   /db_xref="GOA:Q8PR85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR85"
FT                   /protein_id="AAM34970.1"
FT                   /translation="MLTERLEWRYHDRITGSFTIPGRTGRYAPIPGDVPGALADALQAR
FT                   GISQLYSHQADAWAATQRGEHVAIVTPTASGKSLCYTLPVVSAAMTSGAKALYLFPTKA
FT                   LAQDQVAELLELNRAGELGVKAFTFDGDTPGDARQAIRLHGDIVVSNPDMLHQAILPHH
FT                   TKWAQFFENLRYVVIDEIHTYRGVFGSHVTNVLRRLKRICAFYGATPQFILCSATIGNP
FT                   HAHAQALIEEQVHGITESGAPTGDKHVLLWNPPVVNADLGLRASARSQSNRIARIAIKS
FT                   GLKTLVFAQTRLMVEVLTKYLKDIFDHDPRKPARIRAYRGGYLPTERREVERAMRAGNI
FT                   DGIISTSALELGVDIGALDVVILNGYPGSVAATWQRFGRAGRRQQPALGVLVASSQPLD
FT                   QYVVRHPDFFADASPEHARTAPDQPLILFDHIRCAAFELPFIADEPFGPIDPLVFLEAL
FT                   AESEVIHQEGDRWEWIADSYPANAVSLRSVADGNFVVVDKSDGKQQIIAEVDYSAAALT
FT                   LYEGAIHMVQSTPYQVERLDWEGRKAYVTRTHVDYYTDSIDYTKLKVLDRFDGGVAGRG
FT                   DSHHGEVHVVRRVSGYKKIRYYTHENIGYGPVNLPDQELHTTAVWWQLPQATLGKAFAS
FT                   KQDALDGFLGAAYALHVVATVAVMADARDLQKAVGNGDGAWFAVADQTGRGQLRGVEEG
FT                   DAATVELQQAFVPTVYLYDNFPGGVGLSEPLWLRQAELLQRADELVRRCDCSAGCPACV
FT                   GPVLAAHEAAKGESPKSLALTVLALLFDADAPLRHATQVDDDLALDVLA"
FT   gene            98737..99393
FT                   /locus_tag="XAC0079"
FT   CDS_pept        98737..99393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0079"
FT                   /product="hemolysin III"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34971"
FT                   /db_xref="GOA:Q8PR84"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR84"
FT                   /protein_id="AAM34971.1"
FT                   /translation="MPANVTAPHYKSVSARRADIAVHAAGLLLAIVGGAWMVVRAHANQ
FT                   TMLLATCIYALGLLVMFACSAAYNFAPPQRQPMLRKFDHAGIFVMIAGSYTPFFLVALD
FT                   GSWRWVMILSVWCVALFGVFAKLCLPGIAKGFWVAIYLLLGWAGIVVINQMIAGLDSAV
FT                   LWLIVAGGAFYTVGVAFYVRKSMVYNRAIWHAHVLGGALSHWCAIWLCLRPLGEG"
FT   gene            99461..99718
FT                   /locus_tag="XAC0080"
FT   CDS_pept        99461..99718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34972"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR83"
FT                   /protein_id="AAM34972.1"
FT                   /translation="MRTELVTTLKRQATELLAAAERDKEPILITQHGLPSAYLVDVASY
FT                   ERMQQRIALLEGIARGEMAVAEGRTLSHEQARHRMARWLK"
FT   gene            99706..100005
FT                   /locus_tag="XAC0081"
FT   CDS_pept        99706..100005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34973"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR82"
FT                   /protein_id="AAM34973.1"
FT                   /translation="MAEIIWSVPALADLDAIADYIAIDNAPAAAALVKRVFGHVEQLIE
FT                   HPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMRSERALRGNRLSR"
FT   gene            complement(100185..101084)
FT                   /locus_tag="XAC0082"
FT   CDS_pept        complement(100185..101084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0082"
FT                   /product="short chain oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34974"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR81"
FT                   /protein_id="AAM34974.1"
FT                   /translation="MSKRILVTGASSGFGRLAAQALAAAGHTVYASMRDTAGRNAGVAQ
FT                   EMADLACKQQLALHALELDVQSQASADAAVASIVAQAGGLDVVVHNAGHMVFGPAEAFT
FT                   AEQLAHVYDINVLGTQRVNRAALPQLRAQQQGLLVWVSSSSSAGGTPPYLGPYFAAKAA
FT                   MDALAVQYARELTRWGIETSIIVPGAFTKGTNHFAHAGTPDDAARAAAYEAGPYAGFGE
FT                   QVQQAFARLVPEDADVAEVAQAIVQVVNAPFGKRPFRVHIDPAGDGAEVGFAVLDRLRA
FT                   EMLHRVGLDDLLAPRVVE"
FT   gene            complement(101144..101881)
FT                   /locus_tag="XAC0083"
FT   CDS_pept        complement(101144..101881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0083"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34975"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR80"
FT                   /protein_id="AAM34975.1"
FT                   /translation="MTQQQKVALVTGASRGIGAAIAQRLAGDGFAVVLNYAGHADEADR
FT                   LVRSIEADGGRAISVQADVSDPAAVARLFAAAETAFGGVDVLVNNAGIMQLATLADSDD
FT                   ALFDKHIAINLKGTFNTLRQAARRLRNGGRIVNLSTSVVGLKLETYGVYAATKAAVETL
FT                   TAILSKELRGRAITVNAVAPGPTGTALFLDGKSPELIERLSKANPLERLGCPDDIAAAV
FT                   AFLVGPDGGWINGQVLRANGGMV"
FT   gene            102007..102918
FT                   /gene="yhjC"
FT                   /locus_tag="XAC0084"
FT   CDS_pept        102007..102918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjC"
FT                   /locus_tag="XAC0084"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34976"
FT                   /db_xref="GOA:Q8PR79"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR79"
FT                   /protein_id="AAM34976.1"
FT                   /translation="MDRFDAMRLFVRIVERRSFTAAANDMEIPRSTATKVIAEMEARLG
FT                   VRLLQRTTRVVRPTLDGELFHQPCMRILDDVDDAEGGFRGVAPKGLLRVDVQGTLARHF
FT                   LLPGLPAFFARYPQIQLVMSESDRWVDLVEEGIDCVLRYGPLRDSELVARRVAMLERLT
FT                   CATPQYLQCFGMPTQLEALDQHRMVGLRSITTGVVTPLEFQTAQGLRTFALPSPLSVTG
FT                   TESYLAGIRLGLGIAQVPRFHVAHDLQQGTLVEILRDTPPPSNPVSLLYSRARQLSPRV
FT                   RVFLDWAAGEFAKQAGVAQPIG"
FT   gene            complement(103084..104085)
FT                   /locus_tag="XAC0085"
FT   CDS_pept        complement(103084..104085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34977"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR78"
FT                   /protein_id="AAM34977.1"
FT                   /translation="MAVGIARPAALPRTAADAATLKRLLRKGARSLVRTLPWRHQDRLY
FT                   FLHTFGRLPDLYAPKCFNEKILYRKCVHGDYLQYQRLADKFAVRPYVAAKIGQAHLIPL
FT                   LLDTTDPQDLLRLPQWQQTVIKANHGAAMVEVVREEPDAQQKRRIIARCGQWMRTDFSD
FT                   MVREIHYRDIPPRILVEKYIGDAQQVPVDYKFHMFRQADGTFKYVLQVIYGRFDTPKLS
FT                   MTFFVGNLHDAFHRIRDDGRAPPCAPELLEQALELSKVLASDFDYVRVDWYIQHGQVYF
FT                   GELTFTPGAGLVTGLDRGLDRMMGDMWVQRRAPGEPCLPMQGFGVGVRVPQR"
FT   gene            104350..104865
FT                   /locus_tag="XAC0086"
FT   CDS_pept        104350..104865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0086"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR77"
FT                   /protein_id="AAM34978.1"
FT                   /translation="MTRCRSQRERPRRLSAYGRKHMGKTGLSRMVSARQYPRMSVRARI
FT                   QRSTLSRADAPALVDVEASRRCCTDRRALLARCAVDSLAYTPGCISRSCLDRVIADTQG
FT                   AGSKEQRRCGDVQPGISRTPTGQPHEIRQHRTDKCANANANANACTCSVSRRADSPRTH
FT                   HQRQRRLE"
FT   gene            105104..105424
FT                   /locus_tag="XAC0087"
FT   CDS_pept        105104..105424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0087"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34979"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR76"
FT                   /protein_id="AAM34979.1"
FT                   /translation="MLYGSRTARSSRFESGVAILRKAAATGNIYAYYGLSEVYNGDTPQ
FT                   KNLVESAAYLRLAYLLGDRKASVAIARRGLSDVENIAADERAAVLYQIFANSPRPSPRP
FT                   FE"
FT   gene            complement(105661..106137)
FT                   /locus_tag="XAC0088"
FT   CDS_pept        complement(105661..106137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0088"
FT                   /product="NAD(P)H oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34980"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR75"
FT                   /protein_id="AAM34980.1"
FT                   /translation="MLLPSPDIAFYLKRAAPAPDVAAEHARLDRADALVLVFPIYWWSF
FT                   PALLKGWIDRVLTLGWAFDESAEGKIVKKLQHLDVHMLAIGGADERTYARHGYFGAMKM
FT                   QINHGIFDFCGAPVRTSELLTVPDAGFPQSHLDTARAIGARLFAVRASADSATS"
FT   gene            complement(106232..107182)
FT                   /gene="abiR"
FT                   /locus_tag="XAC0089"
FT   CDS_pept        complement(106232..107182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abiR"
FT                   /locus_tag="XAC0089"
FT                   /product="abortive infection phage resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34981"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR74"
FT                   /protein_id="AAM34981.1"
FT                   /translation="MSRKSWAYQPGDFWALNNGITIVANNFEEITPKKFKIFQLSIVNG
FT                   CQSTVSLSRAVHHDKGAERCQILVRVVGAKKALLTDIVRYNNTQNPVKLSAVRLLDPIQ
FT                   EGLRTAFSRIDIQYAPKQEGAKATKSHKRIELDRIAQYLASTSEDTILEAVTKKAELFD
FT                   RSYKSIFPRGLRPEIVYLAWILAHHIEAERANLLEDTSISGDPQMKAILGIYGTPWGIF
FT                   VAYNLIIKFGSDLSKLTLEKMATEVFSNSLLKYAKKAMELYSEIAVNILTTSDEALNLR
FT                   NELRTRTFLEKIKKNLGLRVAKGSAWRLPKLHQVS"
FT   gene            107220..107492
FT                   /locus_tag="XAC0090"
FT   CDS_pept        107220..107492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0090"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34982"
FT                   /db_xref="GOA:Q8NKZ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NKZ0"
FT                   /protein_id="AAM34982.1"
FT                   /translation="MSSKRYTDEFKIEAVRQVTDRGFKVAEVAERLGVTTHSLYAWLRK
FT                   FGKPGVVQRAEADQSAEVRRLKIELRRVTEERDILKKAAAYFAKG"
FT   gene            107546..108352
FT                   /locus_tag="XAC0091"
FT   CDS_pept        107546..108352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0091"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34983"
FT                   /db_xref="GOA:Q8NKZ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NKZ1"
FT                   /protein_id="AAM34983.1"
FT                   /translation="MCRVLRVNRAGYYAWLKSPDSERAKEDERLLGLIKHHWLASGSVY
FT                   GHRKIAKDLRDLGERCSRHRVHRLMRTEGLRAQVGYGRKPRFHGGTPCKAAANLLDRQF
FT                   DVTEPDTAWASDFTFIRTHEGWMYLAVVIDLFSRQVVGWAMRDRADTELVVQALLSAVW
FT                   RRKPSAGCLVHSDQGSVYTSDDWRSFLASHGLVCSMSRRGNCHEREACPWGTTHRWRAS
FT                   LVCSNASGSGGGSTPPRTPHAPRCSTTSRCSTTHNAVMVQLATCPL"
FT   gene            complement(108392..109222)
FT                   /locus_tag="XAC0092"
FT   CDS_pept        complement(108392..109222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0092"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR73"
FT                   /protein_id="AAM34984.1"
FT                   /translation="MEIKMLKKKNPAPKEEKTFSDARKELISSIDAIARRGGISRDKAI
FT                   TAWYATTLLGIDEDEAIVSASVDGAEDAGCDFIYIDHDQEIVYVLQGYVSDRPERSASQ
FT                   KKWNALIASISNIQDPISFQHSGRHDIFEQLTEIDPTNYAKVFGLVTLAGKSDQIARQR
FT                   ETTERANTYGKDVSFLYEHQDTLYEKHLVAKAADRNVPEDEIIFNSDVVQIRDGFGSAV
FT                   VGAVKASELARLHTKHGNRLFEGNVRLFIGERKGGINEKIIETASSRPDTPRVP"
FT   gene            complement(109267..110481)
FT                   /locus_tag="XAC0093"
FT   CDS_pept        complement(109267..110481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0093"
FT                   /product="ISxac1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34985"
FT                   /db_xref="GOA:Q9Z3E5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3E5"
FT                   /protein_id="AAM34985.1"
FT                   /translation="MRASEVLQKCLSNSLSGMHALRQRTLLGAVEALVHGGRLTLIDIA
FT                   RAWPGATRVRAPLKACDRLLCNRTLQAERSMIERDMAHWLLRGDQPVIVIDWSDLKPDK
FT                   SWCLLRAAVPIGGRTLTLLDMVVAGKQQGSPGAEKRFLQQLRRMIPDDVRPILVTDAGF
FT                   RTPWFRAVSAMGWDWVGRLRGRTQVKPQDVPDDAAQWIDSRRLHALASNRACELPPMQA
FT                   NRSDPLDCRLVLYAKTRLGRQQRNRRSPAKVSRASSSLKAAAREREPWLIVASPQLQAP
FT                   SAKHLVNLYARRMQIELAFRDLKSHRYGQAMEDSLTRRGERLQILLLLNTLATFASWLA
FT                   GLGCEATGIAQWLSPRSSTRKLYSTLRVGRQALARRWPMEPVSRWLERLRTLPEAVREQ
FT                   MTLVL"
FT   gene            110518..111015
FT                   /locus_tag="XAC0094"
FT   CDS_pept        110518..111015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR72"
FT                   /protein_id="AAM34986.1"
FT                   /translation="MPHARTFFHRLAHQALDLAGRNVGKPQGQVYLPTQTPLPPTRSSR
FT                   HLLPSIAQPLHRLPAHACITQLLGFCSAKTRQCDDGVRWGRAPLTLRFIAQHHVLDALA
FT                   VTHHARMRVRAVLLAVEGRGVVRHRVIRLLRWRNVLACCRAGGRAHALCMRRLHVCRAT
FT                   QH"
FT   gene            complement(111185..111406)
FT                   /locus_tag="XAC0095"
FT   CDS_pept        complement(111185..111406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34987"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR71"
FT                   /protein_id="AAM34987.1"
FT                   /translation="MHDEPGYWMSEGTQYHLLRVRDQLRLLATLATPRTREEGAMGMPA
FT                   IPLQQWAHCLQHLAEQVDDVLGDLGTAR"
FT   gene            complement(111806..113746)
FT                   /locus_tag="XAC0096"
FT   CDS_pept        complement(111806..113746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34988"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR70"
FT                   /protein_id="AAM34988.1"
FT                   /translation="MRQIYRYVELINKERKMAAVSPQLEAALARFSTDPSVTRDQAQQL
FT                   RTAIISNTTLFKEFEKEAKQGHLQGFSLQSSANRAPNLVGSYDMQSGVITLPTASFQPA
FT                   GTTPSSDLKATLQVQHMTLGFARSTYQDAARVSHPVTQDMVDNLQSTLNKSPFLADQLK
FT                   KAATTVDPSDPSSPKRAQLESFGFVGPGVSAGGTYDGNNRVMNLPPIGLQTASASNPQG
FT                   RFSEKDMVFVLGHEIQHSFNHADKTKATANFLNDVRSQAVAKTPVHDYTNELRSYIQSG
FT                   REDEAKAEIAGWNALLSHERQSNPTANGLDLMLNTKNARTLDFVHRDPLTTKAVANPGL
FT                   GFNQDGSLAQTPSNIAAMGQNYFDRPSPLYAQPGQRPVGLGEHRNQAGQLQPTADYTNY
FT                   YGTWAVEQILQAEDRANVMYQGARPQVTIDMAALGLKEHLIENEGLDRGVNKSPFPYQD
FT                   TSTRPPTLHHFDHTQDGSVNPAHDHTYVPVVPSAPAATGSLGPDDPAHPDHRMLEQIRS
FT                   GVRKIDESVGKPYDDMSERVSRSLLAVCKDNREAYPAAGDRSLADNALSRVDHVVMGKT
FT                   GNMFAVEGRLDDPAHRRVHVEIDQAIRTPVEQSDQKLLAANQAIAQERALTQQQEVARG
FT                   MNEPNQGSLSR"
FT   gene            complement(113716..114354)
FT                   /locus_tag="XAC0097"
FT   CDS_pept        complement(113716..114354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0097"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34989"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR69"
FT                   /protein_id="AAM34989.1"
FT                   /translation="MRFPRAALLFLTALCAPALSACAHGPLKPLPKEHADMTLPEAVTG
FT                   DKITLSAEEIGNRFLKLIKGLDSRDDLNPERIREVMGITLKKPDPAELSVAYWSIDLQD
FT                   GWRYAFTYVPESPSLLKGVDLTFQNDKDDWSNMSAVCGLDFDHYDKALEAMGFNASPTY
FT                   GPIGQLEDWRYTKFAKDGVGGDIAISVVPRNIVVREPGRLCVKSIGTLN"
FT   gene            complement(114472..114780)
FT                   /locus_tag="XAC0098"
FT   CDS_pept        complement(114472..114780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0098"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR68"
FT                   /protein_id="AAM34990.1"
FT                   /translation="MELTPESRALKQGIGLSFVNEDKGSSSLQSNCVDFEEYKSSLIEL
FT                   GFVDSPVHGEIGQLQSLRFAKFAKDVSGNDIVISLVPQNEVPGYPGRLCVKSIGTLN"
FT   gene            complement(115510..115893)
FT                   /locus_tag="XAC0099"
FT   CDS_pept        complement(115510..115893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0099"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR67"
FT                   /protein_id="AAM34991.1"
FT                   /translation="MGQQAGVHTEPGLQVGMHIGERLASTGTMGPLTNGSAWHDGCETE
FT                   GNHLITRGRSFAASRQLLHGAARGNANRTNAAAWAKASALQETSAPSPQAYVPMPMQDS
FT                   WRRWKRRSGMSATGMPSRRRDEW"
FT   gene            complement(116066..116254)
FT                   /locus_tag="XAC0100"
FT   CDS_pept        complement(116066..116254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34992"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR66"
FT                   /protein_id="AAM34992.1"
FT                   /translation="MDKNRIDGAAKQVKGSVKEAIGRVTGDKSTELEGAAEKNVGKVQR
FT                   KAGEVADDVRDAVKSTK"
FT   gene            complement(116477..117358)
FT                   /locus_tag="XAC0101"
FT   CDS_pept        complement(116477..117358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34993"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR65"
FT                   /protein_id="AAM34993.1"
FT                   /translation="MATPSLAEGTLPADPAQAEVLAAVAAALEHVDLRPQLLPRRPHLL
FT                   PQLMRAVNDPDASGRGIAAIIAQDPALAANLLRIANSALYRPQGGPLESLERAVVHIGT
FT                   EGVRQIVAAAVMQPVLSLDGGLYSRLPAAVWDYALRTAAAAAAYLRERGGDTLSGQLAG
FT                   LLQGLGAVVILRVLRDTYAERPAVPYNLEVAAALVERHTATVAKTIANAWELPPPLGTA
FT                   LDEQRPEHDASLLATPLGLALRYGRLAAALAMLARHGAEHEDHALGILATLEPDSEANA
FT                   ALWQRLVAASVE"
FT   gene            117721..118380
FT                   /locus_tag="XAC0102"
FT   CDS_pept        117721..118380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34994"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR64"
FT                   /protein_id="AAM34994.1"
FT                   /translation="MTGKPVRARSKTNVASSRVHAMGCVQQAPTRHPSPKPPPPGHDHA
FT                   HAGHGMSMMCNGGLVASMQRRSLPKRVPMSTVTLHRVIRASPERIYRAFLQADAVAKWL
FT                   PPNGFTCTVEHLHAHVGGTFRMAFTNFANGERHAFGGTYRELQPNVLLRYDDAFDDPSL
FT                   PGTMVTKVQLHTLPCGADLHVVQEGIPEQIPLHACYLGWQDSLMLLAHLVEANPEH"
FT   gene            complement(118680..118991)
FT                   /locus_tag="XAC0103"
FT   CDS_pept        complement(118680..118991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34995"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR63"
FT                   /protein_id="AAM34995.1"
FT                   /translation="MSPQRPPVETGVTLRLAREGGVAAFPAMRRERQLAMDALDDAQRV
FT                   RLRSVLDQCMAHALPAPQAGGGDRRYFSIVWDGASEPLRIPEEHAPAEIVQLWKQGTL"
FT   gene            complement(118988..120058)
FT                   /locus_tag="XAC0104"
FT   CDS_pept        complement(118988..120058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0104"
FT                   /product="metalloprotease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34996"
FT                   /db_xref="GOA:Q8PR62"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR62"
FT                   /protein_id="AAM34996.1"
FT                   /translation="MSTFVSPRRAGILPPYLLEHVAQAAPAHARQCALLSRQITAQLRQ
FT                   QRALGLLARADAPAADAKAQQTAQAVQRRIYDAQQGTTLPGTLARDEGAPATQDVAVTE
FT                   AYDYLGATHDFFQTVYGRDSIDAAGMPLIGTVHYERGYDNAFWNGEQMVFGDGDGEVFN
FT                   RFTIAIDVVGHELTHGVTERTANLIYQGQSGALNESISDVFGVLIKQYTLGQSADQADW
FT                   IIGAGLLMPGIQGVGLRSMQAPGSAYDDPALGKDPQPATMAGYVDTQEDDGGVHYNSGI
FT                   PNHAFYRAAVAIGGAAWEKTGRIWYRALTGGELAASADFATFADLTASVASADYGANSS
FT                   EAVALRQAWRDVGVLA"
FT   gene            complement(120169..120825)
FT                   /locus_tag="XAC0105"
FT   CDS_pept        complement(120169..120825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34997"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR61"
FT                   /protein_id="AAM34997.1"
FT                   /translation="MSRILVIGGHGKVARLLTPLLVQGGHQVTALFRNPAHEDDVIADG
FT                   ATPVVLDTERAQTDAIAAQLAGHDAVVWSAGAGGGDAARTYAVDRDAAIRAMHAAEQAR
FT                   VRRYVMVSYLGAGLEHGIGPDDAFFAYAQAKAAADAHLRSTTLDWTVLGPGRLTLDPPS
FT                   GRITRDPGSDADGGVSRANVARVIAAALATPGSIGKTMGFIDGQTPIAQALSQLE"
FT   gene            121092..121529
FT                   /locus_tag="XAC0106"
FT   CDS_pept        121092..121529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0106"
FT                   /product="MutT-nudix family protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34998"
FT                   /db_xref="GOA:Q8PR60"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR60"
FT                   /protein_id="AAM34998.1"
FT                   /translation="MSSELRPRVGCGAFLQRADGRLLLVLRGRAPEQGHWGLPGGKVDW
FT                   METVEATVVREVLEETGLQVHPQRVLCVVSHFEPDMDPPQHWVAPVYLASIQGPEQAVL
FT                   REPQVLLDMGWFALDALPAPLTRSAMQAVQQVQAERAATRA"
FT   gene            121570..125535
FT                   /locus_tag="XAC0107"
FT   CDS_pept        121570..125535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0107"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAM34999"
FT                   /db_xref="GOA:Q8PR59"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR59"
FT                   /protein_id="AAM34999.1"
FT                   /translation="MLRRAGHMDFVAALGYFLRCRGEGTARPADRIARPGCRTTAWRPA
FT                   THQGTRMESLYPQGPAVVPEQLTAPSSNYRRNAWLAMFGLGGFIAVYLGLLVWFGWTAY
FT                   RLVAGLLQGSGGEQAFWLWVVAAGAAFLAVFMAKALVFNKRAERDTRALELTPAEQPAL
FT                   FAFLYRLADDAGAPRPHKVYLSAQVNAGVFYDLSLINLLLPSRKNLDIGLGLVNVLNLG
FT                   ELKAVLAHEFGHFAQRTMAVGRWVYIAQQIAAHIVGKRDALDRVLATLSRIDLRVAWIG
FT                   WGLSLIVWSIRSLVEIAFRGVVLAQRALSREMEYQADLVAASLTGSDALVHALHKLEAA
FT                   DDGFQRALRFAAREFAQDRPVKDLFAIQSRIIEHMRVVLNDPGHGAVPAVPTEAAPMHR
FT                   LFHSEIAQPSQMWATHPPSAAREENLKRRYIACAIDARPAMELLHDAQALRERVSLGMF
FT                   NGEAPTCVDTAVSLEQLEREFAALSLSRRYQGLYLGRSCTRTARTLDELYATPLPSGDL
FT                   LQALDGLYLPDDGQAIEQLRERERQRATLQGLLDGGLRAAGGVVTWKGTTLSRTQLPAV
FT                   IADLDDELRVLRARVSGHDQRCRSVHLAAANRIGGGWPALLRGYLAVLHYTDHTIADLE
FT                   DANLLYLQTFHAVIADGRVSAKELRQLVAACNQVQRALRQVYAQAGQVQLNAPLAHALG
FT                   KPQWSQCLPEFGLVEADDNNINAWMKAAGSWVQVTLDALGTLRDASLEELLRAENAVAE
FT                   RLRNGDTLPTDDTPPAAPADYPIRLPGEVRQRDLRQNLWQRFLAADGVFPSVARVAVAA
FT                   AIVAGVLWAGGVVGMAEVVAYNGLQQTVTVAIDGQAATIPANGRHVFRLSERSTHHVQT
FT                   RTANGAAIERFDAPSGGHGGQFAYNVAGAALLLNWRASYGSASEDTTRSLSTTRWERTQ
FT                   AQDIFSEPPQKVSGKGGHYRDVLTAVSGRSPHELLGELGPERDLALVTAHARWDDAGSA
FT                   YLEQWMEQLRRAAPHTVPALLAERLQRNPQDVAALRMQQDIATPEQRAQVCGRQTAAAQ
FT                   AHPDAPALQYAAIRCRSDTPERDQAFVAAQARWPNDPWLQRAAAAVQVGQLHLPQAQAL
FT                   YEQAARAPALADDVLPLLARVQRYRGLATDLPGMAQRSPSLASIVALEGGERTQGTPYH
FT                   SYYALAHGQLDTAVTDAAADADVQARIVRLAAASRGASAALLQQARVLPERAGLDAITA
FT                   PSAWALAAREGWQTDALRAATLQGTGEDGAYIARFFDAVQAGSSQQQAEAALGGVSLVG
FT                   RGLAYTMAAVLLGQRCPDAWRRGAQQLLFASERPYLG"
FT   gene            125921..126319
FT                   /gene="atsE"
FT                   /locus_tag="XAC0108"
FT   CDS_pept        125921..126319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsE"
FT                   /locus_tag="XAC0108"
FT                   /product="AtsE"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35000"
FT                   /db_xref="InterPro:IPR041374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR58"
FT                   /protein_id="AAM35000.1"
FT                   /translation="MSLQIPQGALVVVADGGEARWFTNTGNEGKVVLRQHARTDVQNVD
FT                   DDGPAGKAPQDLTETDLDEMTFAKQLSHALNDGALKHEYTHLVLVADPTTLGRVRPLLH
FT                   KETQQRLVGDLAKDLTNLPLEDIQRALS"
FT   gene            126340..126669
FT                   /gene="trxA"
FT                   /locus_tag="XAC0109"
FT   CDS_pept        126340..126669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="XAC0109"
FT                   /product="thioredoxin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35001"
FT                   /db_xref="GOA:Q8PR57"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR57"
FT                   /protein_id="AAM35001.1"
FT                   /translation="MGFVREYAAQAPERSAVEAQAGLQVLEFGTDWCGHCIAAQPLLQK
FT                   LLGGYDAIDYRKIEDGKGRPLGRSFRVTLWPTIILLRDGQELARAVRPQTREDLQDLLS
FT                   VLDAA"
FT   gene            127200..128672
FT                   /gene="proP"
FT                   /locus_tag="XAC0110"
FT   CDS_pept        127200..128672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="XAC0110"
FT                   /product="proline-betaine transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35002"
FT                   /db_xref="GOA:Q8PR56"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR56"
FT                   /protein_id="AAM35002.1"
FT                   /translation="MRSHFGWFKRRRQLQLDEVTVVDRSMLRRAVGAAALGNAMEWFDF
FT                   GVYGYLAVTLGQVFFPASNPTAQLIATFATFTVAFLVRPIGGMVFGPLGDRYGRQKVLA
FT                   ATMILMALGTFSIGLIPAYQRIGLWAPALLLLARVLQGFSTGGEYGGAATFIAEYATDR
FT                   NRGLMGSWLEFGTLGGYIAGAATVTALHMSVTPAQMLDWGWRVPFLIAGPLGLLGLYMR
FT                   MKLEETPAFRAHTEQSEQRERQTAAQGLTTLLRLHWPQLLKCVGLVLVFNVTDYMLLTY
FT                   MPSYLSVTMGYAESKGLLLIILVMLVMMPLNIVGGMFSDKLGRRPMIIGACIALFALAI
FT                   PCLLLVGSGNDGLIFAGLMLLGLALVCFTSSMPSTLPALFYTPVRYSALSIAFNVSVSL
FT                   FGGTTPLVTAWLVERTGDPLVPAYYLMGAAAIGLLTMLFVRETAGLPLRGSPPAVASDA
FT                   EARALLQADSPVTVDAQLPVTTAASMGQPRTA"
FT   gene            complement(129010..129435)
FT                   /locus_tag="XAC0111"
FT   CDS_pept        complement(129010..129435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35003"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR55"
FT                   /protein_id="AAM35003.1"
FT                   /translation="MVCAALSEPRQLARWWTREVSLADDLVRLDWSRQGWRVELSIDEG
FT                   ADHQLVCWRCHDSNMLDTDAWKGTVMRFELRSISQGTQVDFVQSGYRDSPCKEACARGW
FT                   RFFLGSSLKRYVETGEGAPSADMHMPELPAQNPHTPR"
FT   gene            129654..130445
FT                   /locus_tag="XAC0112"
FT   CDS_pept        129654..130445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35004"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR54"
FT                   /protein_id="AAM35004.1"
FT                   /translation="MDAAAQRDLATAHALLENPGVAAQLANALGAPIESLITKRLPKVV
FT                   TRSIDGVTRRALQVAMKSALLSLRGKTDAQQPASTTRHTLAVAVSGGAGGFFGLPGLMV
FT                   ELPVTTTVMLRSIADIARAEGESLHDPETALACLEVLAHGGRSASDDGAESGYFAVRAA
FT                   MAQQLSAAASYVAAHGFASKGAPALVSLVSRIAAKFSVNVGEKLAVQAVPLVGAVSGAT
FT                   LNTVFMRHFQAMARGHFIVRRLERRFGEEAVRRAYEALPPR"
FT   gene            130617..131273
FT                   /locus_tag="XAC0113"
FT   CDS_pept        130617..131273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35005"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR53"
FT                   /protein_id="AAM35005.1"
FT                   /translation="MPMMPKPFSPASARNRDPILEVLRTHFADRQQVLEIGAGTGQHAV
FT                   HFAAAMPWLQWQASDHLEHLAGMRQWLDEAALPNTPPPIALQAVPTPTPGLAPPPSLPV
FT                   LVGGQHGFDAIYSANTLHIMGWPQVQALFAGLPAVMAPDAVLAIYGPFNRNGQFTSDSN
FT                   RAFDAMLRERDPASGIRDAEAVDALAASVGLQLIDDVALPANNHCRVWRRVTVVS"
FT   gene            complement(131525..133501)
FT                   /locus_tag="XAC0114"
FT   CDS_pept        complement(131525..133501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35006"
FT                   /db_xref="GOA:Q8PR52"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR52"
FT                   /protein_id="AAM35006.1"
FT                   /translation="MRCGRRCSRESHPDPPSSGAAVVRTDGVCRPGSKRSAVVRKDRIA
FT                   NAARRTLSGRIAPGAPTMTLSLPWLLGAALLLIAVIGCIRLVRAHQRQPYLRTRLWLLL
FT                   AAQPLLAALLYPVLLPPPRAGTDGELHVATAGTAAGQVSTGDLARWVALPEAPALPGVM
FT                   RVPDLATALRRAPGTTALVVHGSGLPARDREGLNIPLRLTLDPAPRGVVAVSPPPPVTP
FT                   GDTIAVAAQVQGLPDARVELLDPAGQVVDSAVANRAGRVRLRGLARAPGQVLFAVRARD
FT                   AAGAERSRVEVPVLIAAVPPMRVLLLAGAPQPELKYLRRWASDAGLDVRSQIAVGPGVQ
FT                   LGEGAALDAASLDRLDLLIVDPRRPVALGTAQRQTMRAAIQRGLGVLVRTDGPLDAGTR
FT                   TALAELGLGVSGGGTSRPVPAPQRLSPPAAPAAPADPAGSPGDAPTLAPLQRRDLQPQA
FT                   TDALIAARADDGSALGWWRAQGRGRIGIGLVEDSFALVLAGRSDLHAALWAQLSAAVAR
FT                   PGGALPTPVQEGWSQQRITLCDLRADALVTDPDRARHPLLPERNGNGPRCAGYWPATPG
FT                   WHRLESSSTQRWLYVRAPNDAQAMYAQQLRAATSALTGGTPFAPIATPATQPGARWPWL
FT                   LAWLSVAAALWWFERRRASQRVP"
FT   gene            complement(133473..135839)
FT                   /locus_tag="XAC0115"
FT   CDS_pept        complement(133473..135839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35007"
FT                   /db_xref="GOA:Q8PR51"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR51"
FT                   /protein_id="AAM35007.1"
FT                   /translation="MAAGAVANRPGAAAVRARTLAGHRAAPVHSRMSTPALQRAWQAAR
FT                   RRQAAGVLLFGLPLAAVPAALAWRAGAQAAVVALLLGLLALGGVALLAARRLDQSWLIH
FT                   RLDRDADLEDSSDLLFAPATRLGPLQTLQRQRLEQRLRSSPRDLRPAWPWRRAWPWSVL
FT                   GVLACGALLLWPQPATHRTPPTDRVAAARASSGAPTLRQAQLRSSPPAYTGLPAARLPG
FT                   LDAKVPAGTRLDWQLQVGPAPRSVAVRLTDGSTVALARQGRGDIWQGHWVAERASLYRI
FT                   LIDGAPADRQLHRLDVLPDRPPQVRVLAPEQSLVLWSPAARTWTLRFEASDDYAVATNA
FT                   ELRLTLAQGSGENITFRTQRRTLTGSGPARQRGFAITLEPHALGMAAGDDLIAQLIVHD
FT                   TRQPGPQEGRSASVILRWPPPEQTMAAGLEASVKQTLPAYFRSQRQIIIDAEALLKEKP
FT                   RLEAATFLKRSDAIGVDQRLLRLRYGQFLGEESEGAPQGPPTADAPPTSDAPADDLPTA
FT                   DMPTADAPSAPGAASDTHAGHDHDDHAHDAHAATPGAAALDDDHDHDHGGSNGRPERSS
FT                   FGQAENVLAEFGHTHDHAEAATLLDPQTRALLRAALDQMWQSEGELRQGHPERALPYAN
FT                   KALGFIKQVQQAERIYLARVGTQLPPIDPSRRLSGDRTGLGDRAAGLDTRPDPDPSALQ
FT                   LWDALGEAAPVSDATLARYAQWLQTQQDRLHDPLGLAAAVETLRAEPDCARCRAQLRAQ
FT                   VWRTLLAPPAAPHRRAAPDPRGQRYLDALRQEMQP"
FT   gene            complement(135743..136942)
FT                   /locus_tag="XAC0116"
FT   CDS_pept        complement(135743..136942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35008"
FT                   /db_xref="GOA:Q8PR50"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR50"
FT                   /protein_id="AAM35008.1"
FT                   /translation="MNLLLLFPAGLAALAALLLPLLIHLARRSEHRPTDFAALRWLRAL
FT                   PRPRHHVRLDEWPLLLVRLLLLAAVALLLAEPAVRGHDDARPRIALSPGVDVAAARQLR
FT                   HAADAQWVWLAPGFPPVDADTNADTHKTLARPAGATQPVSSLLRELDASLPPDAALSVI
FT                   VPAQWGPLDAQRLQLSHQVRWQIVPGQSPLAAPAAAAPLRLQAIADDSAAPALRYLRAV
FT                   HAAWALPGSLPVGTPADAQPSRWQPGTVVAWLSRSAPPAPVMAWVAAGGRLVLEAQTPV
FT                   PPNLAATLQPVQQATSGEPLLDAAALGRGRVLRWAAPLQPQQLPALLDADFPTRLHDAL
FT                   QPLPTPQRALAQTQQPQRGAASRLTTAPWPLAPWLIGLVLLLFALERWLATAPRRSTPA
FT                   "
FT   gene            complement(136986..137882)
FT                   /locus_tag="XAC0117"
FT   CDS_pept        complement(136986..137882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35009"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR49"
FT                   /protein_id="AAM35009.1"
FT                   /translation="MSVDVPALIPSHVRSRLRGLQLRARHAQGAHDIGQHASRSRGAGL
FT                   EFAQYRAYEPGDALRQIDWKLYARSDRFFVREAERESPLTLWLVLDATASAGQADHARP
FT                   GGTRLHTMATLAACAAEIALQQGDQVGLFAVHGGGLVAVPAGAGPRQRDRLWLALHGLR
FT                   AGGRWPGMTAVRPLWERIATHALVLSIGDGFDEDLNIALEKLAAARRQVMQLQVLTCDE
FT                   RDFGFSGGHRFRDPETGEELLGDGAAMRADYLQRFGAAQRAQQARWRAAGIAHALQYLD
FT                   AAPDAALRQLFGQGAQR"
FT   gene            complement(137896..138888)
FT                   /gene="moxR"
FT                   /locus_tag="XAC0118"
FT   CDS_pept        complement(137896..138888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="XAC0118"
FT                   /product="methanol dehydrogenase regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35010"
FT                   /db_xref="GOA:Q8PR48"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR48"
FT                   /protein_id="AAM35010.1"
FT                   /translation="MTSPNNDILAAQLSQLGTLRAALAQAVVGQDAVVEQLLIGLLAGG
FT                   HCLLEGAPGLGKTLLVRSLGQALDLQFRRVQFTPDLMPSDILGTELLEEDHGTGHRHFR
FT                   FQQGPIFTNLLLADELNRTPPKTQAALLEAMSERTVSYAGTTYALPAPFFVLATQNPIE
FT                   QAGTYPLPEAQLDRFLLHVRVDYPSEQEERDILTQTTGSASAQVPKVMDAASVQALQQH
FT                   VRQVHVGAELLTWINRLVRASRPGPQASDEVRQWIKWGAGPRAGQSLVLASKARALLHG
FT                   RFAATREDVVALAAPVMRHRLLLSFAAEAEQRTADDVVAALLRAVPFPA"
FT   gene            complement(139019..139690)
FT                   /locus_tag="XAC0119"
FT   CDS_pept        complement(139019..139690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35011"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR47"
FT                   /protein_id="AAM35011.1"
FT                   /translation="MLGGVAALALPQRARAAGNYDFWFTRLRYDSGDWDVDARMPSNLI
FT                   TSLIDYTQLRVDPQEHVLDLADPRMLQAPFCYLSGHKLVEFNPAERRNFERYVRNGGFV
FT                   FVDDCNHDIDGLFATSFEAQMTSIFGKTALQKLPKNHRLYRAFFTFPDGPPATGFELNG
FT                   WGDDLVHDYLKGISIDGRLGVLYSNKDYGCEWDYDWRNKRFLAEDNTKFGVNIVMYALT
FT                   N"
FT   gene            complement(139834..141168)
FT                   /gene="tldD"
FT                   /locus_tag="XAC0120"
FT   CDS_pept        complement(139834..141168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="XAC0120"
FT                   /product="TldD protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35012"
FT                   /db_xref="GOA:Q8PR46"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR46"
FT                   /protein_id="AAM35012.1"
FT                   /translation="MSILTEAQAKAILDKVIKLSKADECTATLTGSIDGNIRFALNNVS
FT                   TSGIVDNTDLQVQVAFGKRVGVATINEFDDASLERVVRRAEDLAKLAPENPEFMPAVDK
FT                   QTYRPSPTFSESTAAIDPAFRAQVAADSIAPCKGKGLIAAGFLEDGQSFTAFANSKGNF
FT                   GYQRGARFDYTCTVRTEDGRGSGWVGRNLKDAADFKAEQDIRIAMRKASDSAEAKALEP
FT                   GKYTVILEPAAAAGLISFMMNFFDARRADEGRSFLSKKGGGNKLGEQVYDPRVNITADP
FT                   WDPRAAVMPWDEEGLPREKMAIVENGKIANLQYSRFWAQKNGKRAVGEPGNLLMAGGDK
FT                   NIAELVRGTEKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKYPVKNFRFNES
FT                   PVIMLNNIDELGKPVRVAGDESNFVMMIPPMRLRDFTFTSLSDAV"
FT   gene            complement(141183..142778)
FT                   /gene="tldD"
FT                   /locus_tag="XAC0121"
FT   CDS_pept        complement(141183..142778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="XAC0121"
FT                   /product="TldD protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35013"
FT                   /db_xref="GOA:Q8PR45"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR45"
FT                   /protein_id="AAM35013.1"
FT                   /translation="MGGLIVPAYFGKAIAAEQLLTPFDVGRKKRLADAGLNAARQAGAS
FT                   YCDVRIGRYLRQFVITREDKVQNVVNTESIGAGIRVIVGGAWGFAATNELTEQGVAKAA
FT                   AQAAAIAKANAKVQGTPVQLAPTPGVGEVSWKTPIKKNAMDVPIKDKVDLLLGVNAAAT
FT                   AAGANFVNSMLFVVNEQKYFASTDGSYIDQDVHRIWAPMSVTAIDKASGKFRTRDGLSA
FT                   PMGLGYEYLDGAASGKFVSPNGVVNYGLSYDMKEDAIAAAKQAQEKLKAPSVKPGKYDL
FT                   VLDPSHTWLTIHESIGHPLELDRVLGYEANYAGTSFATLDKLKAGFQYGSDKVHILADK
FT                   TQAGSLGAVGYDDEGVKTKQWDLIRDGKLVDYQAIRDQAHILGKTASDGCCYADSWSSV
FT                   QFQRMANVSLAAGKTPLSVSDLIKNVENGIYIIGDGSFSIDQQRYNAQFGGQLFYEIKN
FT                   GAITRMLEDVAYQIRTPEFWNACSAVADQRDYRLGGSFFDGKGQPSQVSAVSHGSSTAR
FT                   FDGINVISTARSLG"
FT   gene            complement(143248..144828)
FT                   /gene="tldD"
FT                   /locus_tag="XAC0122"
FT   CDS_pept        complement(143248..144828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="XAC0122"
FT                   /product="TldD protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35014"
FT                   /db_xref="GOA:Q8PR44"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR44"
FT                   /protein_id="AAM35014.1"
FT                   /translation="MLLPNTRLIAAEQLLAPVDAARNRRLSDAALTTAKAAGASYCDVR
FT                   VGRYLRQFVITREAQVENVVNAESSGVGVRVLADGAWGFAATNTLTSDGVAIATRQAVA
FT                   IAKANARLGGTPVQLAPVTAAGQVSWKTPIRKNAMEVPLQDKVALLMDVNAAALNAGAT
FT                   FVASRMFAINEQKYFASSDGSYIDQDVHRLWLPFTVTAVDKASGKFRTRDGLSSPMGMG
FT                   YEYLDGDAKQKHQLPGGLIGYGHSYDAREDAIAAARQARAKLAAPSVKAGKYDLVIDPS
FT                   NLFLTIHESVGHPLELDRVLGYEANYAGTSFATLDKRDAGYRWGSDAVTFLADKTQTGS
FT                   LGAVGYDDEGVKTKQWELVKDGILVDYQCTRDQAHLLGKTASDGCSYADSWSNVQFQRM
FT                   PNVSLAPGKTPLAVAEMIKNVERGLYIHGRGSYSIDQQRYNAQFGGQLFYEIENGQVTR
FT                   LVEDGAYQIRTPEFWNACSAVCDQRDFRLGGSFFDGKGQPSQVSAVSHGASTARFDGIN
FT                   VINTARSLG"
FT   gene            complement(145244..145780)
FT                   /locus_tag="XAC0123"
FT   CDS_pept        complement(145244..145780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0123"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35015"
FT                   /db_xref="GOA:Q8PR43"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR43"
FT                   /protein_id="AAM35015.1"
FT                   /translation="MQAGLSAGHCEPARKRRHRRQINSTNDTGSAFILCLMLRVLFDRE
FT                   GKRCMTFASARLLLVIAGVVLPYAARLPFGLERVRQYTDVGLGGWLLLGGFNAIAWSAL
FT                   LGISFLYRRPIALLVPCLIGFGVLAWAHATVDLRADAQSALALIFIPVYALLPITLGGV
FT                   LGYLLDRKLRRSAMP"
FT   gene            complement(145882..146892)
FT                   /gene="cbbFC"
FT                   /locus_tag="XAC0124"
FT   CDS_pept        complement(145882..146892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbFC"
FT                   /locus_tag="XAC0124"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35016"
FT                   /db_xref="GOA:Q8PR42"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR42"
FT                   /protein_id="AAM35016.1"
FT                   /translation="MSRPSLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGA
FT                   LGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMDHSQPVPDQYPS
FT                   GDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPKGTEKPGDEHFLQPGTQQVAAGYCIYG
FT                   PSTMLVLTLGHGTHAFTLEREEGSFLLTQANMRVPEDTAEYAINMSNQRHWEPAMQAYV
FT                   GDLLAGKDGARGKDFNMRWIASMVADVHRILTRGGIFIYPWDKKDPSKPGKLRLMYEAN
FT                   PMSMLVEQAGGAATTGRERILDIQPTQLHQRVPVFLGSKNEVAEATRYHLDADKA"
FT   gene            complement(147156..148358)
FT                   /gene="tyrB"
FT                   /locus_tag="XAC0125"
FT   CDS_pept        complement(147156..148358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="XAC0125"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35017"
FT                   /db_xref="GOA:Q8PR41"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR41"
FT                   /protein_id="AAM35017.1"
FT                   /translation="MSFFANVEQVPGDPILGLTEAYNADSRPNKVNLGVGIYYDENGRI
FT                   PLLRAVHKIEQQLAQDAKPRGYLPIDGLAAYDKATQELLFGADSALVTSGRVATSQTVG
FT                   GSGALRVGADLLKKLLPTATIAISNPSWENHRAVFGAAGFEVVDYTYFDAAIHGLNFDG
FT                   MLADLAKLEPGTVVLLHACCHNPTGADLSKEQWKQVAGLLKERNLFPFVDIAYQGFDKG
FT                   IEADAYAVRLLAAEGIDSYVVASSYSKSFSLYGERVGALSVVSATAAEAKAVQSQVKRI
FT                   IRTIYSSPSTHGAALVAGVLTSPELRDLWEQELTEMRERIHSLRAGLVEKLATLGAPEF
FT                   DFIQRQAGMFSYSGLTKTQVDRLRDEFAIYAVGTGRICVAALSQRNLDYVAQAVATVSR
FT                   V"
FT   gene            148533..150653
FT                   /gene="yncD"
FT                   /locus_tag="XAC0126"
FT   CDS_pept        148533..150653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncD"
FT                   /locus_tag="XAC0126"
FT                   /product="iron transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35018"
FT                   /db_xref="GOA:Q8PR40"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR40"
FT                   /protein_id="AAM35018.1"
FT                   /translation="MAAACGLFATGATSPVLAADPAPPAATSIQRLPAVQVDAARVRGV
FT                   DDFDLPASFTVVAADDDNRRGAQVSELLDGIPGLVARDRQNYAQDTQLSIRGFGARSTF
FT                   GVRGVRLLVDGIPASMPDGQGQLSHFNVLGAQRVEVLRGPFSALYGNSSGGVLQLWSAD
FT                   GEPDDPWRLRATYGSNATVNVGAQVLGQQGAVHYNLAANHFDTDGFRAHSRAKRDSVNA
FT                   KLGFDLAEGRRLDLVLNYLDAPDAQDPLGLTRAQFNADPAQATSVATQFDTRKSVRQSQ
FT                   AGAIFTQRMDDQTLRLMAYGGQRSVEQFLAIPVAVQRNPLHSGGVIDLDSNYEGADARW
FT                   AWQGEALGRPLQLTVGTNVDRQRQHRTGYENFVGDTLGVKGALRRDQRDEVENVDQFAQ
FT                   LWWQWSDRWSALLGVRHSDVRFASDDHYIVGRNPDDSGRRDYSATTPVAGIVFRADENL
FT                   RFYASVGRGFETPTFNELGYRSDGGAGLALDLGAATSRNYEVGSKWRAQSGAALEFTVF
FT                   RADTDDELAVASNTNGRSTYRNIGATRRQGAELSWQQPIGATQQLQLAYTFVDATVRDG
FT                   YLTCASSGCATPTAAVASGSRLPGVPRQQLFARWQWQPAQWQLAAESVASGATVVNDLA
FT                   TERAPGYALVNLEASRRWSTPQGALRTFARIDNVLDRQYVGSVIVNDGNGRYYEPGPDR
FT                   TYTVGLQWDFGG"
FT   gene            150831..151235
FT                   /locus_tag="XAC0127"
FT   CDS_pept        150831..151235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35019"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR39"
FT                   /protein_id="AAM35019.1"
FT                   /translation="MHTARRSAPGRDKAIPPTHGLPSTCHTRAHHIRPTMIVIDHAPAD
FT                   WFLLRADNRYWLDINCTISATGFSLLLALNATEQADVLADGHAACARLAAQVQWRPHDF
FT                   AARDVGASHGAQVAAAVRAWRAAGTSNARA"
FT   gene            151370..151741
FT                   /locus_tag="XAC0128"
FT   CDS_pept        151370..151741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35020"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR38"
FT                   /protein_id="AAM35020.1"
FT                   /translation="MNTRYAPIDFSDKLALLSQHWSPRVVAEMNDYQFKLVKLQGAFVW
FT                   HRHADTDEVFIVLDGNMTIEFRDGVVALSAGQMHVVPKGVEHRPAAEHECSVLLVEPRG
FT                   VVNTGDAGGAYTADNDVWI"
FT   gene            151964..153493
FT                   /gene="aldA"
FT                   /locus_tag="XAC0129"
FT   CDS_pept        151964..153493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /locus_tag="XAC0129"
FT                   /product="chloroacetaldehyde dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35021"
FT                   /db_xref="GOA:Q8PR37"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR37"
FT                   /protein_id="AAM35021.1"
FT                   /translation="MNALASAKSLNNDPHSIFKPRYDNFIGGQWVAPHSGQYFDNTTPI
FT                   NGKVFTSIARSTAPDIEAALDAAHAAKDAWGKTSTTERSNVLLKIADRIEQNLELLAYA
FT                   ETWDNGKPVRETLNADVPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQ
FT                   IIPWNFPLLMACWKLAPALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGF
FT                   GLEAGKPLASNPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAE
FT                   DDDFLDKAVEGFVLFAFNQGEVCTCPSRALIQESIYDAFMEKALSRVAAIKQGNPLDPN
FT                   TMVGAQASSEQLEKILSYIDIGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKM
FT                   RVFQEEIFGPVVSVTTFKDEADALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVW
FT                   TNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSPKALGFF"
FT   gene            153671..154066
FT                   /locus_tag="XAC0130"
FT   CDS_pept        153671..154066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35022"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR36"
FT                   /protein_id="AAM35022.1"
FT                   /translation="MQDSTTRVELPAQVTATLAALQLIDKLRAQHGDVLFHQSGGCCDG
FT                   SSPMCFAVGEFIVGDRDVLLGEIGGAPFYISAPQFGYWKHTQLIIDVVPGRGGMFSLEN
FT                   GEGVRFLVRSRLFDDDEFARLQQAGRA"
FT   gene            154464..154922
FT                   /locus_tag="XAC0131"
FT   CDS_pept        154464..154922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35023"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR35"
FT                   /protein_id="AAM35023.1"
FT                   /translation="MAHGSGVTDVSPQCRTVEPPMRPQDRRPDRRLFSAHVEPAPPRRA
FT                   HRSARMPDTAGVAQDFHCYSLADYQRRRRRGGPTWRDLSPAYAFARITHAADWPRGADI
FT                   DCEQALAAQWDSMRGASRLDWPHVRDIVEDAWLALDHIPEAAIHGAAH"
FT   gene            154922..155881
FT                   /locus_tag="XAC0132"
FT   CDS_pept        154922..155881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35024"
FT                   /db_xref="GOA:Q8PR34"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR34"
FT                   /protein_id="AAM35024.1"
FT                   /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLHFRMLDSRDKKPIRF
FT                   ERVNADTGDEVPWKEIVKAFEYDKGSYVIVEEQDIRSAAPESHETVEVETFVDAADIDP
FT                   RYFEKPYILVPGKKAEKGYVLLRETLRDTGKVGIAKVVIRTREYLAAVMPQGDALILLL
FT                   LRYQQEVVDPQDFKLPAGAVGEYRITPKEQEMAKQLIESMSGTWQPEDYHDEFRGKLEK
FT                   ILRRRIQEKGGTTTVDVEPPQHEDATTNVVDFMSLLQKSLQANTRTPAKKSSTADTASA
FT                   PAKKTATKKAAKKAVKKAAGKTTKKTAAKTAAPRRKAG"
FT   gene            complement(156019..157185)
FT                   /gene="lctD"
FT                   /locus_tag="XAC0133"
FT   CDS_pept        complement(156019..157185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctD"
FT                   /locus_tag="XAC0133"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35025"
FT                   /db_xref="GOA:Q8PR33"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR33"
FT                   /protein_id="AAM35025.1"
FT                   /translation="MIISAASDYRAAAEARLPPFLFHYIDGGAYAEHTLRRNVSDLADV
FT                   ALRQRVLRNMSDLRLSTELFGETLAMPVALAPVGLTGMYARRGEVQAARAAAARGIPFT
FT                   LSTVSVCPIEEVAPAIERPMWFQLYVLKDRGFMRNALERAKAAGVTTLVFTVDMPTPGA
FT                   RYRDAHSGMSGPNASLRRMLQAVTHPRWAWDVGLLGKPHDLGNISAYRGSPTGLQDYIG
FT                   WLGANFDPSIAWKDLEWIREFWTGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLD
FT                   GVLSSARALPAIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYALAAAG
FT                   QAGVENLLTLIEKEMRVAMTLTGTHSIADISADALSRVTRERADAISP"
FT   gene            157496..158680
FT                   /locus_tag="XAC0134"
FT   CDS_pept        157496..158680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0134"
FT                   /product="beta-lactamase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35026"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR32"
FT                   /protein_id="AAM35026.1"
FT                   /translation="MLCSGQAWAGGPGRPPAPDAITRTLQQHMDAAGIVGLGAAIIRDR
FT                   KVVWTGGVGFADRARGTPFTPDTVMNIGSISKTVTGVALMQAVQDGKLALDADINTYLP
FT                   FAVRNPQFPQVPITLRQLATHTSSLTDRWEVYRDTYRWQGLPVAPLGDFLRGYLAPGGR
FT                   DYQAQNYLPVKPGTHREYSNIGAGLVGYIVARAVGQSLERYTHTRIFAPLGMQHTAWHA
FT                   ADLPAAAQATLYVSQFGVSVPIPPYELTTYPDGGVRTSVNDLSRLFIALLDGGQYQGVR
FT                   ILDTTTTAQMLRFQYTAANTPDNVALNEKNSGIFWSTKYNVTRIGHGGSDPGVHTEMLS
FT                   DLAHDNAVVLISNTSLDSSDARVNAQLFDDLWAYAVELRQQAASAAGRRRPAPD"
FT   gene            158735..159961
FT                   /locus_tag="XAC0135"
FT   CDS_pept        158735..159961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0135"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35027"
FT                   /db_xref="GOA:Q8PR31"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR31"
FT                   /protein_id="AAM35027.1"
FT                   /translation="MPVCARAAAATGAAGHRSHLPEVTFCLRTIAERLHGGQHRRMNSS
FT                   FCHLLHPLRLAAAFTIAAVALSFMPDASAHGAWRWGALAGFTALFVLHTVLPQTHALRT
FT                   VATLLQAVLALLLVWIEPRAGTAPVLLVMLVAQAGMTWPPLRVLLLALALNAGMYAVLV
FT                   HAGFDRALLIVSIYAGFQAFAALTAHYARSAERARDALAYVNADLLATRALLADSARDA
FT                   ERLRLARELHDVAGHKLTAMRINLRLLSADPALAQRDEVAVVEQLSAELLSDIRNVVQS
FT                   LRDDQGLDLQTALRALAAPFPRPTLRLQIDADVRVTDARVAELLLRLVQEALTNAVRHA
FT                   DADEVAVHLHCEGAQLHVDICDDGRRAERIREGNGITGMRERLAALHGQLDLGRTPTGG
FT                   MHLIARLPV"
FT   gene            159958..160590
FT                   /locus_tag="XAC0136"
FT   CDS_pept        159958..160590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0136"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35028"
FT                   /db_xref="GOA:Q8PR30"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR30"
FT                   /protein_id="AAM35028.1"
FT                   /translation="MSSRRIALADDQILVRAGLRALLQQQGVEVVCEADDGQGLLDALA
FT                   IHTVDVVLSDIRMPGLDGIQALEHLRARGDRTPVLLLTTFDDSDLLLRASEAGAQGFLL
FT                   KDAAPEDLREAIERVAAGDTLLQPVSTDPVRARYQFRDQQAPRETFSEREVAILRLLAG
FT                   GYSNKEIARTLFLAEGTVKNYVSTILEKLGIRDRTRAVLKAITLRVI"
FT   gene            complement(160822..161553)
FT                   /locus_tag="XAC0137"
FT   CDS_pept        complement(160822..161553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35029"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR29"
FT                   /protein_id="AAM35029.1"
FT                   /translation="MTLDVYTSFRIDRVAARLACVGRSSRIAACCCLHLASIGRCTASA
FT                   APASGRRRGNGASQATTRARLYVGRPAQPLVALGSVAEGRLDLATGRPRTGHAGVRARV
FT                   VRASGLADLAWPTRQVLAPTVPIEAPDQPIAGMGSRRLRCRRVSHDGPHVAFGDRWDRQ
FT                   RSAGPADRQFGLGRRAPGAGGQHDDQHEPRPDQAHDGLRSRPERGASPGGLAGRRITFV
FT                   RGSAPDLTATLRLLAEADGCP"
FT   gene            161598..162116
FT                   /locus_tag="XAC0138"
FT   CDS_pept        161598..162116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0138"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35030"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR28"
FT                   /protein_id="AAM35030.1"
FT                   /translation="MSLYRVVCAVLMATCSLLTATGCAKQPTLSSRLIVSVDAPMLEKG
FT                   GAVIVLARPIPDRQWRHLESATSSDAGDEKQFQVTVASPASIIELHYPETGTYSFKLRP
FT                   AARAKPPFLQSRRVLIGQADLTDPQTKHQVHWPSMSVVHVSGNTYPEGWARILASTFDV
FT                   PFGSDAPDT"
FT   gene            complement(162369..162845)
FT                   /locus_tag="XAC0139"
FT   CDS_pept        complement(162369..162845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35031"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR27"
FT                   /protein_id="AAM35031.1"
FT                   /translation="MAVSSGLPPPGIRFPLCPALQGITNVMTDPQIIPITLTVAHVEFG
FT                   GNTGRGAYFYSFSPDLLIVGKGEQDVTLRYAFCKSVPHRFKIISLLNSDSTGQIGPQHI
FT                   DPDGRGVQVVNANRDRTLIFFSVVVKDTHTGNHFSCDPQVGNDPEISPTEFGRH"
FT   gene            complement(162764..166111)
FT                   /locus_tag="XAC0140"
FT   CDS_pept        complement(162764..166111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0140"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35032"
FT                   /db_xref="GOA:Q8PR26"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR26"
FT                   /protein_id="AAM35032.1"
FT                   /translation="MSLRSERVTQLGSVPRFRLGPLLVEPERLTLIDDGRTITLEPRMM
FT                   EVLIALAERAGEVISAEQLLIEVWHGSFYGDNPVHKTIAQLRRKLGDDSRQPRFIETIR
FT                   KRGYRLLPKVVFPDDYRGAVIGTPAWGHGNPYMGLQAFDPAHADVFFGRSHAIAQVLGA
FT                   LRAQLHSRRGLVLVSGASGCGKTSLLRAGVVPLLCQPGGLDGLEAIAVAYCNLAQCRGG
FT                   DVLDTLARALGQWAPGGRAVLSPAQTARLPEWLQQPAPLHAAIDEAMRQGAHARDNVHT
FT                   QRHLLLVIDHAEAMVATPGITAADRAALAAALHALCASAHVAVLMLTRSDFYPRLIDAL
FT                   PDIVELKRGDGHVDLLPPRDGEIGQIIRIPAAMAGLRFEEDHSGAGRLDDVLRDATARQ
FT                   PDALPLLQHLLHALHAQRSDDGVLTFAAYGALGGLEGALAHHAEQTFRALPSDARAALG
FT                   EVLTLLSVIHPDSDAVTARRALWSALPASSAARVLVDAFVHARLFVSELVAGEPGFAVA
FT                   HEALLRQWPRAAEWIHENRRLLQARKRLQLAAQRWATEGRRSDHLLNSGRPLSEAREAA
FT                   RRMPQDLDALDHAFLRACERSQRQRRGLYAAAAALLVVLASASLLLGWRARQAQQVAEQ
FT                   RRDQAQQLVGYMLGDLAEQLRTVGNLKLLDSVGSRALRYLEDLPRAGMATGDLINHARA
FT                   LRTTGEVLMNQGKLEEAQAAFTRAASTAEQAWTQAPEAAEAHAEIGQTAYWLGNMAYRS
FT                   KQFPLARTHWSQYLAASEWLVRTAPDDPHWQLELSYALNNLGTLARSEGQANTAIGLFA
FT                   RSIALKRQVLARTPDNASVRYELVDSLSWLSLAQETQGLLAPAEQGYREQIETLRLLVQ
FT                   HDPDANAWRRRMATSLVRTSNLALARGHLAQAQADAQASVGMLEPLVAQQPDNRTWRRD
FT                   LAHAYAQAGWVAALDGHAAAATRQLTQARQTLAGVLAHQPLPEWEWLDAIIALRLNRVQ
FT                   GLRGDRQTASLAAIVARLDALHQAKPADLIGVSALATALVWYGEQLDANGDHVGARAAW
FT                   QRTVAVLGADIGNSRDKTLLDPWIRAQIHLGRRAAVTQQLGWLYQAGYRHPGFVSLYAP
FT                   LFKESPTS"
FT   gene            166390..167598
FT                   /locus_tag="XAC0141"
FT   CDS_pept        166390..167598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35033"
FT                   /db_xref="GOA:Q8PR25"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR25"
FT                   /protein_id="AAM35033.1"
FT                   /translation="MIIHPKVRGFICTTTHPLGCERNVLEQIAATRARGVRTDGPKKVL
FT                   VIGASSGYGLASRITAAFGFGADTLGVFFEKPGTASKAGTAGWYNSAAFDKHAKAAGLY
FT                   SKSINGDAFSDAAREKVIELIKTEMGGQVDLMVYSLASPVRKLPGSGEVKRSALKPIGQ
FT                   TYTATAIDTNKDTIIQASIEPASAQEIEDTVTVMGGQDWELWIDALEGAGVLADGARSV
FT                   AFSYIGTEITWPIYWHGALGKAKVDLDHTAQRLNARLARRGGGANVAVLKSVVTQASAA
FT                   IPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLYREDGQPAQVDDENRLRLDDWEL
FT                   RDDVQDACKALWPQVTTENLFELTDYAGYKHEFLKLFGFERTDVDYDADVATDVSFDCI
FT                   ELG"
FT   gene            167716..168042
FT                   /locus_tag="XAC0142"
FT   CDS_pept        167716..168042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35034"
FT                   /db_xref="GOA:Q8PR24"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR24"
FT                   /protein_id="AAM35034.1"
FT                   /translation="MTNPHSLIPNPGPQWTNLSHLVLAFLVSGVCAVLLRFIRAHGALK
FT                   ALANPVITTAVVCAVVVQDGSAPPWQNALLIAAFFSVPASLCVVLVSAAMAWLINKRLA
FT                   RKPA"
FT   gene            complement(168202..169224)
FT                   /gene="kdgK"
FT                   /locus_tag="XAC0143"
FT   CDS_pept        complement(168202..169224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="XAC0143"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35035"
FT                   /db_xref="GOA:Q8PR23"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR23"
FT                   /protein_id="AAM35035.1"
FT                   /translation="MSRASILCFGELLLRLGAPGHELLLQQPRLDVHCGGAEANVGVSL
FT                   AHFGHDVAMVSTVADNPLGAAVLGELRRHDVDTRHVRRVDGRMGLYFLTTGAIHRPSEV
FT                   IYDRADSAFALAPADAYDWPRLLEGVQWLHLSGVSPALGAEVAQATLAAARAARAAGVK
FT                   VSFDGNYRPKLWQRWQGDARGILHQLFACADVVFADYRDIGVVLGGEFAQDTLEARVEA
FT                   AAQHAFAAFPQLQLMACTQRVAHHVDHHSLGAMLVPRQGAVARAPSEELTPIIDRIGGG
FT                   DAFAAGVLHGLIEGWSLEDTVRFGLAAGCLKHSIPGDFNPLSVADVQACVGDARFDVRR
FT                   "
FT   gene            169510..172290
FT                   /gene="iroN"
FT                   /locus_tag="XAC0144"
FT   CDS_pept        169510..172290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iroN"
FT                   /locus_tag="XAC0144"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35036"
FT                   /db_xref="GOA:Q8PR22"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR22"
FT                   /protein_id="AAM35036.1"
FT                   /translation="MQFRTTSRKTPVTLLALSIGLALSGQAAAQDAAQSPAEPAVDLDT
FT                   VTVTGYRASVEKALDIKRGEAGVVDAIVAEDIGKFPDLNLAESLQRIPGVVITRDAGEG
FT                   RAITVRGLGPEFTRVRINGMEALTTVGAGDQSGGTNRGRGFDFNVFASDLFSQLIARKT
FT                   ASADVEEGSLGATVDLRTARPFDYSGFTFAASGQAAYNAMAEKANPRVAALIANTWADN
FT                   TFGALLSVAYTERQVLEEGSNTGRWANGTSNGNFSAASPFAAARSADVYHPRFPRYVQM
FT                   EHDQQRLGVTGSLQWKPTDRTTISLDALYSKIDATRDEHYIEAISFSRGRDSGTPRRAD
FT                   RDGKPATIVRNGEIRNNALVYGEFDNVDIRSENRHDEWNTEFKQVSLDLEHRFSDAFSV
FT                   SGRVGTSRSAHENPVQTTIIMDKYDVDGYSYDYRGNNRAPVLNYGIDPTNPAGWELAEI
FT                   RLRPQTVDNDFDTAQIDFNWNISPGFRLKGGVLAKDYTFSTVELRRASEIAVPTFADGT
FT                   RIVPTDLTEQAGLKGINGSPSNWIVPNLDAVANQLGIYSNAGTYAVAPRANNTRSVEEK
FT                   DRGVWLMGEFSTDLGSIPLSGNVGVRYVRTEQESTGYALINNAPALTTVGRKYNNTLPS
FT                   FNLVAELAPDLLLRLGAAKVMSRPGLGSLTPGVTVAVAGGARTVSGGNPDLDPIEATNV
FT                   DLGLEWYFNEGAMLGVGVFYKDIESFIQTAREVRPYASSGLPASLLDGTGASINDDFTF
FT                   SIPLNTPGGELKGVEANYVQPFTFLPGKWANLGVQLNYTWVDSQIQYLSSTGAPVMKND
FT                   LTGLSRSSWNATLFYEGESFAGRISATNRDDYLTQAPGTEAGFNVDGVHGMSGTTMIDA
FT                   SLRYKISKQLELSLEGINLTNEASDEWVWSPQTGELPLQYTETGRQYLLGLRYKF"
FT   gene            172547..176515
FT                   /locus_tag="XAC0145"
FT   CDS_pept        172547..176515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35037"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR21"
FT                   /protein_id="AAM35037.1"
FT                   /translation="MRQTRAGVGLSSPCSFEYSPRGDPVRRCFLRSRAVSVQKWWMGVL
FT                   LLIALPMRAAAADAPELLFRVSADQSLQADVARGDGVPNFRDKIALVPTGKRGNAIEWA
FT                   DDGVLSWNAPGNLYTQRGTLGFFWRSRYPVGEAPFVIFRVGYADHTSWDMAWLRIDWNG
FT                   HGFDAFVTDANLARTRVSFKLDKAPAASDWTHIAFAWDETRGVRLYVDGKEAARADCGA
FT                   PCANGGSLDYAAALDQFGLAGRVMSPHQVQSRYNFLRGSDFDEIRIYDRMLDASGAAAL
FT                   ARLQEPTTAPAIAADAQHAAFLHRYGWNNGHAPPALTAPVTRIRKVEFTDARDLKQWMW
FT                   KATDGIAETTWPGVYNRSRLPGRNDYFQLPDWNTYVEGGKALDLTLPDEPFNRIELRGA
FT                   AYGQATYAAPNAQPQPLFARQQGVVRSVDQFEERRGGTLRFANSAQETPIQEIWAYNVQ
FT                   PGEVPNGSAQLSYTVRSDIQSDYDNLAPLRAVIAGRYPPGERQTVIALPTKAPARKRPS
FT                   DKAAASAQQPIVHILVPSSLGDPPPDQALMRSWSYGWENMHDGLDGIAITLPALNLPAT
FT                   HNGSIPLNIRIKDPIWPARDMIDVSVAVAPGQARTLWLDLRDRILSNDSLMLSIAAAAP
FT                   GFDANALDGTQLQLVFKPRAEAITEHVADRFNQVKDNWGFLVEEHTTSKRQLLYKRLDA
FT                   DITDLLRVDPDNALGREYWNDISYANQGELPVDLPAVPKGVPAWAFWQLQDLSATRRYI
FT                   RWWIEQRQVAYGDFGGGISDDSDLVQQWPGVALMGVDPDMLNASMLALSDANYRNGMFT
FT                   NGLSTIETDELHSYEEGINLNSALLYLNWGDPRTVERLMQTVKAFDTIIQVNPQGHLLF
FT                   ASNWFGGRKVHREPNWQWQKPYSFPIVHPAILLGGYNADSNSRRIVTGLADGYLAHAYT
FT                   NVKGNWALPNEINWQTGKTRGGELFEGSGGADTLHTFWAAYRFTGDARYLKPIDYRVAN
FT                   SGPNGLSLLNENFLDVMGKRSDWSAKLIDAANKDDESAPDFPHHVAWEQTGNLDYLASI
FT                   YRSETREKLQNFYMNTEGHWWSDRVESPTVNLQRARLGGVALKRNQTYPGHTVSWRFAD
FT                   PEAATQVAIAIPAPRQDRFTVIAYNTSSKPQRASMTGWNVAPGQWRITQGADRDGDGKL
FT                   DSNAKTQEVAFEKSASIDIDFPAGRTTVLQLERIAESSPVELRPDLGIGHGDVRVTADA
FT                   IEVTVHSLGHANAPAGFVVLEDAREKELARAAFPALAAPRDLRPITTQVRLPLANAANL
FT                   KATQLRVITDNNVAEITDLNNKLPLPTSTTAPTTKNSP"
FT   gene            176661..177356
FT                   /locus_tag="XAC0146"
FT   CDS_pept        176661..177356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0146"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35038"
FT                   /db_xref="GOA:Q8PR20"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR20"
FT                   /protein_id="AAM35038.1"
FT                   /translation="MQPQSHTFLQGGRNNVEQGMEHRGTDCGCTGIICRIRASARQGRR
FT                   FAPHHQSRRSLQRRPRRLAQGWQLPQHQYQQPLSASQVLAGLKPTPLGSAAYARTRTRR
FT                   MRYQKFLKLMAGLAGVMLAATGALLVALFAAGQVREGQTGALISGIGFLVMAAPALATP
FT                   FSLRAAKRLLMLTLCCLAALAIWLCFWPKEGVTPTLHLRIAVLAFPVLLTFRLFLARHR
FT                   KMTKINTDN"
FT   gene            177709..179226
FT                   /locus_tag="XAC0147"
FT   CDS_pept        177709..179226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35039"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR19"
FT                   /protein_id="AAM35039.1"
FT                   /translation="MAILSEAALDFAKAHIEKYYDSDFFPKAFEFEALWHQWPQVKQEL
FT                   RSKNISKMLVPNPYNSTIQKARGGYRVVHQLEPMEAIAYTAMAYEVGGSIEAMRAPATH
FT                   RIACSYRINIANGNFFVGGSGWGDFKAKSQELANENKFAAITDISDFYNQIYLHRLQNA
FT                   IEASGPAHKSLASDIEDFLLALNNKASQGVPVGPAASIVMAEAVLIDIDSFISQCGVLH
FT                   TRYVDDIRIFSNSAAKLAETLEKLTLYLYENHRLTLATDKTKLMPSEDFIENHLHNPYL
FT                   DDKDELMEELDNISPYGGEDEDEDEGLDDDDIGETLAGALYKILEFDYIDLGLARSIIR
FT                   TARRNKIPNIITILLENFEYFAPVTPDIFLYLEELFDASTAAIIRAKLEKVCDMQEANC
FT                   ALVRIWLEHFIASHSSLLANQKLRIFVMTGPNIENKARAAITLGDIAWVRTHKGQIYNV
FT                   GARARRSIINSARVLPSDERNPWLTLVAQNAALPLERWLAGWVKETA"
FT   gene            complement(179328..180542)
FT                   /locus_tag="XAC0148"
FT   CDS_pept        complement(179328..180542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0148"
FT                   /product="ISxac1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35040"
FT                   /db_xref="GOA:Q9Z3E5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3E5"
FT                   /protein_id="AAM35040.1"
FT                   /translation="MRASEVLQKCLSNSLSGMHALRQRTLLGAVEALVHGGRLTLIDIA
FT                   RAWPGATRVRAPLKACDRLLCNRTLQAERSMIERDMAHWLLRGDQPVIVIDWSDLKPDK
FT                   SWCLLRAAVPIGGRTLTLLDMVVAGKQQGSPGAEKRFLQQLRRMIPDDVRPILVTDAGF
FT                   RTPWFRAVSAMGWDWVGRLRGRTQVKPQDVPDDAAQWIDSRRLHALASNRACELPPMQA
FT                   NRSDPLDCRLVLYAKTRLGRQQRNRRSPAKVSRASSSLKAAAREREPWLIVASPQLQAP
FT                   SAKHLVNLYARRMQIELAFRDLKSHRYGQAMEDSLTRRGERLQILLLLNTLATFASWLA
FT                   GLGCEATGIAQWLSPRSSTRKLYSTLRVGRQALARRWPMEPVSRWLERLRTLPEAVREQ
FT                   MTLVL"
FT   gene            180838..182022
FT                   /locus_tag="XAC0149"
FT   CDS_pept        180838..182022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0149"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35041"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR18"
FT                   /protein_id="AAM35041.1"
FT                   /translation="MPSTMKIESEFVEQLSSVHPRDLIEILQSEDRPHFDNHWKIFNEI
FT                   KPGDLYCYLYGRFGPPNGIQNFLRGDHSENLIHWEWALASQGRIILVQGHNFRTEIWVS
FT                   GDDLGAEALDQLVVCVKDDFPKHGQAMGKVRKTLEHWVEFINPYHRIRSSVECLMSEIE
FT                   ALDVEEKTSQLGGFGEYESPEQWANEWERQAEIVAKATGLCFGARAMLPVMAEAFVNLL
FT                   MYLLMKPNLKQDDRLRENLIRQPIDVRIKSLAHNCVGFQSEIDYSHESCRRYHSMVNER
FT                   NDLLHGNVVIEKLRFNELHFNGRVPVFGSYASMWERAFGVAKRSVGLEVLRDERQVVEG
FT                   FVEYVISRLNEKRQEQVRIFCARRDLGICLDDGRLGVLFSGQLVDMAPGPRVRG"
FT   gene            complement(182546..183334)
FT                   /locus_tag="XAC0150"
FT   CDS_pept        complement(182546..183334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0150"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35042"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR17"
FT                   /protein_id="AAM35042.1"
FT                   /translation="MDPFAPPLTSQCCLCGSTEALSGEHKLKAAALRSEFGAQPMVIGR
FT                   PGERYRHAQSPSSKQFHFSARICGTCNNARTQPADLAFDAFRALASDLLKTGKDPAKVH
FT                   EDPRFNASGGTLYLDVFRYFAKLMCCHLAEMGATFYEPIADFAIGISDNNYVLLCVDAD
FT                   VAYRRLQENGAIHSYAAHGGLIVTGNPQSHAPEAFHSTLTIGPVRYCYRIHLNEVGQAQ
FT                   LQHEHPDFYEWCQRRIRHAMDNPMSDDDRELLGLNGANEK"
FT   gene            complement(183490..184254)
FT                   /locus_tag="XAC0151"
FT   CDS_pept        complement(183490..184254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0151"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35043"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR16"
FT                   /protein_id="AAM35043.1"
FT                   /translation="MALRCLGNPGRIIGPHGDSDYRNYYGVNPISHIAQNYAHLAHDRQ
FT                   PPEVRIDLKSLGLDPRQLERNGLELGPAKTFNILDLGKDGYGMVQLRNAGTRGVSSPNL
FT                   AAPNEPGRALTPAEAGHPDHAMHQQIRSKVEQLDAANGRTFDATSERMTASLLTLAKDN
FT                   GLTRVDHVLLSEKTRDSPAAQTLFVVQGDPKDPAMLRAHMPTADAAQRPVQESFTQLES
FT                   VNQRLAQERTQDLAVEQQRSQEQQHRGPVPSR"
FT   gene            184281..184553
FT                   /locus_tag="XAC0152"
FT   CDS_pept        184281..184553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0152"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35044"
FT                   /db_xref="GOA:Q8NKZ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NKZ0"
FT                   /protein_id="AAM35044.1"
FT                   /translation="MSSKRYTDEFKIEAVRQVTDRGFKVAEVAERLGVTTHSLYAWLRK
FT                   FGKPGVVQRAEADQSAEVRRLKIELRRVTEERDILKKAAAYFAKG"
FT   gene            184607..185425
FT                   /locus_tag="XAC0153"
FT   CDS_pept        184607..185425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0153"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35045"
FT                   /db_xref="GOA:Q8NL47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NL47"
FT                   /protein_id="AAM35045.1"
FT                   /translation="MCRVLRVNRAGYYAWLKSPDSERAKEDERLLGLIKHHWLASGSVY
FT                   GHRKIAKDLRDLGERCSRHRVHRLMRTEGLRAQVGYGRKPRFHGGTPCKAAANLLDRQF
FT                   DVTEPDTAWASDFTFIRTHEGWMYLAVVIDLFSRQVVGWAMRDRADTELVVQALLSAVW
FT                   RRKPSAGCLVHSDQGSVYTSDDWRSFLASHGLVCSMSRRGNCHDNAPVESFFGLLKRER
FT                   IRRRIYPTKDAARAEVFDYIEMFYNPQRRHGSTGDLSPVEFERRYAQRGS"
FT   gene            187246..189237
FT                   /locus_tag="XAC0154"
FT   CDS_pept        187246..189237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0154"
FT                   /product="alpha-amylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35046"
FT                   /db_xref="GOA:Q8PR15"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR15"
FT                   /protein_id="AAM35046.1"
FT                   /translation="MRPRAQTAGTWPRVCIESVTPSVDNGRFPVKRTVGDRICVEADAF
FT                   CDGHDRIAVAVLWRPADAKAWASAPMRALGNDRWRAEFPLERIGTYEFRVEAWRDVFAT
FT                   LHADLEKKRAANTVLPVDVQEAVAAVQAAQARSDGALAERLQTVLTRIGAQSEPLQQLA
FT                   IVLEPDTAQAMALADDKPFRSEYPVTFRVESERRAAHFSSWYELFPRSQSGDASRHGTF
FT                   DDVIKRLPHIRAMNFDVLYMPPIHPIGLNNRKGRNNSVTAVEGEPGSPYAIGATDGGHT
FT                   EVHAELGGLEGFRRLIEAARAQGLEVALDFAIQCAPDHPWLKEHKDWFTWRADGSIPYA
FT                   ENPPKKYQDIVNVDFYASGAVPDLWNTLRDAVLFWVNEGVTLFRVDNPHTKPFPFWEWL
FT                   IADVRGRRPDVVFLSEAFTRPKMMYRLAKCGFSQSYTYFTWRNHKHELQAYVEELNDGV
FT                   PRECFRPHFFVNTPDINPLFLQTSGRNGHLIRAALATTLSGLWGMYQGFELCEATPLAP
FT                   GKEEYLDSEKFQLRAWPERVPGDIVEEITRFNQLRRMHPELQSHLGTRFYQAHNDQVLY
FT                   YGKFLDAGYLSRSRSMVLVAINLDPHAGQDADIEIPLWELGLPDHASVAVEDLWDGHRF
FT                   AWHGKYQHIRLEATRPFALWRIRAGEVA"
FT   gene            189234..192584
FT                   /locus_tag="XAC0155"
FT   CDS_pept        189234..192584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0155"
FT                   /product="trehalose synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35047"
FT                   /db_xref="GOA:Q8PR14"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR14"
FT                   /protein_id="AAM35047.1"
FT                   /translation="MNAVASLQADAEQSAVVADQRWYKDAIIYQVHVKSFFDSNDDGIG
FT                   DFPGLISKLDYIAELGVDTIWLLPFYPSPRRDDGYDIAEYMAVHPDYGSIEDFEHLVAH
FT                   AHARGIRIVTELVINHTSDQHPWFQRARNAPAGSPERDFYVWSDTDQEYEGTRIIFCDT
FT                   EKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPAVLDAVLEVMRFWLDRGVDGLRLDAVPY
FT                   LIERAGTSNENLPETHAILRKIRATLDAEYPDRMLLAEANMWPEDTQQYFGQNADECHM
FT                   AFHFPLMPRMYMAIAREDRFPITDIMRQTPEIPESCQWAIFLRNHDELTLEMVTDSERD
FT                   YLWQTYAADRRARINLGIRRRLAPLLERDRRRIELMTSLLLTMPGTPVLYYGDEIGMGD
FT                   NIHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPPVMDPLYGFQAVNVEAQIRDQHSL
FT                   LTWTRRVLSVRKRYQAFGRGSLRFLYPGNRRMLAYLRCYQDETVLCVANLSHTLQAVEL
FT                   DLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPPFGFYAFQLVSEGTLPDWHVPSPVPLP
FT                   DYRTLVLRSDADESAALLPHLPTLEGEILPAWLSARRWFSAKDQVLRSVRIARRTPLPG
FT                   DEPMTLLELEVALEDGRHERYMLPVGIVWEREQPSTLAEQLALARVRQGREVGYLTDAF
FT                   ALKPMVRGVIDALRSHAALDFCDGDDAAQQGQVCFEATPALATLDIPQDPEIRWLSAEQ
FT                   SNSSLVVADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAAPLLGSVSRIGGQGTVTT
FT                   IALLQGFIRNQGDAWRWTLDHLARSFDEYATAQTDEARAEAVAGYDAFAAVVGKRLAEL
FT                   HEALSRGTDDADFAPQRIDLPTANDVVAGVGRQVEEMWETVNARLAGSEDSAEREALEA
FT                   VLAQRPQLDALLAKAPSVLADSLLTRVHGDFHLGQILVAFDDVVLIDFEGEPAKPLAER
FT                   RAKASPLRDVAGFLRSLDYASEVSARGEEGTAARAGVGVDTHLDQFLVQFRRRSTQAFL
FT                   DAYHAVLDASAHPWIAPAAFNAATLLFLVEKACYEVRYEAANRPGWLMVPIEGLRRILQ
FT                   RARAGAGDT"
FT   gene            192605..194779
FT                   /gene="glgB1"
FT                   /locus_tag="XAC0156"
FT   CDS_pept        192605..194779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB1"
FT                   /locus_tag="XAC0156"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35048"
FT                   /db_xref="GOA:Q8PR13"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR13"
FT                   /protein_id="AAM35048.1"
FT                   /translation="MSNRWDSGVVRALAEARHGDAFAVLGAHPSDKGRLLRTYLPGADR
FT                   VGAVLDDGQVVALDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAFGPQLSDFD
FT                   LHLISEGHHLQLADALGANVVEVEGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRL
FT                   RHQSGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPH
FT                   QWSDDGWMATRARRQAHDAPMSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTH
FT                   VELMPVSEHPFGGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFP
FT                   TDAHGLAHFDGTALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDG
FT                   LRVDAVASMLYRDYSRNAGEWIPNIHGGRENYETIAFLRRLNEVVREHTPGAVMIAEES
FT                   TAFPGVTAEVAHGGLGFHYKWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMVYAYSERF
FT                   VLPISHDEVVHGKGSLLGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEW
FT                   NHDAGLPWHLLDDPRHRGVQTLVRDLNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVV
FT                   AFLRKGKRGDAPVLVVINFTPVVQHAYRIGVPQGGQWREVFNSDAGIYGGSNLGNGGSV
FT                   TAEQQSMHGHAQSLPLLLPPLGAIVLTPYG"
FT   gene            194972..195466
FT                   /locus_tag="XAC0157"
FT   CDS_pept        194972..195466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35049"
FT                   /db_xref="GOA:Q8PR12"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR12"
FT                   /protein_id="AAM35049.1"
FT                   /translation="MIERKRGDGQTGTGTRIGVISDTHGLLRPEALAALEGCAHIIHAG
FT                   DVGKPQVLEALRALAPLHAIAGNIDDKPWAAGLPQTLDLQIDGVRIHVLHDLKTLAPQV
FT                   QADVVISGHSHKPLVHMHDGVLYLNPGSAGPRRFSLPISVATLWLGDGAPRARVQPLAL
FT                   V"
FT   gene            195646..196695
FT                   /locus_tag="XAC0158"
FT   CDS_pept        195646..196695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0158"
FT                   /product="L-fucose dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35050"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR11"
FT                   /protein_id="AAM35050.1"
FT                   /translation="MPTRGKTDAGALPTNPLVKGGRYRPGSRLGFGGVAIGNGFAPATD
FT                   AQSEQTLAAVWESGVRYFDTSPWYGLGLSERRTGHHLHNHPADDYVLSTKVGRLLTATD
FT                   TPPKTMWQQPSPFDYRYDYSASGVRRSIEDSLQRLGVSQIDIAYIHDLSPENEKDLGMP
FT                   WEQRFAEAVKGAMPELTKMRKEGLIKAWGFGVNRPEPALRAIEEADPDIFLLACQYSLL
FT                   DHAQALHDTFPKIAKHGASVVIGAPLLAGYLAGRERYLYDGTIPPWAPAKRQKALAICD
FT                   RYGVDLRTVALQFAAAPQVVSAVIPGARTAEQARANASSMRVAIPSAVWEALKREGVIE
FT                   ADAPVPAAR"
FT   gene            complement(196741..198219)
FT                   /gene="estA1"
FT                   /locus_tag="XAC0159"
FT   CDS_pept        complement(196741..198219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA1"
FT                   /locus_tag="XAC0159"
FT                   /product="carboxylesterase type B"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35051"
FT                   /db_xref="GOA:Q8PR10"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR10"
FT                   /protein_id="AAM35051.1"
FT                   /translation="MRGGALRGYRDQGVCVFKGIPYGGDTAPRRFQAPLQETPWHHVRD
FT                   ASGFGAAAPQPKASEPTSEDCLFLNVWTPGLRDGGKRPVLFYIHGGGYTTGSGSDPLYD
FT                   GVRLCKRGDVVVVTVNHRLNLFGYLSLAQLGDASFADSGNAGQLDLIQALQWVRQHAAE
FT                   FGGDAGNVTVFGQSGGGAKIATLMAMPAARGLFHRAWTMSGQQVTVAGPRAATQRAQLL
FT                   LDALKISPSEIARMRTLPVAQLLGAAHVRDPSRVESTALYFGPVLDARNVPVHPFWPTA
FT                   PVQSARIPMVIGNTRDETRGFLGNDAKNFALSWDELPARLEAQQYVDLLPQVVIAEYRR
FT                   LYPQYTPSQVFFAATTAGRSWRGAVEEAQARARQGAPTWVYQLDWGSPLDGGKFGAFHT
FT                   LDIPLVFDNVRQPGSRTGDGADAQRMAEQMSEALLAFARQGDPNRRGAPYWKPYSLKRR
FT                   ETLVFDTPSRLELDPRGGERLLYQQAPFIQRGTF"
FT   gene            complement(198360..199391)
FT                   /gene="xynB"
FT                   /locus_tag="XAC0160"
FT   CDS_pept        complement(198360..199391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="XAC0160"
FT                   /product="xylanase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35052"
FT                   /db_xref="GOA:Q8PR09"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR09"
FT                   /protein_id="AAM35052.1"
FT                   /translation="MTALSRATRHGLAVLVLGALLAGPAPAAERPSADTAAEQASRIAL
FT                   WPTPLAPGDTALPQPQRIVERSSEPTQPDRYIQQVSTPYLVVYRPKQPNGTALLVTPGG
FT                   GYQRIVLDNEGSALVPGFVDVAGITLFVLRYRLPGEGHPNGADVPLADAQRALRLIRAN
FT                   AARYGIDAQRVGVMGFSAGGHVAASLGTRYAAQVYPPIDAADALSARPDFQLLIYPVID
FT                   MDSANAHKGSRERLLGSAPSQAQVQAYSPQLHVDARTPPTFLLHAQDDSVVPVRNSLLM
FT                   HDALLRAGVPSELHVFPQGGHGFGTASGSGLTVSAWPQLAQAWIAHVAKPAPTPTPAKE
FT                   MAR"
FT   gene            199558..200379
FT                   /gene="mhpD"
FT                   /locus_tag="XAC0161"
FT   CDS_pept        199558..200379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="XAC0161"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35053"
FT                   /db_xref="GOA:Q8PR08"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR08"
FT                   /protein_id="AAM35053.1"
FT                   /translation="MSNDAATPPSSTPALSAIAQRFVEARRAGASLPDFPGQIPDDLVT
FT                   AYQVQDIAISQWHDHVVGWKVGYIAAERRDASGDERLLGPIFSRKVWNATGGTTEFPIF
FT                   VGGFGAVEAEYVLMLGADAPADQTHFTPEQAAELPATLFIGVEIASSPLATINQLGPRV
FT                   VISDFGNNNGLILGPEVTDWLARDEAALTAQTLIDEKVVGTGGATTLPGGLRAAYAFAL
FT                   SRSAQRGRPLKRGDLIATGNATGIHDIEVGQRALIRFAGIGDISCTAVSAS"
FT   gene            200417..201415
FT                   /gene="dctP"
FT                   /locus_tag="XAC0162"
FT   CDS_pept        200417..201415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="XAC0162"
FT                   /product="C4-dicarboxylate transport system"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35054"
FT                   /db_xref="GOA:Q8PR07"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR07"
FT                   /protein_id="AAM35054.1"
FT                   /translation="MITRRHFLGAGLGAAAAAPWLGAGATTPVPGGQLLTATDVHVGDY
FT                   PTVEAVRWFGKQLEERTNGRLKLRQYHSGQLGRESEAIDMARFGAIDITRVYSGALNNT
FT                   FPLTQALCLPYVFDSVPHLRRAIDGHVGDSVLRSFEQRDLVGLAIYDSGARCFYNTKHP
FT                   LHRPEDLKGLKLRVASSDIFLKLMRMLGANPTPMSLGETFSAMETHMIDGAENNMRSFQ
FT                   SSRHFEAAHYWSQSEHSYAPDILVMSRQSFQSLSAADRGLVVELARASVPVMRNLWDAS
FT                   ETVARKQVIDYGVKLNQVDMPAFRAAAAPLLAEYRKQPEIETLYRRIRDFA"
FT   gene            201534..201947
FT                   /gene="dctQ"
FT                   /locus_tag="XAC0163"
FT   CDS_pept        201534..201947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ"
FT                   /locus_tag="XAC0163"
FT                   /product="C4-dicarboxylate membrane transport protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35055"
FT                   /db_xref="GOA:Q8PR06"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR06"
FT                   /protein_id="AAM35055.1"
FT                   /translation="MVVQGWQVFTRYVLNDSPSWTEPVTLLLLSTALSLGAAAGVHTNR
FT                   HFGFYLLGDHVPPLVRKMFEVIRPLMILSIGTVLAWWSAALLVDGLDIKMAGAQMPQSI
FT                   NYLPLSIGGALMVLFAVFKLWRVLRPVHVGGVR"
FT   gene            201947..203230
FT                   /gene="ygiK"
FT                   /locus_tag="XAC0164"
FT   CDS_pept        201947..203230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygiK"
FT                   /locus_tag="XAC0164"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35056"
FT                   /db_xref="GOA:Q8PR05"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR05"
FT                   /protein_id="AAM35056.1"
FT                   /translation="MGIAMLLGTFVVLLLIGVPVAYALGAAALATLLYLDLPMVVLVQQ
FT                   ISAGSGSASLIAIPLFIFAGELMLRGGISERLIALASSLVGRVRGGLGQVSVLSSLFFG
FT                   GVSGSAIADVSAVGGTMIPQMIKRGYDRDYAVNVSMTAALVALLVPPSHNLILFSAAAG
FT                   GGLSIADLFAAGIFPALLMTAAMMVTGYAVARHRGYGTEAFPGWRAVALRLIGALPGLG
FT                   LVGLIFIGIRAGIFTAVESAAIAVVYALIVTALLYRQLRWAEFFAAVTHAARTTGVILF
FT                   VIATAAVFGWLLAYLQVPAAAVKFLQAIADSKNTVLLMIVVMLLLLGMFMDLAPKILIC
FT                   TPIFLPVVKAYGIDPIHFGLVMVLAGGIGLITPPIGSVLFIGTSIGQITIAQSMRTIWP
FT                   FWLAALCVLLIVAFFPELSLWLPRALRA"
FT   gene            203483..205009
FT                   /locus_tag="XAC0165"
FT   CDS_pept        203483..205009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0165"
FT                   /product="xylosidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark; arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35057"
FT                   /db_xref="GOA:Q8PR04"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR04"
FT                   /protein_id="AAM35057.1"
FT                   /translation="MCAGLSAAADWKRGIEHQRIADQGDGRFLNPVLAGDHPDPSVLKD
FT                   GDDYYLTLSSFDAYPGLPIWHSRDLVNWQPLGHAITQNVGAIWAPDLIKHGKRYYIYFP
FT                   ARRGDQGERSNFVVWADDITGPWSAPIDIGLGKYIDPGHAVGEDGKRYLFLSGGDYVQL
FT                   SDDGLKVVGTPRHVYDGWKYPESWDVEGYAQEGPKITRHNGWYYMTTAVGGTAGPPTGH
FT                   MVITARSRSIHGPWQNAPNNPITRTSSADEPWWSRGHATLVEGTDGRWWMLYHGYEHGY
FT                   WTLGRQALLDPIEWTPDGWFAAKGGDLGTPLKKPSGQALAHGMALSDDFRAARLGPQWA
FT                   FFDPAADEAKRLQVGNGVLRLQGKGTAPRNASPLTVIATDPAYQFEVQMTVAPGGQGGA
FT                   LLFYSDKLYAGVGSNGQQFVMHRYGEERPATLSPSTTGGTLWLRVTNNRHIVTIHSSPD
FT                   GKTWTKYPVQMEVSGYHHNVAGKFLALKPALYAAGPGQVEFRNFRYRALD"
FT   gene            205185..206213
FT                   /locus_tag="XAC0166"
FT   CDS_pept        205185..206213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0166"
FT                   /product="transcriptional regulator lacI family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35058"
FT                   /db_xref="GOA:Q8PR03"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR03"
FT                   /protein_id="AAM35058.1"
FT                   /translation="MPGLPKGRVATINDIARMSGVSKKTVSRIINNSPLVRQDTREKVE
FT                   ALMREVGYAPDPLARGLAFRRSFLIGMVYDNPTAQYIVDMQYGALDALRGSSFELVVHP
FT                   CDSRSPGYIEGVRRFAQAQKLHGVILVPRASEDQALADMLAEIGCRYTRIASIALDATS
FT                   QTVITHDRDGAAEAADYLLSLGHRDIALVTGPSAYRSSIERTSGFADALTRRGIELPPE
FT                   RIVEAGYTFESGVAAAEKLLLGKKRPTAIFTGNDEMAAGIYKVALRAGINIPRQLSVIG
FT                   YDDSSLASRLWPPLTSVRRHTRDTGRTAAAMLIQPDNAPQLPTASVRPHLIVRDSCQPP
FT                   ED"
FT   gene            206563..206964
FT                   /locus_tag="XAC0167"
FT   CDS_pept        206563..206964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0167"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR02"
FT                   /protein_id="AAM35059.1"
FT                   /translation="MSRGEVTHQRSPAQAPHADSALCATFSQEEGTSLRSASGWPPSAL
FT                   RAPSPAGGGRQSGDAAVKPLSRLRERGWGEGTAAGSRPRKPSCERRGRHTSAVTRSNPA
FT                   TLIRRCAPPSPREKERAPTPPTPISCTAQ"
FT   gene            207038..207892
FT                   /gene="kduI"
FT                   /locus_tag="XAC0168"
FT   CDS_pept        207038..207892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="XAC0168"
FT                   /product="5-keto-4-deoxyuronate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35060"
FT                   /db_xref="GOA:Q8PR01"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PR01"
FT                   /protein_id="AAM35060.1"
FT                   /translation="MSLYCKTHYATHPDAIKGASNDDLRELYLLDGLFVDDAVTLKYTH
FT                   YERFVLGGAAPLGRTLELPRQTEPASAAGHPFLERRELGILNVGAGTGTVIVDGTAYTL
FT                   GPKDGLYVAMGSTDVSFASEDAGNPAKFYLASTPAHARFETKQLSIKDAVALERGALET
FT                   SNERTIYQYIVPATCQSSQLLLGLTVLKPGSVWNTMPPHLHDRRSEVYFYFDLGADDRV
FT                   YHFMGEPDAQRHIVIQNNEAVVSPPWSIHMGAGTSNYAFIWAMGGENLDYTDMHVLDIC
FT                   QLK"
FT   gene            208080..208835
FT                   /gene="kduD"
FT                   /locus_tag="XAC0169"
FT   CDS_pept        208080..208835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="XAC0169"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35061"
FT                   /db_xref="GOA:Q8PR00"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PR00"
FT                   /protein_id="AAM35061.1"
FT                   /translation="MSNPFSLEGKVALVTGANTGLGQGIALALAQAGADIAAAGIQAPT
FT                   ETEAKVKALGRRFIAIEANLISIEPVQRIIDETIAGLGGLDILVNNAGLIRRTDAVDFS
FT                   EQDWDDVLNVNLKSAFFMAQAAGRHFIAQGRGKIINIASMLSFQGGIRVPSYTASKSGI
FT                   AGITRLLANEWASKGVTTNAIAPGYMATDNTAQLRADEDRNKAILDRIPAARWGVPADL
FT                   GGTAVFLASSASDYVNGAIIPVDGGWLAR"
FT   gene            209089..209745
FT                   /locus_tag="XAC0170"
FT   CDS_pept        209089..209745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0170"
FT                   /product="sugar-phosphate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35062"
FT                   /db_xref="GOA:Q8PQZ9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ9"
FT                   /protein_id="AAM35062.1"
FT                   /translation="MKIALMNEFSQAAKNPVILQQLNDVAGEQGHSVFNVGMDGDNDHR
FT                   LTYIHLGIVASLLLNSKAVDFVVAGCGTGQGAMMSLNAHPGVFCGYCIEPTDAYLFAQV
FT                   NNGNALALAFAKGYGWGAEINVRYIFEKAFSGERGMGYPAERRESQQANAGILTQLKQA
FT                   TAKSYLDGLRAIDPELIKQAIGGERFQQCFFDNAQDAEIRNFVAGVLGKTEAAAA"
FT   gene            210124..211215
FT                   /locus_tag="XAC0171"
FT   CDS_pept        210124..211215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0171"
FT                   /product="rhamnogalacturonan acetylesterase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35063"
FT                   /db_xref="GOA:Q8PQZ8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ8"
FT                   /protein_id="AAM35063.1"
FT                   /translation="MLCTGIAHAAPQRIFIAGDSTAAEYGAERAPQAGWGQLLQDWFDP
FT                   AQWQVHNHAKGGRSTRSFIAEGRLDAIARELQRGDVLLIQFGHNDAKREDPTRYTDPTT
FT                   DYMQFLRRYIAAARDKGATPILITPAARLLYDFGALLDTHGRYTLAMQQLAAQEHVGLI
FT                   DLNASSSDWIRALGERAARPYFLFVPEQGKADGTHFSRAGATAIACLVVQGWVQLQPAL
FT                   ESQLQRDADCGAAPDTATQRAAQPRPSLIAHERDLARRQPGPHGGAGPTTAYPFFADAP
FT                   DLAFVLRKRVLHKGAGIGLHLHDKDEIYYIVSGRGLYALDGKQYQVAAGDALLTRPGST
FT                   HALQQTGEEPLVLLLAYLAKPAG"
FT   gene            211543..213132
FT                   /locus_tag="XAC0172"
FT   CDS_pept        211543..213132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35064"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ7"
FT                   /protein_id="AAM35064.1"
FT                   /translation="MRLRLATLRVARGGIVAQLPMQVQNVDTAAEHIAAIEATDAQGTV
FT                   QLVGRAAKAQESGDQGPLRVWIAPRALSGPLSLHYRVPANATRPPRGPAPPISFRNDDH
FT                   AFSALSSMFLALPPQEQSYALTIRWDLSQLPDGAKGVSSFGQGTVQVAQIDNNSLSGVF
FT                   FMAGEVGRWPAVPRADGFSVAWQGQPPFDAAALSAWVGKLHDQFELLFPQPAPAPYTIF
FT                   LRYNPVNAGGGTALNQSFVTTYGEGDGADLDLIKITLSHEMFHTYQPHLSRHGAESTTW
FT                   FSEGSAVFYEALLPLRFGLLTPQQFLDTLNTTAARYYTNALGNLPNARIDEGFWKDTRI
FT                   RTLAYDRGMLYLATVNDALRKRSQGRRSLDDLLRALLEIGQQREATQADWEALLKAELG
FT                   DTAVQDFHAFLAGTAPLPASDAFGRCFRRISKPLRRYVLGFEPAVLAEPRRIVRGLMAE
FT                   SAAAQAGVRNGDEIVRPVPQDGIQGNQTQHLKLRLRRDGKEFDVDYLPRGEQVDAWQWE
FT                   RVPGVDDAQCRR"
FT   gene            complement(213205..213849)
FT                   /locus_tag="XAC0173"
FT   CDS_pept        complement(213205..213849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35065"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ6"
FT                   /protein_id="AAM35065.1"
FT                   /translation="MDLTHLRIRRLELDDTRLLFTLANGMRIDEPIQAHRLLLKASPPQ
FT                   RAQWQITEDGFGVNWPAVAPPTPEGLLNMPELLWRRRAARAQAKLTQLRGRMDALSPGE
FT                   RELIALARLDADMNESGYARYFDRWDAATRSDALRGLAAMGAVQARQAIEGLGAVFERL
FT                   EEDPNLLSIEDILDAMNDTDRQRVDGWEEVYYRRSAELARLGLTHYGVDKA"
FT   gene            complement(213990..214880)
FT                   /gene="pah"
FT                   /locus_tag="XAC0174"
FT   CDS_pept        complement(213990..214880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pah"
FT                   /locus_tag="XAC0174"
FT                   /product="phenylalanine hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35066"
FT                   /db_xref="GOA:Q8PQZ5"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ5"
FT                   /protein_id="AAM35066.1"
FT                   /translation="MTTAPQRVENQLTDKGYVPVYTTAVVEQPWDGYSADDHATWGTLY
FT                   RRQRELLVGRACEEFLQAQDAMGMGQTHIPRFDALNRVLQAATGWTLVGVQGLLPELDF
FT                   FDHLANRRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPLFADFMQAYGRGGVKA
FT                   HGIGPDALQNLTRLYWYTVEFGLIDTPQGLRIYGAGIVSSKGESLYSLESPAPNRIGFD
FT                   LQRIMRTRYRIDSFQKTYFVIDSFAQLMEATAPDFTPIYAELAQQPQMPAGDVLPGDRV
FT                   IQRGSGEGWSRDGDV"
FT   gene            215008..215490
FT                   /locus_tag="XAC0175"
FT   CDS_pept        215008..215490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0175"
FT                   /product="transcriptional regulator asnC family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35067"
FT                   /db_xref="GOA:Q8PQZ4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ4"
FT                   /protein_id="AAM35067.1"
FT                   /translation="MDQPIALDRTDLRLLALLQTQGRSSNAELAVQVNLSASACLRRTQ
FT                   RLEAAGIIAGYGARLDARALGLGLQAFVRVQLEQHGQADIEHFAEGVRGWDEVVACWAL
FT                   TGDMDYLLQVQVRDLEHFSRFLLDRLLNATGVSDVNSSFVLRTVKAPEGLPLSHLA"
FT   gene            215744..217984
FT                   /gene="fpvA"
FT                   /locus_tag="XAC0176"
FT   CDS_pept        215744..217984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpvA"
FT                   /locus_tag="XAC0176"
FT                   /product="ferripyoverdine receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35068"
FT                   /db_xref="GOA:Q8PQZ3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ3"
FT                   /protein_id="AAM35068.1"
FT                   /translation="MTRCVGNDRRERPMSAAIAPLGLLSAALLCALSTLAPAAAHAAEA
FT                   ADATNATTLDQVSVNGTVSRAQPATTTRLPLTLQETPQSVSVIGLQRLEEQSLFSIDDV
FT                   MRHVTGVNVSFYDTQRPLYFARGFQITDFQVDGLPTYSGATNQEYDTVFYDRIEVIRGA
FT                   NGLLTGAGIPSATVNLLRKRPGKDFDASFGVSTGTWDFRRMQADVNAPLTEDGRFRSRV
FT                   VAAWQDRDYYYDRYHDNKMSGMAVLEGDLTESSTLTVGYQRQDNTPVGSTWGTVPFFAA
FT                   DGSFANLSRSTNMAPEWTRWQRETSTAFANLEQRFGQDWLLRVNTAHTKGAVQSLRVYG
FT                   TGYPAADGSGVFLRANAGETQDTRDSVDVYLSGGFALFGRQHDVVIGGSWQDLQSTTYT
FT                   VAQAYPDDWATCGSERCYFIPNIRNWNGDASEVTYARTGARRQARTTQRGVYASTRLRL
FT                   ADPLSLIAGARLSSWETRTQAFDASGSYTGTSGRYEVSDEVTPYVGLVYDIVPDVSVYA
FT                   SYTEIFNPQNYRDKDNNLLAPVEGSNLEAGIKAQLFDGHAMATAAVFEAKQDNYAVRDM
FT                   TQPEASLPDGSSAYIGVDGTKSRGWEVDVNGEVRPGWTINAGYTHVKVTRAPTDAIYAN
FT                   LPEDYLQLSTQWRLPGTWDRLSIGGGVSWQSAVRGFNIARPTGDGTGATRPVTVEQNPY
FT                   ALVHFNANYRISDQWTATLAVRNALDKTYWANLDYQNYGEPRFVSVSLRWRY"
FT   gene            complement(218389..219426)
FT                   /locus_tag="XAC0177"
FT   CDS_pept        complement(218389..219426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35069"
FT                   /db_xref="GOA:Q8PQZ2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ2"
FT                   /protein_id="AAM35069.1"
FT                   /translation="MIALRCSRSLALLSMLGLLSACGGEPRPATPAPVVQAPSAEAPKP
FT                   IKIGVALGGGAAKGFAHIGVIKMLEANGFAPVVVSGTSAGSVVGALYASGMDAFQMQEK
FT                   AVALDQTSIRDVRLFSGGLVQGQKLQDYVNEQLGGKPIEKLRKPFAAVATRLEDGERTV
FT                   FVRGNAGQAVRASSSIPGVFEPVTIGKYHFVDGGVVSPVPVDAARQLGAEFVVAVDISS
FT                   KASGKNPGDLLGTVNQSISIMGQRLGEAELKRADVVVRPKVNDIGSADFNQRGAAILEG
FT                   ERAAMAVMPQIRAKIAQLQAARSSATRTAADQAKAARQQAYERCLEQRSRWEKLRGKDE
FT                   ACVAP"
FT   gene            complement(220012..220875)
FT                   /locus_tag="XAC0178"
FT   CDS_pept        complement(220012..220875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35070"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ1"
FT                   /protein_id="AAM35070.1"
FT                   /translation="MAELQGGLSAPPPLSGISGRADEIDYRIVGNDMQFVEVELDPGES
FT                   AIAEAGALMYKDAAVQMDTVFGDGSHAGQSGGGLMGKLLSAGKRVVTGESMFTTVFTHA
FT                   GSGKAKVAFAAPYPGTVLALRLSEHGGQLICQKDSFLAGARGVSLGIAFQRKILTGLFG
FT                   GEGFIMQKLEGDGWVFVHAGGTVVERELGPGERIDVDTGCVVAYHAGVDMDVRRVAGLK
FT                   SMFFGGEGVFLATLTGPGKVWLQSLPFSRMAGRMLQAAPQGGGQQRGEGSVLGGLGRLL
FT                   DGDNRF"
FT   gene            complement(221216..222061)
FT                   /gene="ylmA"
FT                   /locus_tag="XAC0179"
FT   CDS_pept        complement(221216..222061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylmA"
FT                   /locus_tag="XAC0179"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35071"
FT                   /db_xref="GOA:Q8PQZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQZ0"
FT                   /protein_id="AAM35071.1"
FT                   /translation="MTVATENAADSTAVANAAPLIELDQASVMRGQVRVLHALSLRIAL
FT                   GQHTAILGPNGCGKSSFIKLITRELYPLARADGQAAVKVLGQTRWQVDRLRSQLGIVTG
FT                   DLSVNLADMPGLDVESAVLSGFFASYVVPPHREISDDMRARAREALALARALPLVDRQF
FT                   AELSAGETRRVLIARALVNRPQALLLDEPSTGLDLVARQHLLETMRHLARQGITLVLVT
FT                   HHIEEIVPEIERVILLRAGKVVADGTREALLTDASLSAVFDGPVRVQRDGERCWATVGE
FT                   "
FT   gene            222247..223413
FT                   /locus_tag="XAC0180"
FT   CDS_pept        222247..223413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0180"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35072"
FT                   /db_xref="GOA:Q8PQY9"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY9"
FT                   /protein_id="AAM35072.1"
FT                   /translation="MAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQAHRGVDFHPVIAH
FT                   FFRFWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIAQVFWRGVELYREARTQ
FT                   RADIEQYGKGAPSDWIERHLYTPHANAGPIALLVINAVLFGLPGIALWAIQMAWIPFWA
FT                   AGVVNGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPSSARFSMRRWELDI
FT                   GWVAIRGLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQAMTDYQRNVFKPA
FT                   LREEAAATGAKLRELLPRRLRKGLVDDGRWLKPDARAQLQAWVAQRPRMRTLVEYRARL
FT                   TALLEARSHDASERLRQLQQWCHEAEASGNAALQAYAARLKGYALSGA"
FT   gene            223451..223798
FT                   /locus_tag="XAC0181"
FT   CDS_pept        223451..223798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35073"
FT                   /db_xref="GOA:Q8PQY8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY8"
FT                   /protein_id="AAM35073.1"
FT                   /translation="MRGVIVRTFVIVGLAALPAVAAQAQVQDSQQYLQRMDTDGDGRVS
FT                   LDEYLAWMSYAFDQRDTDHDGVLQGDELPGRRDKPITRAAHRATLIARFARQDADGDGY
FT                   LSARELLAPPR"
FT   gene            223862..224599
FT                   /gene="yehX"
FT                   /locus_tag="XAC0182"
FT   CDS_pept        223862..224599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehX"
FT                   /locus_tag="XAC0182"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35074"
FT                   /db_xref="GOA:Q8PQY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY7"
FT                   /protein_id="AAM35074.1"
FT                   /translation="MFTLDQVSRRYGQAIALDAVSLTFASGITTALIGPSGAGKSTVLR
FT                   MLVGLEWPDSGTVAFDGTPLQRANLQAQRQRIGYVIQEGGLFPHLDARSNVILLARTLG
FT                   WTRERIDARLDALCALCQLPAELLARYPAELSGGQRQRVGLIRALMLDPPALLLDEPLG
FT                   ALDPIVRYDLQAQMRELFAQLGKTVVLVTHDVAEAAYLADNLVLMRVGRIVQQGRARDL
FT                   LEQPADAFVQRFLTAQRSIGDAA"
FT   gene            224599..226068
FT                   /gene="yehZ"
FT                   /locus_tag="XAC0183"
FT   CDS_pept        224599..226068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehZ"
FT                   /locus_tag="XAC0183"
FT                   /product="ABC transporter amino acid permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35075"
FT                   /db_xref="GOA:Q8PQY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR041894"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY6"
FT                   /protein_id="AAM35075.1"
FT                   /translation="MARALIAVVLLICSVGAQAAQVTIGSKNFTEAVILGEIATAAGRR
FT                   YGVDVQHRAQLGGTRILWRALETGQIDAYAEYTGTLAQELLQLPNASQAELRAALDARG
FT                   LAMTDSLGFQNTYAFGMKRERAQALGIVSLSDLARHPTLKIGLSNEFMQRADGWPGVRA
FT                   AYALPQAATGLDHDLAYRALQSGAIGVTDLYSTDAEIPYYQLQVLRDDRRYFPDYQAIF
FT                   VYRKELAQRSPAMLQALRGLQGRIDEATMQRLNAQVKLERQSEAAVAAHWLGVTPASDT
FT                   DSRLTRLLQHTREHLALVGSSLGFALLLALPLGVLAARRPRLGQVVLSLTGVLQTLPSL
FT                   AVFVFMIPLFGIGAKPAIAALFLYSLLPIVRNTHAGLTSIPRELRQTAHAIGLPAWTRL
FT                   WRVELPLARRTIVAGIQTAAVINVGTATLGALIGAGGYGQPILAGIRLDDLGLILEGAI
FT                   PAAVLALLVQALFEGVERWATPSGLRISQRQ"
FT   gene            complement(226327..227508)
FT                   /locus_tag="XAC0184"
FT   CDS_pept        complement(226327..227508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35076"
FT                   /db_xref="GOA:Q8PQY5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY5"
FT                   /protein_id="AAM35076.1"
FT                   /translation="MSSPSLSSTLAAPLDWAQRQQAFALPSGVIYLDAASRGPLLRAMQ
FT                   TVAHQAVDAMAAPWRLPFDAWLQQIEVLRGLAAALLDGDADAVAMVPSAAHGLATAARN
FT                   LPVQPGHAVLVLEGQFPSNLLIWQRRCAEAGARLVPVPTAAGGNLTDAVLQVIAETPAL
FT                   RIASLPHAYWLDGRMLDLDRISAAVHARGAALVLDLSQSLGVLPPDLLRWQPDFVVSVG
FT                   HKWLLGPMGLAWLWVAPQWRTDGLPIEEHWIGRDAGSSWEFPAANAPGYRGGARRFDAG
FT                   GVADPLRIAMATVALQQLNAWQPARIAAALGELTAHWDAALQARGLGSWCTPGHAPHLT
FT                   ALQPPAAALDAVATALGAGGVVCTRRHGRLRIAPHLSVTDHALSQVVAALPDR"
FT   gene            227580..228863
FT                   /locus_tag="XAC0185"
FT   CDS_pept        227580..228863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35077"
FT                   /db_xref="GOA:Q8PQY4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY4"
FT                   /protein_id="AAM35077.1"
FT                   /translation="MSALSPLLGHLQQQQLTLLERYAQTRALSDRLAAPLSAEDAMVQS
FT                   MPDASPSKWHLAHTTWFFERFVLQADPAYRVFDPAWDFLFNSYYQSVGPMHARARRGVL
FT                   SRPSLQQVRDYRAAVDMQMQQRLRDGLLDAQACTIVQLGIQHEQQHQELLLTDIKHALW
FT                   SNPLQPAYRDLPTPPAAVASPLRWHARDEQIVQIGAAAWPQADSFAYDNESPRHRVLVG
FT                   AHALGSRVVTNAEFQHFIDDGGYRSAGAWLSDGWAMVQAQGWQHPLYWDADGREFTLHG
FT                   WRTRDPHAPVCHLSLFEADAFARWAGARLPTEAEWEQAATGVPVQGNFVDTDALHPRGA
FT                   EAVDTGMQQLFGDVWEWTGSAYLPYPGFTPWPGSLGEYNGKFMNAQWVLRGGSCASPAS
FT                   HLRASYRNFFSSDARWQFAGVRLAKDLP"
FT   gene            228881..229846
FT                   /locus_tag="XAC0186"
FT   CDS_pept        228881..229846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35078"
FT                   /db_xref="GOA:Q8PQY3"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY3"
FT                   /protein_id="AAM35078.1"
FT                   /translation="MQRAHAALTDLRPQPDDITADALAGLSQTPKTLPSKYFYDARGSQ
FT                   LFEAITQQPEYYLTRTELSLLEASMGSIAQAIGAGVHVVEYGSGSGRKTELLLQGLRDV
FT                   VAYTPLEISRTALLESTARLAQQFPQIQMLPVCTDFTKPLRLPDAQRPARRHVVFFPGS
FT                   TLGNFADAAAIELLDAMRQTMGSDGCALIGIDLDKDAGLIEAAYNDAAGVTAEFTLNLL
FT                   ARLNREIGSDFDLDGFRHHAVYVRERGRIETFLISQRAQRVRVGGKDVAFAEGEAMQVE
FT                   YSCKYTDARFAELAAAAGLKVTHGWNDAKDWFGLRLLRPL"
FT   gene            complement(230156..230734)
FT                   /gene="hipA"
FT                   /locus_tag="XAC0187"
FT   CDS_pept        complement(230156..230734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipA"
FT                   /locus_tag="XAC0187"
FT                   /product="HipA protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35079"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY2"
FT                   /protein_id="AAM35079.1"
FT                   /translation="MRLVALIENQTIGHLASDPHGHPRFTYAPDWQHSKSAIPLSLNLP
FT                   LSREHHPTEAVSAVLWGLLPDNEATLQRWASRFQVSPRNPLALLSHVGEDCAGAVQFVT
FT                   EARLEDVLSGASDGIEPLTDGELEARLRRLRQDIGAARQVEDVGQFSLAGAQAKIALLH
FT                   DGLQWAIPAGRIPTTHILKPPSGESRYTW"
FT   gene            complement(230731..231312)
FT                   /locus_tag="XAC0188"
FT   CDS_pept        complement(230731..231312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0188"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35080"
FT                   /db_xref="GOA:Q8PQY1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017507"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY1"
FT                   /protein_id="AAM35080.1"
FT                   /translation="MDTVRTPSDIGNIIRARRKRLGWDQARLAHEIGVSRQWIVDIEKG
FT                   KPRAELQLILRALQALGLELMLGPGVAQVSEVGVPDRDTVTPINLDAIIEHNRANPPLG
FT                   TTVFNAFNNNIFKNQFSPFDALKNTGLDKSPPIIGASVKKNPANEHLHKQFSATNRLKI
FT                   GETVADSLKIGEAEKISKVISPSSKKKGVP"
FT   gene            complement(231458..235027)
FT                   /gene="iorA"
FT                   /gene_synonym="AF1489"
FT                   /locus_tag="XAC0189"
FT   CDS_pept        complement(231458..235027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /gene_synonym="AF1489"
FT                   /locus_tag="XAC0189"
FT                   /product="indolepyruvate ferredoxin oxidoreductase chain
FT                   alpha"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35081"
FT                   /db_xref="GOA:Q8PQY0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQY0"
FT                   /protein_id="AAM35081.1"
FT                   /translation="MRLPLLQRLRDDAAGLETAGFISGYRGSPLGGLDLELWRARKHLD
FT                   AAKVTFTPGLNEDLAATMVWGTQQTNLFPGAKVQGVYGMWYGKGPGVDRSGDVFKHGNA
FT                   AGTSPFGGVLALAADDHACRSSTLPHGSEDEFVSAMMPILNPAGVQDILDMGLLGWAMS
FT                   RYTGRWIGFKTIAETVESSASVNVDPFARTIVLPEDFALPAGGLSIRWPDPPVDQEMRL
FT                   HRYAIAAAQAFARANHIDKMVLDSPHARLGIVTTGKSYLDVLQALEYLGLDAQACAQIG
FT                   IRVYKVGMTWPLEPVGISAFAQGLEDIVVVEEKKAFIERQMKELFYNWPASAGARPSIV
FT                   GKYDEQGAWILPSTGELTPATIAAVIGRRILRLLQSSTINTDSIQQRLRWMDAKEAEMA
FT                   LPRAQFPRVPHYCSGCPHNTSTAVPEGSRALGGIGCHYMVTWMNRATDTFTHMGGEGVT
FT                   WSGQAPFTGTPHVFQNLGDGTYFHSGSLAIRQSVAAGVNITYKILYNDAVAMTGGQPVD
FT                   GTLTVPDIAHQLRAEGIHEIAVVSDDIGKWTRRRDLFPPEVAFHDRGELDAVQQHLRTV
FT                   KGVSILIFDQTCATEKRRRRKRGKLIDPPKRVMINSLVCEGCGDCGEKSFCVSVLPKET
FT                   EFGRKRQIDQSNCNKDYSCVSGFCPSFVTVHGGAPRKGKRRDASTLLDALPEPPRRTTL
FT                   ERPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQTGLAQKGGAVTTHIRIARQP
FT                   ADIHAVRIAAGEADLVLGCDMVVVNDYWALSKVRDGRTQVVLNTYEAMPGTFTTQPDLQ
FT                   FPAAEIIAGVRTALGGQEPLLLDATQLATALLGDAIASNLFVLGYAWQHGLVPLSHAAL
FT                   MRAIELNGAAVAMNQQAFAWGRLAAIDLPAVQRAAGLAGADAPAHLHGDTPYARGPGSW
FT                   EEHDLSGQSAPRALAQTDGSTLHGEVAAPAAPLDDEQLAHSLDEAIARRVAFLTDYQDA
FT                   AYAQRYRSLVERVRTHELQRAPGSNALTEAVARYAFKLMAYKDEYEVARLYTRGDFQRR
FT                   LQQQFEGDYTLRFHLAPPLLAKKDAHGNLIKREYGPWMFTAFKLLARLKFLRGGKLDVF
FT                   GYSEERRGERQLIADYSATVHMLLERLDADNVGLAAQIASIPEHIRGYGHVKHAHLQEA
FT                   KAREAALLAQWRNPKALHVVQAA"
FT   gene            235221..235997
FT                   /locus_tag="XAC0190"
FT   CDS_pept        235221..235997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35082"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX9"
FT                   /protein_id="AAM35082.1"
FT                   /translation="MHPTDSKTAVQSVTASFHAPVPVRMRSRRAAGRMGMGRGRLLSGE
FT                   NTVKRKYAWAALALLGGVWSLAQAQSLPKPKEFYFDEDRSTTKAVVAVQGQGDAVVDRL
FT                   AAMVQRDARAADPRAQLAALAYAGGRTQLGDELYQGALALVSNGSQQYRAITWNYGWDL
FT                   LRADQPDKALQQWANLANGRPATPEWLPTTAALALWRAGRKQEAVEWYAAAVRTWPDRW
FT                   SSPANYASLLPEWREAERASLAEVFAAWQANPPAFP"
FT   gene            236616..237533
FT                   /locus_tag="XAC0191"
FT   CDS_pept        236616..237533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35083"
FT                   /db_xref="GOA:Q8PQX8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX8"
FT                   /protein_id="AAM35083.1"
FT                   /translation="MAIDAFALILAMLGLGLLFARLRVLPDNSADVLNRIVLYICLPAS
FT                   VLTYVPRLHLDASLGGVIATPWLLTAIIVPLLWGCSRLLRFGRAEYAALLMCVVFTNSS
FT                   FIGFPMVRALIGDHALPYAVVYDQFGTFVLLSTFGLYVLARYSGDTPPTARLIVMRVLQ
FT                   FPPLWALLFALTLMPGQPPAWIGSGLKNLADAMLPLVMLSVGFSLQLRLPADELKPLAV
FT                   GLVFKLLLMPVLALPLSWVLGLRGQMLQTNVLESAMPTMITAAALAISHRLAPRLAAAM
FT                   VGYSILLSLLTLPAWAWLLARLVA"
FT   gene            237853..238485
FT                   /gene="parA"
FT                   /locus_tag="XAC0192"
FT   CDS_pept        237853..238485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="XAC0192"
FT                   /product="partition protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35084"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX7"
FT                   /protein_id="AAM35084.1"
FT                   /translation="MKTVLVAASKGGVGKTTIATNLAAHAALQGQRTVLADADPQGSST
FT                   RWAERRASLESAVLPIDATKRRSWQSAVPDGTDTLIVDAPAGAMAEDLSGFLDHVDAIV
FT                   VPVLSSALDIEAVVGFLNTLAKVPRVHQRKLPVGLVLNRARPWTQTSQQAADMIGSWPY
FT                   PLVTQLRDTQAYVVMAGLGRSLFDYRSAQVRDHQQDWEPLFKWLRKS"
FT   gene            238501..238977
FT                   /locus_tag="XAC0193"
FT   CDS_pept        238501..238977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35085"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX6"
FT                   /protein_id="AAM35085.1"
FT                   /translation="MRELILLRHAHAEPADTGQADFDRPLSPHGIAEAEAAGRWLREQR
FT                   LVPDRVLCSPARRARETLEAVLELTGYIEQRLDERIYEATPGTLASLVDEHREAERLLL
FT                   VGHNPGLERLAALMHSGQTGDYRGMPTASIALLALPLDATIEPGIARLTAFWWP"
FT   gene            238981..239553
FT                   /locus_tag="XAC0194"
FT   CDS_pept        238981..239553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35086"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX5"
FT                   /protein_id="AAM35086.1"
FT                   /translation="MSSSLRWYAWLALWVVFPCMAQQKVQSIDPAQSRFGFEIKTRFGT
FT                   KIEGFFPRFRGDVVTLADGRQQVRFRLDATQVEIPGKDRYTSWMRGEDFFDVAQYPVVE
FT                   FESLPYVDEVVKQGGDIVGNLTIRGITHLETLHVVPAECTRPGYDCDVISRGTVLRGRY
FT                   GMNAWQMALGDRVTFILRGRLQEARRP"
FT   gene            239550..241568
FT                   /gene="cls"
FT                   /locus_tag="XAC0195"
FT   CDS_pept        239550..241568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="XAC0195"
FT                   /product="cardiolipin synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35087"
FT                   /db_xref="GOA:Q8PQX4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX4"
FT                   /protein_id="AAM35087.1"
FT                   /translation="MTYLLRVCVLATLLLGTGCASLSQTERNRAAGVAAAARSTVVNCT
FT                   QANRCAQPSPLRALGGEAITASTPGAPRHYATIVDHGEESLVARLNLIRSATRSIDLQT
FT                   YIFDKDDSARMVLDALVDAAQRGVKVRILIDQLSAIADLQILGALASSHENLQLRIYNP
FT                   TFGKVKLNYFDYAGSVLCCFRRFNQRMHNKLLVVDDVLGVVGGRNYQDDYYDWDSEYNF
FT                   RDRDVILAGPEVRAMAANFDAFWRARRSVPAERLNDVGRLLLEQGVPTMPPAEFRRPDR
FT                   VARVDREAHDPQFVRDAFVTPAMPVKRVLYVADLPQKHRREHAAKAVSTAPELDGLIAG
FT                   AQQEVLLQTPYLVLSDQAQAIFRTLRKHPQPPRIVVSTNSLAATDNPIVYALSYKFKRR
FT                   NMRELGFNVYEFKPFPLDAPVDYANLVTDPLNPASDVNQDSRNNRLIGGSAAGNAMRGS
FT                   SGPEGNASASAGSVLRGSGGGRAPGGSEVDRRVLRTETRPSFLGTRAVNKPLPVTRAGA
FT                   RMGLHAKSLVVDRRIGVIGTHNFDPRSENYNTEAAVVIDDARFAQALAASIERDIAPEN
FT                   AWTVAPREKPPVLSGLNYSVGKVSEALPVLDFWPWRYATNYQFQPGPDCPFPLKRQDPQ
FT                   FRQCYVAVGDFPEVNVGPKWLLVRMLTAFGAGLVPIL"
FT   gene            241932..242360
FT                   /locus_tag="XAC0196"
FT   CDS_pept        241932..242360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35088"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX3"
FT                   /protein_id="AAM35088.1"
FT                   /translation="MTFREPVDLAALNAASRDTLIEHLGIVFTEAGDDWLRATMPVDAR
FT                   TRQPYGLLHGGASVVLAETVGSSAGNLCVDMTTQICVGLEINANHLRAATQGLVIGTAR
FT                   AVHVGRSTHVWDITIENPAGKRVCVSRLTLAVVPRSNG"
FT   gene            242523..243281
FT                   /locus_tag="XAC0197"
FT   CDS_pept        242523..243281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0197"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35089"
FT                   /db_xref="GOA:Q8PQX2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX2"
FT                   /protein_id="AAM35089.1"
FT                   /translation="MRWFRYLYRVPLLLLHLCLGLPVTMLCVVVPALARIRIGHDDTLE
FT                   ERMIRWWQGTLMRVFGFRLRRFGTPLPGATLFVANHVSWVDISILHSQRVMGFVAKREI
FT                   AGWPLVGWLATKGQTIFHQRGNTESLGGVLQEMLLRLQSGKPVGVFPEGRTRGGTEVGP
FT                   FHARIFQAAVEAGVPVQPVALRYGLRGNAQAVVAFGERESFFANIVRLLGEPSRLAEVH
FT                   FLEPIRALDIEGRRRMAETSRQRIVAAMES"
FT   gene            243341..244330
FT                   /locus_tag="XAC0198"
FT   CDS_pept        243341..244330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35090"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX1"
FT                   /protein_id="AAM35090.1"
FT                   /translation="MNASDYLPPRWLRNPHVQSVLGSSALRRIRSRQLLAASGAVTSEH
FT                   ILDGGDGVRLQGWMSVPPGDAPPRGTVLLLHGWEGSADSNYMRLTAARLLGLGYQVFRL
FT                   NFRDHGGTHHLNVDLFHSDRIEEVVNAAGDLWRRFPAPQLLAAGYSLGGNFALRLALRA
FT                   PAAGLPLARVAAVCPLLDPAATMTQLEKGPQFYDWYFRRKWRESLLRKRKLFPEQHGYD
FT                   DATLALDMRGLMAWLAVKHTGHGSLEAYFDSYSIAGQRLANLQVPVDILMAEDDPVIPF
FT                   EDFAAWQLPAHAQLEIARWGGHCGFLENARGDGFAERWVAERLASAGQ"
FT   gene            244681..246813
FT                   /locus_tag="XAC0199"
FT   CDS_pept        244681..246813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35091"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQX0"
FT                   /protein_id="AAM35091.1"
FT                   /translation="MQAAAARIVTIAVCPGPAAAMQDAILQALRRDAADDAVALAREWV
FT                   TNAPDHAAAHRWLALALQQQGQPALALDSIDTALTLTPEDADLHLLRAGALLATRDLSA
FT                   ADAALSRTTALDPNQFNAYVMQAHLAVARGDLDEAERLSRTAARLAPEHPQLLAVDGVV
FT                   EMRRGQDDRALSLLTRAAEQLPDDARVLFSLGFAYLQKEHFAFAERAFERVIELNPPGT
FT                   ALRAFIAQLAQRQGRLDDALAAMQGVLDQPDGDLPAMRRLAGEMELQAGRPDQAAAHLR
FT                   LALAHWPADRRTLHALLTAWERLGAVDDARDTLDAALATSATAHDLWLARLAVEPVGGP
FT                   QAQAVIERWLLAMPEHLPALEALMRVHDMQGQADEAEMVARQIVAVEPGRISGEQRIVE
FT                   ALLQRDPPAAIACVESLIESLPAPQQTVLRPWLGNVQDRAGQPDAAVGTWMQFHREQAQ
FT                   HRLPLPPQAARQPTQWPALGSIPDTVTARPLFVWGTPGSHVERLVAVMGAATPLVRGDR
FT                   YGITPPSDALQSYRTLEQLASGELAPTALVEGWKAQLPRRGIDDGNVIDWLLWWDNTLL
FT                   TALRPHLPEGRLAIALRDPRDMLLDWLSAGASAPLALQSPQQATDWLLIALEQLATLHE
FT                   RDLYPHRIIRLDGIEDDPQGISTALEQAFGLSFPLVEPRGPARLASGRWRDYRGVLGAQ
FT                   FDLLTLIAVRFGYPQD"
FT   gene            247005..247616
FT                   /locus_tag="XAC0200"
FT   CDS_pept        247005..247616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35092"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW9"
FT                   /protein_id="AAM35092.1"
FT                   /translation="MRLTSNSIENGKPIAVEFAAGTPEGFAPNRNPHLAWSETPAGTQS
FT                   FALLCLDPDVPTVPDTVGRDDLQIPVEQPRTDFVHWAMADIPADVHEIAAGSCSDGFVV
FT                   KGKQQPAGPAGARQGLNSYTQWFAGNADMAGDYRGYDGPYPPFNDLRVHRYFFRVFALD
FT                   VAKLGLPSSFTAADVLSAMQGHVLAEAALYGTYTLNPSLR"
FT   gene            247700..248710
FT                   /gene="adh"
FT                   /locus_tag="XAC0201"
FT   CDS_pept        247700..248710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="XAC0201"
FT                   /product="alcohol dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35093"
FT                   /db_xref="GOA:Q8PQW8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW8"
FT                   /protein_id="AAM35093.1"
FT                   /translation="MKAFQIGNQTGLESLVAVEMPEPVAGAGEVIVAPRLVGLINRDLQ
FT                   ILKGTYGGKLAPTRVPVAEGVGIVTCVGAGVGQVVPGDRVVSGHFPTWLDGRFRAEMFA
FT                   HDLGVTHDGWLAEKVSLPASALIKVPASLEDADVAALASAAVTAWHALVEVARIKAGDL
FT                   VLCLGTGGVSMAALQLAKLHGARVAITSSSDDKLELARRLGADITVNYRTHPDWAEAVM
FT                   QLSGGGADVVIETGGQDTLGQSIKAAAANATIVVVGVTPGAASPIPDYVALIRKNVTIR
FT                   GIANGSRAMFVDLLRAIEQHRIKTLHSKTFRFDEAPQALDYFARAQHVGKVLIRL"
FT   gene            complement(248766..249581)
FT                   /locus_tag="XAC0202"
FT   CDS_pept        complement(248766..249581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35094"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW7"
FT                   /protein_id="AAM35094.1"
FT                   /translation="MRAVFLAPALLAAGVTACGSGASPDPPGFSHAAARAPVAVPPDTD
FT                   NVPLRAALRAQHWHLQRASDAHGTALRSLFVDGVPPVQLDFSDQRIQVSQTCNALGANY
FT                   SVAEAHVQIGRVVSSKRMCADARRMAQERAASDLLSGRFAVIMDNAAAAPRLTLTRSDG
FT                   TVLIFGGTPTADTRYGGPGQTLLIEVAAETVPCVSDPARRCLQVREHAPDAPATVQAAT
FT                   SWQPYDGAIEGFVHEDGIRTLLRVTRYPAGSEPGAKPVYVLDQMIEAGS"
FT   gene            complement(249859..250656)
FT                   /gene="bacA"
FT                   /locus_tag="XAC0203"
FT   CDS_pept        complement(249859..250656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="XAC0203"
FT                   /product="undecaprenol kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35095"
FT                   /db_xref="GOA:Q8PQW6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQW6"
FT                   /protein_id="AAM35095.1"
FT                   /translation="MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIV
FT                   IQAGAILAICLALRQRLWSLATGLGERANRDYVLKVGVAFLVTAVVGLIVRKAGWQLPE
FT                   TLQPVAWALLIGGVWMLVAEHFAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSAST
FT                   IFIAMLLGLSKRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGTENWADVAVAFVAA
FT                   TITGFVVVKWLLGYIKKHRFTVFAVYRMLLGAALLLWLPAAAG"
FT   gene            250876..252285
FT                   /gene="glnA"
FT                   /locus_tag="XAC0204"
FT   CDS_pept        250876..252285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="XAC0204"
FT                   /product="glutamine synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35096"
FT                   /db_xref="GOA:Q8PQW5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW5"
FT                   /protein_id="AAM35096.1"
FT                   /translation="MSVENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPVNIIEPALFE
FT                   EGKMFDGSSIAGWKGINESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQSYERD
FT                   PRGIAKRAEAYLKSSGTADQAFFGPEPEFFIFDSVRFANDMGHTFFQVGSEEAAWNTGE
FT                   KYDGGNSGYRPGVKGGYFPVPPTDSLHDLRAEMIKTLEQVGIETEVHHHEVATAGQCEI
FT                   GTKFSSLVQKADELLTMKYIIKNVAYRNGKTATFMPKPIVGDNGSGMHVHQSLAKGGVN
FT                   LFTGDGYGGLSQLALWYIGGIFKHARAINAFANSGTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASCRIPWVTNPKARRIEMRFPDPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYGN"
FT   gene            252556..252900
FT                   /gene="glnB"
FT                   /locus_tag="XAC0205"
FT   CDS_pept        252556..252900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="XAC0205"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35097"
FT                   /db_xref="GOA:Q9RBK0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RBK0"
FT                   /protein_id="AAM35097.1"
FT                   /translation="MRMKLITAIIRPFKLDEVREALSAAGVSGITVTEVKGFGRQKGHT
FT                   ELYRGAEYVVDFLPKIKIETVVTDDRLDAVVEAIQNAAGTGKIGDGKIFVTAIEQVVRI
FT                   RTGEIGADAL"
FT   gene            252890..254365
FT                   /gene="amtB"
FT                   /locus_tag="XAC0206"
FT   CDS_pept        252890..254365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="XAC0206"
FT                   /product="ammonium transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35098"
FT                   /db_xref="GOA:Q9RBJ9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RBJ9"
FT                   /protein_id="AAM35098.1"
FT                   /translation="MRSDPTSPGVRMKTALFAGWKARFYSVCMLMLFSALMVGGMGSAH
FT                   AQSTPQVTPLPTEPVTTEPLPSAQPAAPPAAAAEAAPVVEKGDVAWMLTSTLLVLLMVV
FT                   PGLALFYGGMVRAKNVLSVLIQVAVVFSLLTVLWVFYGYSLAFSGEGAWIGNLDKALLK
FT                   GVTIETLAATFTKGVSLPEYVFVAFQATFAGITGALIVGAFAERAKFAAVLLFSAIWFT
FT                   FGYLPLAHMVWATGGYLFGLGALDFAGGTVVHINAGVAGLVGAYFVGKRAGLGREAIKP
FT                   HNVTLTFVGASLLWVGWFGFNAGSNLEANAGAALAFLNTLLATAAAILGWSLTEKIIKG
FT                   KSSALGVASGMVAGLVGITPACGTVGPFGAIVIGLAAGVLCVWGVTGLKRLLGADDSLD
FT                   VFGVHGLGGIIGAILTGVFSAASLGGQKGGDYDIVHQVGIQALGVGITVGWIGVVSVVG
FT                   FVVAKLVFGLRVSEEAEREGLDITSHGEAAYES"
FT   gene            254630..255685
FT                   /gene="ntrB"
FT                   /locus_tag="XAC0207"
FT   CDS_pept        254630..255685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="XAC0207"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35099"
FT                   /db_xref="GOA:Q8PQW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW4"
FT                   /protein_id="AAM35099.1"
FT                   /translation="MVTSSSMPSLDSLGTPVAWADREGRVLGVNPAFARWLGVSARRLV
FT                   EQPLAALEVQGDALARFLLNDERDILRLHRLALGLPNDAPRFAEGWLSRLDDGGWLLET
FT                   HPVDEFPALDPTHALPNALSAALKGLAHELRNPLAGLKGAAQLLARRAAGRDEDERELI
FT                   ELIGTEIERLNTLLERLLSPTPARPHDRLNIHVVLERVLRLAEAEGGWSVQVQRDYDPS
FT                   IPDILGDGDRLTQAVWNLVRNAFQAGATRVTLRTRVEHGQRIRDRVHAMSLRLEIIDDG
FT                   GGVPEELAEHLFLPLVSGRAEGSGLGLALAQQVSREHHGTLTYRSRPGHTVFTLLLPEL
FT                   AGDHDKEHLHG"
FT   gene            255678..257105
FT                   /gene="ntrC"
FT                   /locus_tag="XAC0208"
FT   CDS_pept        255678..257105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="XAC0208"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35100"
FT                   /db_xref="GOA:Q8PQW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW3"
FT                   /protein_id="AAM35100.1"
FT                   /translation="MAETAAVSHIWVVDDDRSVRFVLSTALRDAGYAVDGFDSAAAALQ
FT                   ALGMRPTPDLLFTDVRMPGEDGLTLLDKLKSKHPHLPVIVMSAYTDVASTAGAFRGGAH
FT                   EFLSKPFDLDDAVALAARALPDADAGVEEIVATRLAEGSASLIGDTPAMQALFRAIGRL
FT                   AQAPLSVLINGETGTGKELVARALHNESPRARKPFVALNTAAIPAELLESELFGHETGA
FT                   FTGATKRHIGRFEQADGGTLFLDEIGDMPLPLQTRLLRVLAENEFFRVGGRELIRVDVR
FT                   VIAATHQDLEALVEQGRFRADLLHRLDVVRLQLPPLRERRGDIAQLAENFLAMAGRKLD
FT                   MLPKRLSSAALEDLRQYDWPGNVRELENVCWRLAALATSDIIDVVDVDAALARGGRRHR
FT                   SGRSDGQWDDMLSSWAAQRLSEGAQGLHAEARERLDRTLLEAALQLTQGRRAEAAARLG
FT                   LGRNTVTRKLGPGRKRR"
FT   gene            257604..258083
FT                   /gene="yojM"
FT                   /locus_tag="XAC0209"
FT   CDS_pept        257604..258083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojM"
FT                   /locus_tag="XAC0209"
FT                   /product="superoxide dismutase like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35101"
FT                   /db_xref="GOA:Q8PQW2"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW2"
FT                   /protein_id="AAM35101.1"
FT                   /translation="MQQAEAALASASGSLVSGRVVLVPALQGIRLTGTIGGLRPGGVSG
FT                   FHVHERGDCSAADASSAGAHFNPGGALHGRAGGGAHHLGDMDNLRADAEGVVHLDMILS
FT                   GISLGDGAPTDVIGKSLIVHADPDDYRSQPSGNAGARLACGVIRVTQWGTPPSQP"
FT   gene            258282..258779
FT                   /gene="sodC2"
FT                   /locus_tag="XAC0210"
FT   CDS_pept        258282..258779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC2"
FT                   /locus_tag="XAC0210"
FT                   /product="superoxide dismutase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35102"
FT                   /db_xref="GOA:Q8PQW1"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW1"
FT                   /protein_id="AAM35102.1"
FT                   /translation="MVTEAAATTTATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGL
FT                   KPNTEHGFHIHEKGDCSAPDGSSAGGHFNPSQSDHGNISADPHHGGDMPNITADAQGNA
FT                   SIDGPVSSNVNLGKADQFDIAGHAVIVHADADDYKTQPTGNAGGRLACGVITTDNAQAP
FT                   AK"
FT   gene            complement(259311..259706)
FT                   /gene="gloA"
FT                   /locus_tag="XAC0211"
FT   CDS_pept        complement(259311..259706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="XAC0211"
FT                   /product="lactoylglutathione lyase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35103"
FT                   /db_xref="GOA:Q8PQW0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQW0"
FT                   /protein_id="AAM35103.1"
FT                   /translation="MLETGVYVADLERACAFYARVLGLQPMHRDTRMAAYAIAPAQVLL
FT                   LFLQGSTSATVTLPGGTIPPHDGNGRQHFALAIATDALPGWENHLHACGVAIEGRTQWP
FT                   GGGQSIYFRDPDAHLLELATPGLWANY"
FT   gene            complement(259745..260650)
FT                   /locus_tag="XAC0212"
FT   CDS_pept        complement(259745..260650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35104"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV9"
FT                   /protein_id="AAM35104.1"
FT                   /translation="MMGQPRIMSKTEHGVTAMGVLALELTGGSAPERGALAPAQAGMLA
FT                   ERIGRDLAQWIPEVRDLELSVALAHFDPSEVLRPGWPLHRRLEELQARAPGRDQGPRVL
FT                   AFGADAQGEIPLPFQADAQLVGGGLRVLPFLLSGDPQTVATVADAMEEILLAQGMAQAD
FT                   TALLAQESFGARIEHARYLTANDLAAMMSMQYDNQGLAPLWPLIEAALLAPHTEEWLEQ
FT                   PPEPVLRYIDGEVRIALFDPAGWCDYYAHDREDCERLRGVYEHYLARQRQMAAVLEAHG
FT                   LPVLYVHIEPGQDPRQALAA"
FT   gene            260718..262013
FT                   /gene="yfcY"
FT                   /locus_tag="XAC0213"
FT   CDS_pept        260718..262013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcY"
FT                   /locus_tag="XAC0213"
FT                   /product="acyl-CoA thiolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35105"
FT                   /db_xref="GOA:Q8PQV8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV8"
FT                   /protein_id="AAM35105.1"
FT                   /translation="MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGAL
FT                   VERFGLHGQQLGEVAMGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVI
FT                   TIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKL
FT                   AELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDA
FT                   LIAPFRGVSRDNILRADTSLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSE
FT                   AWALAHGHTPMAYLRDAQVAAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHE
FT                   AFAAQVLCTLRAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVA
FT                   TAAKQLEERGGGRALISICTAGGMGVVAIVER"
FT   gene            complement(262228..263493)
FT                   /gene="hemY"
FT                   /locus_tag="XAC0214"
FT   CDS_pept        complement(262228..263493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="XAC0214"
FT                   /product="porphyrin biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35106"
FT                   /db_xref="GOA:Q8PQV7"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV7"
FT                   /protein_id="AAM35106.1"
FT                   /translation="MKVLRTVLILLVAVALGVLGAQWLSHQNSYDLGNVVVSVGGNDYH
FT                   AAMPQALLILLIALLVLWLLWTLISLPFRVWGKYRRNKGRARLIEGLRAADHGQWQRAE
FT                   RLLVSASEDDEVSGIALASAVRVADARGDDAAATALAKQLAERDPTGYALLQGERHLAR
FT                   QRPVDAINAVDSANAQPLPARGLLLRTHALAQIGRADEAYGQLGALRQQAVLAPDAYST
FT                   LEATLAEQTLLQASDANALAERWEALPKALRTTPAVVGAYAQRAAVLHWDDAAVHSLEH
FT                   ALDAQWDESLVRLYGVLPLEKYDSRRASAQRWLTQYPDSPGLLLTLARLARQQQQWSQA
FT                   EEFLHRAIAGGAGSEAWEELGHGFGASGDLLSAQHCYANALRAARGEPVQDLMPRQSLR
FT                   EPVITTYDPAPIDPHAADDRIL"
FT   gene            complement(263490..264467)
FT                   /locus_tag="XAC0215"
FT   CDS_pept        complement(263490..264467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35107"
FT                   /db_xref="GOA:Q8PQV6"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV6"
FT                   /protein_id="AAM35107.1"
FT                   /translation="MTEMPAPARRFPLAWLLLVVAVAAVGVALLLGWRAWQNYQATQLQ
FT                   AAQAQQQRWDGTQQMLETLRRDQRLANERLQDAAATNRVLRDEMLGLSQRSALLEDTVQ
FT                   KLADPNRHGAQALRLDEVELLLRLGQQRLSIAGDADGARRAYALANGALSGIDDPGYLN
FT                   LRQALVQERDALERLGAGPQAEAGKNLDALAAELQRLPEQTAQASDAAQPWWQKALAPL
FT                   VDIRPSRGDALLTGGDRHAARDAVQIEISLARAAAERGDAAGFAQSLRRVETWTTRLWP
FT                   DSPQRRQLRARLRSLQQAPLRPRLPELGTTLLQLQAMREGRSTQ"
FT   gene            complement(264571..265350)
FT                   /gene="hemD"
FT                   /locus_tag="XAC0216"
FT   CDS_pept        complement(264571..265350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="XAC0216"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35108"
FT                   /db_xref="GOA:Q8PQV5"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV5"
FT                   /protein_id="AAM35108.1"
FT                   /translation="MTGLAHSDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQ
FT                   THDTAQARDALRQALAAPIAIFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALHAC
FT                   GIDTVVRPARMDSEGLLALPLLQAPLQAVGLITAPGGRGMLAPTLQQRGARIVRADVYQ
FT                   RVPLRLRASAIQALSLALPRSVLALSSAEALTLVLQQLPAELVAAWQQRPVVASSDRML
FT                   DAAHAAGFAHGMRAEGPLPLQLAAAAEAAIMTPPRPC"
FT   gene            265555..266364
FT                   /gene="lgtB"
FT                   /locus_tag="XAC0217"
FT   CDS_pept        265555..266364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtB"
FT                   /locus_tag="XAC0217"
FT                   /product="glycosyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35109"
FT                   /db_xref="GOA:Q8PQV4"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV4"
FT                   /protein_id="AAM35109.1"
FT                   /translation="MIKSYLINMQRSGDRLQAMSARLDALGLPFERIAAVDGATLTDEQ
FT                   IADFVRERPLEGSGDAFSTGPRKWTASNIGCFLSHQAAWRIAADSDDAYTAIFEDDMHL
FT                   SDALPALLRSTDWLPGGNSIVRLEPSYNRIKLDAKVADVAGRHLRLVRPSRYQHCWPVC
FT                   AGALIISRDAARLLLAAKARWHTMADIFLFGWSESPVAHQLSTYQLSPAACIQDKFFHA
FT                   AAENIVFTSTIDAPLTHAQKQRSTHWKARATALLRVAQGYRKVVFAP"
FT   gene            266514..267158
FT                   /locus_tag="XAC0218"
FT   CDS_pept        266514..267158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35110"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV3"
FT                   /protein_id="AAM35110.1"
FT                   /translation="MHQGVDTFVARNQSDAGLHIARGDDCIHHAVPHVMQVHKTLAEHC
FT                   GMMPPFAVFQSLPMTPSCTLASALQSLQQQFIAMPLVLSMGIAVDGLHDGALRLRAPLQ
FT                   ANVNDKANAFGGSLASLMTLASWGWLTLQLQLAGHHADVYVADSQLRYVAPVYEDLVAN
FT                   AEPSELGSWEAFLATFRQRGKARIGMRAQIALGSGAAAATLSGRFVAFPKR"
FT   gene            267187..267609
FT                   /locus_tag="XAC0219"
FT   CDS_pept        267187..267609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV2"
FT                   /protein_id="AAM35111.1"
FT                   /translation="MRAVITTIVLLGLALLSGVANAGSRAQARALETTQAAYTAAVRWN
FT                   DFDAALGFVEPAYAQAHPLSDLERSRYEQVQISGYREVRVGQDPNGDLRREVELRVINR
FT                   NTQAERLVRSIEIWRWNPEQKRWWLASGLPDLWKGQ"
FT   gene            267684..268118
FT                   /locus_tag="XAC0220"
FT   CDS_pept        267684..268118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35112"
FT                   /db_xref="GOA:Q8PQV1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQV1"
FT                   /protein_id="AAM35112.1"
FT                   /translation="MNFEELQAFVGRNPMLSLALVGLTIALIVTEVARLFRGYRALKPA
FT                   ELTRLINSENALVIDLSPTADFEKGHIAGSRNVALAKFDPAGKLLANAKASPVVVVCRS
FT                   GTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR"
FT   gene            268228..268740
FT                   /gene="secB"
FT                   /locus_tag="XAC0221"
FT   CDS_pept        268228..268740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="XAC0221"
FT                   /product="protein-export protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35113"
FT                   /db_xref="GOA:Q8PQV0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQV0"
FT                   /protein_id="AAM35113.1"
FT                   /translation="MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDA
FT                   NQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAI
FT                   DVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRQNEGTSLAD
FT                   SEPAGNA"
FT   gene            268756..269781
FT                   /gene="gpdA"
FT                   /locus_tag="XAC0222"
FT   CDS_pept        268756..269781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpdA"
FT                   /locus_tag="XAC0222"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35114"
FT                   /db_xref="GOA:Q8PQU9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQU9"
FT                   /protein_id="AAM35114.1"
FT                   /translation="MSDLTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTID
FT                   RTHENARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRPPGAG
FT                   VAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAF
FT                   AQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGL
FT                   NEMLRLAAVIGARPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLDEAIREIGQ
FT                   VVESVQTADEVMRQAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLF
FT                   T"
FT   gene            complement(270235..270831)
FT                   /locus_tag="XAC0223"
FT   CDS_pept        complement(270235..270831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35115"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU8"
FT                   /protein_id="AAM35115.1"
FT                   /translation="MKTSLLALGLLAALPFAASAAENLSYNFVEGDYVRTPTEGRDADG
FT                   WGVKASYAIAPNFHVFGDYSKQNADDNNNVFENTDSDFQQWGVGVGFNHEIATSTDFVA
FT                   RVAYRKLDLDTPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDFSKKRGIDIGDNFYGR
FT                   LGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW"
FT   gene            271190..272917
FT                   /gene="poxB"
FT                   /locus_tag="XAC0224"
FT   CDS_pept        271190..272917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="XAC0224"
FT                   /product="pyruvate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35116"
FT                   /db_xref="GOA:Q8PQU7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU7"
FT                   /protein_id="AAM35116.1"
FT                   /translation="MAKKRTLARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIE
FT                   WMHVRHEEVAAFAAGAEAAVTGQLAVCAGSCGPGNLHLINGLFDCHRSRQPVLAIAAHI
FT                   PSSEIGLSYFQETHPQELFRECSHFVEMVTNPAQLPEVLHRAMRTAILQQGVTVVVIPG
FT                   DIALLEVDKHVSSAWPALRQPRVLPAAEDVRQLVELLQQSKAVTLLCGSGCAGAHDAVV
FT                   ALADTLGAPVVHALRGKEYVEWDNPFDVGMTGLIGFSSGYHAMLNCDTLLMLGTDFPYR
FT                   QFYPKDATIVQVDRDPSALGRRTPLQLGIAADVGETIAALLPQLQRREERGFLEKSLAH
FT                   YRKAREGLDDLAVPADPGQPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNG
FT                   KRRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISLAQLHLPVK
FT                   VVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGILGIRVDESSQLERALRQ
FT                   AFAHSGPALVDVRVATQELAVPPAIKLEQAKGMGLYLLKAVMSGRGDEVIALVKTNLR"
FT   gene            272967..274409
FT                   /locus_tag="XAC0225"
FT   CDS_pept        272967..274409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0225"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35117"
FT                   /db_xref="GOA:Q8PQU6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU6"
FT                   /protein_id="AAM35117.1"
FT                   /translation="MPRSLLRQLLLIWMVIVAACVGVATMLYGLYRQTEGVRLEEARQQ
FT                   LGGQCARIVQRYAGASEAARRGDDGAGLAAVVVQLVLADAPGVEGGVWDLHKGFVAYAY
FT                   PTYDGSDHKTDIPAAEWANIVNAAQQSVTTKQAAQYRRDGRREVLLISACPLASGSAAW
FT                   TMTRVPASKADAWRPLVVGMLLIFAMVAISAIALGVLVRRWSQRLQRIQQALAADTETP
FT                   HIPPTGTPELDRLGAAVNDYAQRNAQALAQTRRLAAELSRHERLAALGRMTATVAHEIR
FT                   NPIATMRLALENEIARGDATPDDAAHGELMLGQIRRLDGVVESLLGMVQPIRLQLETVV
FT                   VQDWLATLLEHGPLPPGTSPPRVLLPAAPLRWTLDPQQLGRAVHNLLRNAAQHADPGSE
FT                   VTLQAAAVEGMLQLQVCNRGAPIAEPIAAHLFEPFVSGRADGNGLGLALVREIARAHGG
FT                   HARYAHADGLTHFILELPWRAS"
FT   gene            274394..275740
FT                   /gene="ntrC"
FT                   /locus_tag="XAC0226"
FT   CDS_pept        274394..275740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="XAC0226"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35118"
FT                   /db_xref="GOA:Q8PQU5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU5"
FT                   /protein_id="AAM35118.1"
FT                   /translation="MARILIIDDDAAFRTTLQATLRSLGHTAVAAENGPDGLARLSEGG
FT                   IDMAFVDFRMPGMDGIAVLRARLDDAQARQVPLVMLTAHVSSGNTIEAMTLGAFDHLVK
FT                   PVGRADIVEVVERALLSRAEAQAAATDALSAPVEDDDALVGHSPAMRTVHKRIGLAAAS
FT                   DLPVLITGETGTGKELAARALHRASPRASAPFAAVNCAAIPLELMESELFGHRKGAFSG
FT                   ASSDRRGLIREADGGTLFLDEIGDMPLPMQAKLLRFLQEGEVTPLGGSGPQKVDVRVLA
FT                   ATHRDLAACVADGRFRSDLRYRLNVVPIELPPLRERGQDILLLAQHFLSANAARAQSLS
FT                   PAAQERLLAHLWPGNVRELRNVMQRSQVLVRGASIDAADLEEALGEAGEAPPNGASALT
FT                   GTLPEAVAQLEKRMIQSALEQSQGNRAEAARRLGIHRQLLYRKLEEYGL"
FT   gene            275930..276682
FT                   /locus_tag="XAC0227"
FT   CDS_pept        275930..276682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0227"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35119"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU4"
FT                   /protein_id="AAM35119.1"
FT                   /translation="MLRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPV
FT                   AATPVSVSGTVERFLLNPNGDVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVVKGFR
FT                   LGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQSDGTIQRLVYGPAG
FT                   EINGALVSDGTVVRMPPHLALQFADLLRVGAPLSASGLGVATPDGRAIEATQLGRDRSS
FT                   LRALFTAPRPDGPLPPPPPVAPVPPAGR"
FT   gene            276758..277402
FT                   /locus_tag="XAC0228"
FT   CDS_pept        276758..277402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0228"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU3"
FT                   /protein_id="AAM35120.1"
FT                   /translation="MPVLFRSNTMHWVDPDFLPATRGTLARFLLNPKADIDGLLLTDGT
FT                   EVHTPPHLSEALLKALKPGSALTVRGLKPRDVEMLVALAIDPEGGKRILDEGPHGPHAK
FT                   PKPKPPGKPPKPEVAQHSGTITRLLHGPHGQVHGVLLDDAVTVRFPPHAGGDFAKQLVV
FT                   GKPLVAEGETKATPHGVLIHAHALGGKAATLKQIEHPPHGPAHKPKPKPKH"
FT   gene            277495..278724
FT                   /locus_tag="XAC0229"
FT   CDS_pept        277495..278724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0229"
FT                   /product="MFS transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35121"
FT                   /db_xref="GOA:Q8PQU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU2"
FT                   /protein_id="AAM35121.1"
FT                   /translation="MPMTKTRPRGTRALEALHFSVADVQDGLGPFLSVFLQSKGWSVAA
FT                   IGTVMSVGGIAGMLATTPAGALVDATRRKRAVVVIGCLAILLATALIWLQPTSSGVVAA
FT                   QIASALAAAGIGPALTGITLGLVHARGFDHQLARNQVANHAGNVLAAVLAGWLGWRYGF
FT                   AAVFLLTAFFGALALVAVLAIPAAAIDHRAARGLASNNGGDALSGWRVLLTCRPLALLA
FT                   VTLGLFHLGNAAMLPLYGMAIVAAHAGDPSALTATTIVVAQATMVVVALLAMRWIRVHG
FT                   HWWVLLVAFMALPLRALVAASVIHGWGVFPVQILDGLGAGLQSVVVPALVARLLQGTGR
FT                   VNVGQGAVMTVQGVGAALSPAFGGWLAHAFGYRIAFLTLGAIALLAVALWAGCRGMLQA
FT                   GASVQAETML"
FT   gene            complement(279073..279549)
FT                   /locus_tag="XAC0230"
FT   CDS_pept        complement(279073..279549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0230"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35122"
FT                   /db_xref="GOA:Q8PQU1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU1"
FT                   /protein_id="AAM35122.1"
FT                   /translation="MSAPVLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSD
FT                   KQLKRAGLDYHEYAPLQVHADLPSALAAIAPKRVFALSTRSTVRYDTPQFADGDAFLFG
FT                   PETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNFAGGQ"
FT   gene            complement(279576..280037)
FT                   /locus_tag="XAC0231"
FT   CDS_pept        complement(279576..280037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQU0"
FT                   /protein_id="AAM35123.1"
FT                   /translation="MKTQTLRIALSTALFAGATLAGFAQATSLTTLETVQVRPAADQIA
FT                   QQTLERNSGIHTLAAVQVRPSAEQVAALASEQAGPRIVTLAAVQVRPSAEQRADLVVRN
FT                   AAASAQSASSQAAGAIGALMGQVIVNLPTPQLQPSPAELEALVNAAISL"
FT   gene            280436..280744
FT                   /locus_tag="XAC0232"
FT   CDS_pept        280436..280744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35124"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT9"
FT                   /protein_id="AAM35124.1"
FT                   /translation="MLSVLVATSTAACTWVPIEQSGKSVRVLPAGPVPAGCQQQGEVVV
FT                   TVKSKVGFYNRNPLRVQEELETLARNEAPGANANAVQAQGQPADGSQRFNAFRCPPR"
FT   gene            280846..281862
FT                   /gene="fabH"
FT                   /locus_tag="XAC0233"
FT   CDS_pept        280846..281862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="XAC0233"
FT                   /product="3-oxoacyl-[ACP] synthase III"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35125"
FT                   /db_xref="GOA:Q8PQT8"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT8"
FT                   /protein_id="AAM35125.1"
FT                   /translation="MLFQNVSIAGLAHVDAPHTLTSKEINERLQPTYDRLGIKTDVLGD
FT                   VAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVGDHCVTFDVANACLAFINGMDIAARMLERGEIDYALVVDGETANLVYEKTLER
FT                   MTSPDVTEEEFRNELAALTLGCGAAAMVMARTELVPDAPRYKGGVTRSATEWNKLCRGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFMAARQVLGWAVDELDQFVIHQVSRPHTAAFVKSFGI
FT                   DPAKVMTIFGEHGNIGPASVPIVLSKLKELGRLKKGDRIALLGIGSGLNCSMAEVVW"
FT   gene            281974..283143
FT                   /locus_tag="XAC0234"
FT   CDS_pept        281974..283143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35126"
FT                   /db_xref="GOA:Q8PQT7"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT7"
FT                   /protein_id="AAM35126.1"
FT                   /translation="MPHRTTGHYVAGALAGSRYQAFVPSPLPPEPALDFSLVALVARKE
FT                   LADQALGRLDGITLMLPDPELFLYQYVRKEALLSSQIEGTQSSLSDLLLFEMDAAPGVP
FT                   IDDVEEVSNYVAALNHGLRRLREDDFPLSLRLIREMHALLLQGGRGASKQPGEFRRSQV
FT                   WVGGASPALAHFVPPPPDALPDTLAALEQFLHASQGQMPSLVKAALAHVQFETIHPFSD
FT                   GNGRLGRLLITLILCSEGVLREPSLYLSLYFKRRRADYYDRLNAVRLNGDWEGWLGFFL
FT                   DGVAETAQQAVDTAQRLLALLARDRARIAALGQRAGNVGLVFEQFARRVVLAVPQVAPH
FT                   LSLSVPTIRAAVRTLQELDIVNELTGQQRHRIFAYQAYLDILSEGAQPL"
FT   gene            283259..284161
FT                   /gene="dhaA"
FT                   /locus_tag="XAC0235"
FT   CDS_pept        283259..284161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaA"
FT                   /locus_tag="XAC0235"
FT                   /product="haloalkane dehalogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35127"
FT                   /db_xref="GOA:Q8PQT6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT6"
FT                   /protein_id="AAM35127.1"
FT                   /translation="MNYPGYPFPPKRLEVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSY
FT                   LWRHLVSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDTLLRHLGI
FT                   TGPVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPMPWQIAMGRHWRPG
FT                   EWFIRTFNAFSSGASWFGVSRRMPADVRRAYVAPYNNWRNRISTIRFMQDIPLSPADQG
FT                   WSLLERSAQALPAFADRPAFIAWGLRDICFDKHFLAGFRRALPQAEVTAFNDANHYVLE
FT                   DKHEVLVPAIRAFLERNPL"
FT   gene            complement(284314..284697)
FT                   /gene="ykgJ"
FT                   /locus_tag="XAC0236"
FT   CDS_pept        complement(284314..284697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="XAC0236"
FT                   /product="ferredoxin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35128"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT5"
FT                   /protein_id="AAM35128.1"
FT                   /translation="MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIELTEALRTHER
FT                   AMRGTSQSQPRCIALDADIGRYSRCSIHDRRPSSCAAVPASLEFGQRSAQCDKSRLAHG
FT                   LHALTDADWVGVDDAQRNPLPAV"
FT   gene            285002..286681
FT                   /locus_tag="XAC0237"
FT   CDS_pept        285002..286681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0237"
FT                   /product="AMP-ligase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35129"
FT                   /db_xref="GOA:Q8PQT4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT4"
FT                   /protein_id="AAM35129.1"
FT                   /translation="MGDNAPMTTLCNIAATLPQLARERPDQIAIRCPGGRGANGFAAYD
FT                   VTLSYAELDARSDAIAAGLARHGIGRGARAVVMVRPSPEFFLLMFALFKAGAVPVLVDP
FT                   GIDKRALKQCLDEAQPQAFIGIALAQLARRLLRWARSATQIVTVGGRYGWGGVTLARVE
FT                   RDGAGAGSQLADTAPDDVAAILFTSGSTGVPKGVVYRHRHFVGQIELLRNAFGMQPGGV
FT                   DLPTFPPFALFDPALGLTSVIPDMDPTRPGSADPRKLHDAINRFGVTQLFGSPALMRVL
FT                   ADYGQPLPNVRLATSAGAPVPPDVVAKIRALLPADAQFWTPYGATECLPVAAIEGRTLD
FT                   ATRAATEAGAGTCVGHVVPPNQVRIIAIDDAAIADWSGVRELATGEVGEITVAGPTATD
FT                   TYFNRDAATRIAKIRECCSDGSERVVHRMGDVGYVDAEGRLWFCGRKTHRVEAASGPLY
FT                   TEQVEPVFNVHRQVRRTALVGVGAPGQQQPVLCVELQPGVSASAFAQVESDLRALGAAH
FT                   PHTAGVARFLRHSGFPVDIRHNAKIGRETLAVWAAQQLHKRG"
FT   gene            286912..287922
FT                   /gene="cdh"
FT                   /locus_tag="XAC0238"
FT   CDS_pept        286912..287922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdh"
FT                   /locus_tag="XAC0238"
FT                   /product="NAD(P)H steroid dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35130"
FT                   /db_xref="GOA:Q8PQT3"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT3"
FT                   /protein_id="AAM35130.1"
FT                   /translation="MKVLVTGGGGFLGQALCRGLRARGHEVVSFQRGDYPVLQRLGVGQ
FT                   IRGDLADPQAVRHAFAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVIEACRANGVPR
FT                   LIYTSTPSVTHRATNPVEGLGADEVPYGDDLRAAYAATKAIAERAVLAANDAQLATVAL
FT                   RPRLIWGPGDNHLLPRLAARARAGRLRMVGDGGNLVDSTYIDNAAQAHFDAFEHLAVGA
FT                   ACAGRAYFISNGEPLPMRELLNRLLAAVDAPAVTCSLSFNTAYRIGAVCETLWPLLRLP
FT                   GEVPLTRFLVEQLCTPHWYSMEPARRDFGYVPRISIEEGLQRLRSSSSNDIAITR"
FT   gene            287987..288145
FT                   /locus_tag="XAC0239"
FT   CDS_pept        287987..288145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35131"
FT                   /db_xref="GOA:Q8NL44"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NL44"
FT                   /protein_id="AAM35131.1"
FT                   /translation="MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVIS
FT                   MFRRGKV"
FT   gene            complement(288478..288705)
FT                   /gene="ddlA"
FT                   /locus_tag="XAC0240"
FT   CDS_pept        complement(288478..288705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="XAC0240"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35132"
FT                   /db_xref="GOA:Q8PQT2"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT2"
FT                   /protein_id="AAM35132.1"
FT                   /translation="MRTIRVGLIFGGKSAEHEVSLQSARDILDALDPRRFEPVLIGIDC
FT                   SRWTRTRVMPLRISGGWPIALHGLCMSIAS"
FT   gene            288927..289571
FT                   /locus_tag="XAC0241"
FT   CDS_pept        288927..289571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35133"
FT                   /db_xref="GOA:Q8PQT1"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQT1"
FT                   /protein_id="AAM35133.1"
FT                   /translation="MPGSLFNSLKPLAGQALQAALNRALALDPDTREALLPLEGQRIAL
FT                   TLEAPALALQIRVHERRLLVGPVDQAQEPDLAVRSSLAGLLGQLPFLANARRTGAPAGR
FT                   LKVSGDAELARQLQQLAGRFDPDWQLPFVAVFGDILGVQIAGAVRAALQQARRSAVDLA
FT                   QSAAEFVTEESRDVVPRAELEAFHDDVDELRDDVERLAARVSRLRASGGAA"
FT   gene            289568..291241
FT                   /gene="aarF"
FT                   /locus_tag="XAC0242"
FT   CDS_pept        289568..291241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="XAC0242"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35134"
FT                   /db_xref="GOA:Q8PQT0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQT0"
FT                   /protein_id="AAM35134.1"
FT                   /translation="MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAE
FT                   IAAQSRGARLRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGQAAR
FT                   LIVEAALGLPVSVAFASFDTVPLASASIAQVHAATLPPDANGVRREVVVKVLRPEIERQ
FT                   IDADIALLHSLATLVERTHPRADKIRPREVVAEIEGTLAAELDLQREGANASVLRRFWE
FT                   GSDDLYVPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVF
FT                   RDNFFHADAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDY
FT                   RRMAELHVEAGWMPSNVRIDELEAAARSVCEPYFNRPLSEISLAQVLIKLFRVAQRYEL
FT                   TLQPQLILLQKTLLNIEGVGRQLDPRLDIWAVARPVLERILRERYSPRRVLRELSKRLP
FT                   EIMTHAPDMPRLVYSWLTQQVEGRHQIAIRSPELLALDLSLRKLQTRVVTAITGSGLLV
FT                   VAAVLYGLHPDGWYLGTVPVWSWISGGAGSAALLVAWLRR"
FT   gene            291272..291754
FT                   /locus_tag="XAC0243"
FT   CDS_pept        291272..291754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35135"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS9"
FT                   /protein_id="AAM35135.1"
FT                   /translation="MDASTPVAGIAALDAPPRTQHSSYPPVFAAQMGGRQKRALGEVFG
FT                   LRNFGVNLTTLAPGARSALRHGHSQQDEFVYIVSGAPSLITNAGEQLLQPGMCVGFRAG
FT                   DGDAHCLINRSQAVVTYLEVGDRSPGDCVTYPDDDLMLVPMADGQRAYRHKDGTPY"
FT   gene            292046..292780
FT                   /locus_tag="XAC0244"
FT   CDS_pept        292046..292780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0244"
FT                   /product="pseudouridylate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35136"
FT                   /db_xref="GOA:Q8PQS8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS8"
FT                   /protein_id="AAM35136.1"
FT                   /translation="MSISPKHLQILYQDDVLAVVDKPAGLMVHDSKLARGEDDFLADRL
FT                   REQLGKPIFLVHRLDRATSGCLLLAFDRDSASALGKALMAGEVEKQYLTVCRGWPAEER
FT                   FIVDHDLDGGPGKPVKKPAVTHFQRLATGELEIPSTGFTTSRYALLRCQPQTGRFRQIR
FT                   RHMKHLSHHMVGDTSHGDGRHNRSFRMLGIHRMLLHAERLEFPHPADGRRIGVTAPLDV
FT                   EFSKACALFGWEMAGLGVMQTA"
FT   gene            complement(293218..293760)
FT                   /locus_tag="XAC0245"
FT   CDS_pept        complement(293218..293760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35137"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS7"
FT                   /protein_id="AAM35137.1"
FT                   /translation="MTPTSSLAAARRLACRLLLSALLAVAAPAAWAQAPSDADINRLLA
FT                   ASRAQTMLDTMLPQIEALQQQQFAQLTAQRQLDADQQAQLQRIQERTRQTVRKALSWSE
FT                   LRPMYVDIYKRSFSREDVLAMAEFYESSAGQSLLDKTPALTQNLMGAIQQRMLPLFADL
FT                   QKDLEKIVNEPAPAKKP"
FT   gene            293853..294284
FT                   /locus_tag="XAC0246"
FT   CDS_pept        293853..294284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0246"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35138"
FT                   /db_xref="GOA:Q8PQS6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS6"
FT                   /protein_id="AAM35138.1"
FT                   /translation="MASDPIQITPSLTIPPSELVERFVRASGAGGQNVNKVSTAVELRF
FT                   DVAGSPSLPEPLRARLLSRRDRRMTADGVLVIDAQRFRTQDRNRDDARERLVEIISACL
FT                   SVPKRRVATKPSHGAKLRRLDAKRERSQIKRGRSASHWE"
FT   gene            294287..294916
FT                   /locus_tag="XAC0247"
FT   CDS_pept        294287..294916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0247"
FT                   /product="acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35139"
FT                   /db_xref="GOA:Q8PQS5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS5"
FT                   /protein_id="AAM35139.1"
FT                   /translation="MSQADPSLPPVTQANILLQPSPPRMPRAHGRFIRWLGRTALRVTG
FT                   WRLLGRLPDEPKLVMIVAPHSSNWDGFVGFAAKFALGFDVRVLGKSQLFWWPLGPLLRR
FT                   LGAIPLDRSSPQGTIGQAVRLIRNSEQMWYVITPEGTRKRVENWKAGFWKIASDSKVPI
FT                   LPVYFDYPSKTVGIGEPFWTGNDMAADIAAIRTWYRPWRGKHRDTL"
FT   gene            295087..296022
FT                   /gene="ansA"
FT                   /locus_tag="XAC0248"
FT   CDS_pept        295087..296022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="XAC0248"
FT                   /product="asparaginase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35140"
FT                   /db_xref="GOA:Q8PQS4"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS4"
FT                   /protein_id="AAM35140.1"
FT                   /translation="MLVIHGGAGVEKSSLSKDEQAQAREAMQRALRAGHAVLQRGGSAV
FT                   DAVAATITVLEDAPQFNAGRGAVFTHDGRNELDAAIMDGASGKAGAITGVHTVKNPILL
FT                   ARSVMDRSKHVMLVGDGAEAFAREQGITLVDPAYFRTDKRWQQLQKALKAEAGDRQAQA
FT                   ELDLETAKHFGTVGALALDRDGHLAAGTSTGGMTNKRYGRVGDAPIIGAGTYANSQCAV
FT                   SGTGWGEFYIRAVAAYDICARMKYAGQSLQQAAETVIDQQIPKAGGDGGAIALDAQGNL
FT                   AFPFNTEGMYRGWIGADGTAHVAIFKDETL"
FT   gene            296221..298299
FT                   /gene="dcp"
FT                   /locus_tag="XAC0249"
FT   CDS_pept        296221..298299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="XAC0249"
FT                   /product="peptidyl-dipeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35141"
FT                   /db_xref="GOA:Q8PQS3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS3"
FT                   /protein_id="AAM35141.1"
FT                   /translation="MPEKTAPAPAADAASNPLLTASTLPFQAPPFDKIQDADYLPAFEE
FT                   GMRQHLADIRKIADNPEAPTFDNTIEAMERGGETLTRVSRIFFGLVQADTSDARQKIQE
FT                   EIAPKLAAHQDEINLDPKLFARVKTIYDQRDTLNLDPEQKRLVERDYEELVRAGAQLSD
FT                   ADKDSLRKLNVEETTLSTQFHTRLVAASAAGAVVVDDKAKLDGLSEGDIAAAADAAKAR
FT                   KLDGKYLLTLQNTTQQPVLASLKNRELRAEVLKASETRAEKGDANDTRQTIQRLAQLRA
FT                   QKAKLLGFDNYAAYSLGDQMAKTPDAALKLLTDTVPAATAKARREAAEMQKVIDAQKGG
FT                   FKLAASDWDVYAEQVRKAKYDLDESQIKPYFELDNVLNNGVFYAATQLYGITFKQRTDI
FT                   PTYHADMKVYEVFDADGTSMALFYTDYFKRDSKSGGAWMDVFVEQDGLTGAKPVVYNVC
FT                   NFTKPAAGQPALLSFDDVTTLFHEFGHALHGMFSKVKYPSIAGTSTSRDFVEFPSQFNE
FT                   HWASDPKVFANYAKHYQTGAAMPAELVEKIKKAKTFNSGYATTEYLSAALLDLAWHTQP
FT                   ADAPLQDVSKFEADALKRFKVDLAEVPPRYRSSYFDHIWGGGYSAGYYAYFWSEVLDDD
FT                   AFEWFKENGGLTRKNGDTFRAKILSRGNTVDLATLYRDFRGKDPSVKALLENRGLTE"
FT   gene            complement(298652..299707)
FT                   /locus_tag="XAC0250"
FT   CDS_pept        complement(298652..299707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35142"
FT                   /db_xref="GOA:Q8PQS2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS2"
FT                   /protein_id="AAM35142.1"
FT                   /translation="MAPPRPSPYADSPQFRAGRFRNAMPLPTTVMTLREQLGLMWAMVF
FT                   GKPRTTVPAAPLPVQPLTRAHLLAAPDRSLYRLGHSTLLMKLAGGLWLTDPVFSKRASP
FT                   VPFAGPKRFHAPPIALDALPPLAGVILSHDHYDHLDRATIRALADRVGVFVAPLGVGDL
FT                   LVRWGVDPAKVRQLDWWESISVAGLQLTATPSQHSSGRGLFDNGRTLWCSWVIQAGDLR
FT                   LFFSGDGGYGPHFKTIGERLGPFDVALIENGAYDHMWPHVHMQPEQSLQAFIDVGGRSL
FT                   LPIHNGTFDLAMHAWQEPLDRIVALADCAGVALITPCMGERVDLNAPGNRVRWWPQDAA
FT                   ASASDGLVATP"
FT   gene            299947..300579
FT                   /locus_tag="XAC0251"
FT   CDS_pept        299947..300579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0251"
FT                   /product="transcriptional regulator tetR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35143"
FT                   /db_xref="GOA:Q8PQS1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS1"
FT                   /protein_id="AAM35143.1"
FT                   /translation="MSTAPSLPAKPQRLTDRKRNAIVEAAIAEFRQHGFEATSMDRVAA
FT                   TAGVSKRTVYNHFPSKDALFGEILRGLWQRSAEAVNLAYRPDQPLHLQLIALLQQKLRL
FT                   LDDPAFIDLSRVAIAEGIHSPARARELLSQLGSKEEGTTTWLRAALADGRLTGVEPDFA
FT                   AQQLQALVKGFAFWPQITLGQPPLSPQQQTQVAESAVAMFLGLYARK"
FT   gene            complement(300753..301100)
FT                   /locus_tag="XAC0252"
FT   CDS_pept        complement(300753..301100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35144"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQS0"
FT                   /protein_id="AAM35144.1"
FT                   /translation="MTDATQHRIDYLEFAADSIAVAKAFYGQAFGWTFQDYGPDYCEFR
FT                   DGRLSGGFFHGTPQPGGALVVLASDDLARSQARIEAAGGQITQPVFAFPGGRRFHFADP
FT                   HGYPLAVWSKD"
FT   gene            complement(301169..301930)
FT                   /locus_tag="XAC0253"
FT   CDS_pept        complement(301169..301930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0253"
FT                   /product="transcriptional regulator araC family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35145"
FT                   /db_xref="GOA:Q8PQR9"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR9"
FT                   /protein_id="AAM35145.1"
FT                   /translation="MPASASPQGSVTSNPAESCYAQSAAPAALRARLQCSWQFRQGGRA
FT                   TQPVLVLPDGSVDLIWDGSEVFVAGPDRMANPASVAAGTTLTGVRLAAGVAAGLLQLPL
FT                   HAIADQRVALESLWGVQGRMWQHRLEDGADPLQTLQALCQQHAAARDPQMAWLFEQLAV
FT                   GTPTRLSALTDALGISERSLRRRCQDAFGYGSKTLQRVLRLQRFLRIVRGHRNLTEAAL
FT                   HAGYGDAPHLVRDARQLTGLSPRALVQQHAR"
FT   gene            complement(302045..303304)
FT                   /gene="yjl094C"
FT                   /locus_tag="XAC0254"
FT   CDS_pept        complement(302045..303304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjl094C"
FT                   /locus_tag="XAC0254"
FT                   /product="Na+/H+-exchanging protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35146"
FT                   /db_xref="GOA:Q8PQR8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR8"
FT                   /protein_id="AAM35146.1"
FT                   /translation="MNQTTLLLVQLAVILGAARLCGALLQRIGQPPVIGEMAAGLLLGP
FT                   IAFGAWLPDLHTALFAAKTLPPLSGLATMGVVLFMFVVGVELRAPEGTKTQVRASVLVG
FT                   VAGIVLPLLLGLAAAPWLFPRFAPQGVSFWPFALFIAAAMSVTAFPVLARILKDRNMTR
FT                   TPAGRLALGAAVIDDATVWIFLAIVLTLTGNNAHGGVAFTAIGALVLIAGVFGVLKPAY
FT                   ARLLRSRAHDGRYAPSALVWALIGLLACAALAEWIGLHAIFGAFLFGICLPRDDRLLEH
FT                   LAGRIEPLAITLLMPVLFAVAGQATSPGAFAGAGLSGLVLVIGMAVSGKLLGCTLGARL
FT                   SGHRWRDSLTVGSLMNARGLMELVVIKIGLDSGVIGPDLFTLLFGMTLVTTVMASPMVA
FT                   WFQGRRHAAADALAASNSPH"
FT   gene            complement(303652..304608)
FT                   /gene="rbcR"
FT                   /locus_tag="XAC0255"
FT   CDS_pept        complement(303652..304608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="XAC0255"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35147"
FT                   /db_xref="GOA:Q8PQR7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR7"
FT                   /protein_id="AAM35147.1"
FT                   /translation="MAPTPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALYVSQPAVTL
FT                   QLQALERDLGVPLFERSGRRMAPSREGQLLYDMAQPLVESLDGLEASFREKVRGLDAGE
FT                   LNIAANSSTILYLLPRIVANFRARHPDVRLTLHNAISADGTDLLREDAVDLAVGSMLDV
FT                   PADLNYAPVYRFEQLLITPPDHPLAGKAEVSLQDLSPYPLILPPRRQVTYRLVDLIFQQ
FT                   ARVPYTVALEVGGWEVIKQYVAMGMGISIVTAICLTEADRDKLATRSLKDFFPTRSYGV
FT                   VVRKGKYLSPQARAFIELIQPDLFTPRGYDESGDSER"
FT   gene            304727..306343
FT                   /gene="mls"
FT                   /locus_tag="XAC0256"
FT   CDS_pept        304727..306343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mls"
FT                   /locus_tag="XAC0256"
FT                   /product="malate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35148"
FT                   /db_xref="GOA:Q8PQR6"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR6"
FT                   /protein_id="AAM35148.1"
FT                   /translation="MAATAFAPRPNDHATPGIALTTQIAGQAELLPAAALALLVSLHRA
FT                   IEPGRQQRLAQRRQRQAAFDAGQLPDFRTDTQAIRTGDWRVAPLPVALQDRRVEITGPT
FT                   DPKMVINALNSGAKVFMADFEDSTAPTWRNLLAGQRTLVAAVRGDLSFDAPNGKHYALR
FT                   PEAERAVLIVRPRGWHLDEKHVLIDGQPLAGGLFDAALFAFHNGRTLLAKDRGPYLYLP
FT                   KLQSMEEAALWDTALAHIEAMLGLPHGQIKVTVLIETLPAVFEMDEILYALRERIVGLN
FT                   CGRWDYIFSYLKTFRAHRDRVLPERGQVTMTQPFLRAYSELLIKTCHRRGAHAMGGMAA
FT                   QIPINHDEAANEQAMARVRADKLREVSAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQH
FT                   VLRNDVQVTRDLLIAPSPGNVTRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATA
FT                   EISRAQLWQWLHHGQHLDDGTAIDQHLLQATLRALPARLGTATALPGAARIDEAIALLE
FT                   ELSGADELADFLTVPAYRLID"
FT   gene            306512..307807
FT                   /gene="aceA"
FT                   /locus_tag="XAC0257"
FT   CDS_pept        306512..307807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="XAC0257"
FT                   /product="isocitrate lyase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35149"
FT                   /db_xref="GOA:Q8PQR5"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR5"
FT                   /protein_id="AAM35149.1"
FT                   /translation="MSTTLQSAEQLQQDWSNNPRWAGIARNYSAADVARLRGTVHVEHS
FT                   LARLGAEKLWNSLHATPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLAGQMY
FT                   PDQSLYPADSVPAVVKRINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFE
FT                   LMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVL
FT                   IARTDAEAADLITSDVDANDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWC
FT                   ETGKPDLEFARAFAQAIHARFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKF
FT                   QFITLAGFHALNHSMFHLAHGYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTGYF
FT                   DAVTQAIQQGQSSTTALRGSTEEEQFQSDKAA"
FT   gene            308105..309163
FT                   /locus_tag="XAC0258"
FT   CDS_pept        308105..309163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35150"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR4"
FT                   /protein_id="AAM35150.1"
FT                   /translation="MTCHNAAGALEPTGSAAKTLPDGLHALMTAEELAFFARFGRLREV
FT                   SAGQSLFERGAVGTQMYIVVSGQIDLDFGEDLMLKHLGPGEFFGELGLLIGDHARSAGA
FT                   SASTDSRLIELAHDDFQRLVDQDPSMVAHFLRRSIVRVVNNEQLLIRQLRRRNHDLEAA
FT                   LDNLYVTSHQLNHTEELSRTDELTGLHNRRGLALHLQECRRAGHVPGVGLILIDCDRFK
FT                   RINDEFGHLAGDRVLQNVAHALRSVIAEGDLACRLGGDEFCVLVAQGTSELVHHIGECI
FT                   VRAVEARLCNGQGEQGCSVSVGSCMIDADAAWNDWYTLADSALYEAKRQGGNVLCMQET
FT                   LALDQPPASGHR"
FT   gene            309167..311827
FT                   /locus_tag="XAC0259"
FT   CDS_pept        309167..311827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35151"
FT                   /db_xref="GOA:Q8PQR3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR3"
FT                   /protein_id="AAM35151.1"
FT                   /translation="MGSRTHARKDASSEALQAPRLRTLLLTDLCDSTALVERIGDNAAA
FT                   ALFREHDRLVVKLQQHWRGRLIDRSDGLLLLFDRPIDGLGFALDYARGLKTMGDAHALT
FT                   LCARQGLHVGEVLTWRNSDEAISIGAKPLEVEGLAKPTAARLMSMARPGQILLSAVAES
FT                   LTHRAARELGNRADRLLWKSHGRWRFKGMPTPMEIYEVGEVGLTPLRMPKNSAKAWRDV
FT                   PLWRRPAALVAEVGVVLAVGIAAWFFIRPQPAIAFASRDWVVVGDVRNLTGNTVLDGAL
FT                   EQALRISLEQSRYVNVLSDMKVRDTVTRMKRDPNTIVLDRSVASEVALRDGASAVLLPT
FT                   VAEVGGKLRFSVELVDPRTQTTVYSEFVQGDGLPSALSSVDQVTRKLRQGLGEMVASID
FT                   KNSVPLPAVTTSSLDALRAYALGVEATAKGRWREGLELFDRAVGIDPTFALAYLGAARI
FT                   KVAVSDRNGALPYLDNAVRFRQRLPARDQLYLDAWIAELRAVDTALPLWRTLASLYPDN
FT                   FAGAANTSWHLFVANRFADALPYAQAADVVQDPLRSIASDRIGRILMAQGKVEAALQRF
FT                   ENSSDGDRAGPLRRQADALAVLGRYAEEQRTLDRIVDNGYANDDVVPLIDRTSIALDQA
FT                   NWANANAAVAQALERSKHTDDFSYRQFLVIGATTAAITGETASVGPGMSSTFEALVGAI
FT                   KANGPAEPNLQDDAAMVLSLVSQAQRNGDDQFTARALSAIKPALAHETPVLADLRAIVE
FT                   AQHLALSGDRVAAIARLPPGPDDLLQMRVTLYTLLHDSGRHAEALQQARWLSLQRGRAY
FT                   IEANASQTLQPLNVAHTRLARLWTAESLYALGRTQEAREQAQAFVRAWPASHLPAYLRS
FT                   RVERILSDSKAKITV"
FT   gene            complement(311767..312198)
FT                   /locus_tag="XAC0260"
FT   CDS_pept        complement(311767..312198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35152"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR2"
FT                   /protein_id="AAM35152.1"
FT                   /translation="METSQGRMSMVDIVSAIPSHHAPAPSPADKTMTHPADKAHPPFDA
FT                   SIADRLLELLSNDDDFRDCFQDNPAQALAQLGVAGANANDGVPSAGEPYYCMTTSQLAS
FT                   KEDIALARVELQSYLTEKTNHTVIFAFESESIRSTLLRR"
FT   gene            312659..313204
FT                   /locus_tag="XAC0261"
FT   CDS_pept        312659..313204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35153"
FT                   /db_xref="GOA:Q8PQR1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR030965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR1"
FT                   /protein_id="AAM35153.1"
FT                   /translation="MERGIGGVAARITLPRAATGAFDDLLSRRVTCRNFDKQRALSREL
FT                   LGHMLERSVMASARVAVGHDTAFLKKPVPSGGSLHPTETYLLIQRVQGMPSGLYHYRPI
FT                   EHALQPVAPPPEPLSDFARRALSGQHWFAEAPVLLILAPRFLRSFWKYRNHAKAYRAMI
FT                   LDVGHIAQTLYLSARTWG"
FT   gene            complement(313648..315723)
FT                   /locus_tag="XAC0262"
FT   CDS_pept        complement(313648..315723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0262"
FT                   /product="dipeptidyl anminopeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35154"
FT                   /db_xref="GOA:Q8PQR0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQR0"
FT                   /protein_id="AAM35154.1"
FT                   /translation="MQRLLLVSSMLLALSACSDKPAPAPEKAAAPAPATTAPAAPPALI
FT                   TRDALFGNPERANVSISPDGKYLSWVAPLEGVLNVWVAPVDAPDQARAITKDTARGIRN
FT                   YFWTYQPNTLLYLRDNGGDEDFHLFSVNLTDGSSKDLTPFKKTNAEVYRVSAQHPESIM
FT                   VGMNDRDAKWHDLYRVDLASGKRTLVQKNTGSLDAYLLDGGYQLRYATRATDDAGRELL
FT                   VPDGDGWKSVDRIPFEDVTNTAPEGLTEDGKTLYMQDSRNRDTAALYAIDTASNTRTLL
FT                   FENPRADVGATLNDPKTGAVQAVSTDYLREEWKPLDNGIAADLQKLKSLGGGDASVAAR
FT                   TLDDRIWIVGYSAAETPLTYYRYDRADGGKLTKLFSARPALEGKPLVPMWPQELTARDG
FT                   LKLISYLTLPAEADANHDGKADKLVLFVHGGPWARDSYGYGPYEQWLANRGYAVLAVNF
FT                   RGSTGFGKAFTNAGNGEWAGKMHDDLLDAVQWAVKQGVTKPDEVAIMGGSYGGYATLVG
FT                   MTFTPDAFKCGVDIVGPANLNTLLGTVPPYWASFYKQLTRRMGDPATEAGKQWLTDRSP
FT                   LTRVDKISKPLLIGQGANDPRVKQAESDQIVNAMKAKNIPVTYVLFPDEGHGFRRPENS
FT                   KAFNAVTESFLSQCLGGRLQPIGADLEGSSITVPEGADKINGLGEALKTHTQAIRK"
FT   gene            complement(315823..317850)
FT                   /gene="accC"
FT                   /gene_synonym="fabG"
FT                   /locus_tag="XAC0263"
FT   CDS_pept        complement(315823..317850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /gene_synonym="fabG"
FT                   /locus_tag="XAC0263"
FT                   /product="biotin carboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35155"
FT                   /db_xref="GOA:Q8PQQ9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ9"
FT                   /protein_id="AAM35155.1"
FT                   /translation="MTQRDPIAAATQAPFDKILIANRGEIACRVIATCRALGIATVAVY
FT                   SDADRNARHVRMADEAVHIGAAPAQQSYLRGEAILQAARATGAQAIHPGYGFLSENAAF
FT                   AEACAHAGIVFIGPPAAAIRAMGDKSAAKALMQRAGVPLTPGYHGDEQAPAFLRAQADA
FT                   IGYPVLIKASAGGGGKGMRRVDASAAFDDALASCQREAQSAFGNAHVLVEKYVQRPRHI
FT                   EIQVFGDTHGEVVYLFERDCSVQRRHQKVLEEAPAPGMSEARRAAMGRAAVDAAQAVGY
FT                   VGAGTVEFIAGPDGDFYFMEMNTRLQVEHPVTELITGTDLVEWQLRVAAGARLPRRQHE
FT                   LRIHGHALEARLYAEDAERGFLPSTGTLRQLQMPAASAHVRVDAGVEQGDTISPYYDPM
FT                   IAKLIVWDTDRPAALARMRAALAQFHAIGVTTNSAFLSRLIATDSFASANLDTALIERE
FT                   HAVLFPEARSPDNAWWCLAAVLIADALPAVAVDPADPHSPWQHTDGWRIGAHAAQRIVL
FT                   EANGERRQLAVRPDADGWQVTNADQMHTLRYHRHETGLRVEMDGRQWRAQVLRDGATLT
FT                   LIGARQRAVFRHHDALAEADQPTQEAGGLTAPMPGRIVSLPATVGQPVARGQALVVLEA
FT                   MKMEHTLHAPSDGTVQAYLVAEGDLVDDGAALVEFVSASA"
FT   gene            complement(318083..319693)
FT                   /gene="accD"
FT                   /locus_tag="XAC0264"
FT   CDS_pept        complement(318083..319693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="XAC0264"
FT                   /product="acyl-CoA carboxyltransferase beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35156"
FT                   /db_xref="GOA:Q8PQQ8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ8"
FT                   /protein_id="AAM35156.1"
FT                   /translation="MSVIDSQLQVSGETFQHNAAAMRAVIDDLRRTLAQTARGGSDAAR
FT                   AKHTARGKLLARERIDALLDRGSALLEIAPLAAHGMYEDQVPCAGVVAGIGRVSGVECV
FT                   IVANDATVKGGTYYPMTVKKHLRAQEIAQQNRLPCIYLVDSGGAFLPLQDEVFPDRDHF
FT                   GRIFYNQANLSARGIPQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGADVHTRISGVADHFADNDLQALARVRAIIAQLNWRKPAASLALQAPL
FT                   PPRYAADELYGVIPADTRKPFDVREVIARVVDDSRLDEFKPRYGSTLVTGFAHLHGYPV
FT                   GIIANNGILFSESALKGAHFIELCTQRGIPLVFLQNITGFMVGRKYEHGGIAKDGAKLV
FT                   MAVACAKVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATV
FT                   RRDGIEAKGGTWSGEDEETFKAPIRAQFEQQGHPYYASARLWDDGIIDPADTRRVLGLG
FT                   LSAALNAPIEPTRFGVFRM"
FT   gene            complement(319704..320867)
FT                   /gene="acdA"
FT                   /gene_synonym="acd"
FT                   /locus_tag="XAC0265"
FT   CDS_pept        complement(319704..320867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /gene_synonym="acd"
FT                   /locus_tag="XAC0265"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35157"
FT                   /db_xref="GOA:Q8PQQ7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ7"
FT                   /protein_id="AAM35157.1"
FT                   /translation="MHVPSLNFELGEEIDLLRESVAAFASHHIAPLAAAADHDNVFPAQ
FT                   LWRLLGEQGLLGLTVEDAYGGSGMGYLAHVVAMEEISRAGGAIGLSYGAHSNLCLNQLR
FT                   KNASHAQKQRYLPKLCSGEHVGALAMSEAGSGSDVVSMKLRADARGDRFVLNGSKMWIT
FT                   NGPDADVLVVYAKTDPDAGARGITAFIVEKGMPGFSTAQKLDKLGMRGSNTCELVFTDC
FT                   EVPAENVLGTLNGGARVLMSGLDFERVVLAGGPLGLMAAAMDVVLPYVHERKQFGEPIG
FT                   TFQLMQAKLADMYVGLNACRAYVYAVARACDAGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QVLGGNGYINDYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFERTA"
FT   gene            320996..321616
FT                   /locus_tag="XAC0266"
FT   CDS_pept        320996..321616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0266"
FT                   /product="transcriptional regulator acrR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35158"
FT                   /db_xref="GOA:Q8PQQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ6"
FT                   /protein_id="AAM35158.1"
FT                   /translation="MAYRRSALMEERLAGNRERILHAARVLIAEGGYRNAPVTAVAAAA
FT                   GVSTGQIYRHFPSKAELFVEVLSEAVQREMAILRAIAATQASAAERLRSAIATFVRRAL
FT                   AGPALAYAFIAEPVESEVDAERIRGRRLFGEVFRQLLAEGVAAGEFPQQSLDAAAACIV
FT                   GAFTEALVGPIAPSRGDPQQGEQLVEAICGFCLRAVGAAQTSS"
FT   gene            321676..322077
FT                   /locus_tag="XAC0267"
FT   CDS_pept        321676..322077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ5"
FT                   /protein_id="AAM35159.1"
FT                   /translation="MHLPCRSRAMVAVLNPLALTERLRVPDRTILSPSAMASLLDLSQQ
FT                   ELADLAGVHRNSLRVHPESPRVQDLLRNLSRLLVAMAQVQPDERQVVFHLKNTPIPAFE
FT                   FATLLEVVKQGRTDDALTYLRTVAAGSAG"
FT   gene            322074..322601
FT                   /locus_tag="XAC0268"
FT   CDS_pept        322074..322601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35160"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ4"
FT                   /protein_id="AAM35160.1"
FT                   /translation="MRLSAPAYCTLYRAFTPRWAAEPLSGAGAARSGGRFNRFGQPALY
FT                   LSLQLETAASEYAQAAPFLPPLTLVSYAADLPALADLRLLDASWDAVWADWADDWRKAL
FT                   VNKIEPVSWVLGDLLREAEIPGVIFPSMARPEGVNVVLFLDMLQPERVLRVLDDGRLPR
FT                   DGRSWGDPPTVV"
FT   gene            complement(322923..323258)
FT                   /locus_tag="XAC0269"
FT   CDS_pept        complement(322923..323258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35161"
FT                   /db_xref="GOA:Q8PQQ3"
FT                   /db_xref="InterPro:IPR021762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ3"
FT                   /protein_id="AAM35161.1"
FT                   /translation="MSVLLLLALNFSGFAALCLAMDKHQQELRGRLLGTTRSRQLRVSG
FT                   WLLLCLTFALAVHAQGWGIGAVLWLGTLTASAAVLSLWLLPYRRGAILPAAVAAPVLAG
FT                   VVQVLTG"
FT   gene            complement(323255..324871)
FT                   /locus_tag="XAC0270"
FT   CDS_pept        complement(323255..324871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35162"
FT                   /db_xref="GOA:Q8PQQ2"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ2"
FT                   /protein_id="AAM35162.1"
FT                   /translation="MKQGFRQSMAWLHTWTGLLVGWVLLLIFMGGTASYYRDEISRWMR
FT                   PELPTTTVSTATALRSAEQYLQTHAADAVSWNITLPDARTPVVSMYWQNPAPADGKPVD
FT                   RRQMYGTAIIDPATGKDIAARDTLGGEFFYRLHFDLHYVPVMWARYIVGFCAMFMLVAI
FT                   ISGVITHKKIFKDFFTFRPGKGLRSWLDFHNVSAVTALPYHAMITYTGIVTLMFMYLPW
FT                   GIKARYASDEMRFYDEAANRVADTRKAAGVPAHMLPLEQFVARARSDWRGGEVGSVAVS
FT                   LPNDAHAAVGVSRLADNLSTDVPSILFDAVSGERLQRSGQPGGASQTRGVMVGLHLAHF
FT                   AGPWLRALFFGSGLLGCLMVASGVVMWAVKERPKHLKAGRIGFGLRLVDALNIGTVAGL
FT                   PIAFSSFFWANRVLPVSLDARAAMEANVFFAAWATALLAAFVWPRRAMWSWQLYLGAAL
FT                   FALVPVLNAITTDVHLGVTLPARQWALAGVDLVCLFLGLCLGIAGFRLQRWKAPQPASA
FT                   RRARAAAATPAQPAAPLQESA"
FT   gene            complement(324868..325332)
FT                   /locus_tag="XAC0271"
FT   CDS_pept        complement(324868..325332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35163"
FT                   /db_xref="GOA:Q8PQQ1"
FT                   /db_xref="InterPro:IPR022109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ1"
FT                   /protein_id="AAM35163.1"
FT                   /translation="MEQAPPLRRGDAWLARPTPHAVATCVCRPTRFGNGALRCGRCATS
FT                   IARGGVMSSASPLPLAWFRRPWLGVLARTLAAIFGGYALASATNLLLALVLPMPRSEAV
FT                   LSSMLIGIVVCACAPLWAFATASVWRACAGIAVPATLMFALAAWLQRSAA"
FT   gene            complement(325361..326005)
FT                   /locus_tag="XAC0272"
FT   CDS_pept        complement(325361..326005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQQ0"
FT                   /protein_id="AAM35164.1"
FT                   /translation="MKSFLLSCLALASISLSAQAHEIWIERDGSGPVRIFFGEPAQEAL
FT                   DHGQDEIKRVVKPSVFGAAGKAGPLQRGAEFLTAPLAGSGDAWLSDDSVFEPWKGEAGG
FT                   FETVSYYARAGRTTPAAKLNFELVPTAANSNTLTVLYRNKPLPKVEVTVIDPQKWQKTL
FT                   TSDAKGQVTLPTLRAGRHILVATNKEPVKREIAGKQVSMVHHISTLTFLAE"
FT   gene            326288..326806
FT                   /locus_tag="XAC0273"
FT   CDS_pept        326288..326806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0273"
FT                   /product="cytochrome C5"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35165"
FT                   /db_xref="GOA:Q8PQP9"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP9"
FT                   /protein_id="AAM35165.1"
FT                   /translation="MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAIPDEVSPTA
FT                   AKRVLQRIAPAGAVYAGATGASAQAAAQAAALAKAASQSAYGGTTDGKTIFNNLCTACH
FT                   TTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYTGPDGGIMPPKGGNPALTEEQVRAT
FT                   VDWMLGNLK"
FT   gene            326970..328799
FT                   /locus_tag="XAC0274"
FT   CDS_pept        326970..328799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0274"
FT                   /product="nuclease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35166"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP8"
FT                   /protein_id="AAM35166.1"
FT                   /translation="MPGGHSPWFASLFLRFSLSRAAFRAAFAFGFTYWSRSMSPRPLVV
FT                   LGLVGLLAPLLCSAADGAAQRLSIADVQGEDSRSPYDGRVVEVEGIVTADTRVGLAGLF
FT                   VQQPGFEPRRSHGLFVTGAGNAELAVGDRVRIVGTVREVSAGGEASLTTVDASSIERLA
FT                   SGQPVPVRMLSGPPANWEALEGEHVRIASLTLNGSDRLDTYGELVAAFGGRLWQPSEVA
FT                   AAGTPAFVQVQADNARRRVLLDDARNGRSPRTVSYLPADPVLRSGSLLKSVDGIVDQRY
FT                   DGNYRIQVLGPLTLPAMPTAVAPQVGGDLRIASFNLENFFNGNGRGGGFPTKRGARTHE
FT                   QFQAQLAKLVATIVPLGADVAALMEVENDGNGADAAVSQLVAALNAAGKDKDWQFVDTG
FT                   SGPGDDAIRVGIIYRSSQVTPVGRPATLTGGPFENHSRVPLAQAFRSARGATFVVVANH
FT                   FKSKGCGNASGADADQQDGQACWNATRTESAKRLHQWLQTDPTGAQTKLAVLLGDFNAY
FT                   AMETPMRSLRASGWQDAFAVAGVKQPYSYVYDGLSGRLDHALLSPAMAKQLRGAAEWHV
FT                   NADVMDAAGYAKRNLPGPWRSSDHDPVLLGFSL"
FT   gene            complement(329125..329511)
FT                   /locus_tag="XAC0275"
FT   CDS_pept        complement(329125..329511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35167"
FT                   /db_xref="GOA:Q8PQP7"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP7"
FT                   /protein_id="AAM35167.1"
FT                   /translation="MRATASLLDSSAIALSGLCLLHCLALPLLAATLPLLGVWSRAEWV
FT                   HVVFATAAVPLSGYALWSTHRRHALPAPVWVLALCGLAGLVIGASGLAGDALETPVTVA
FT                   GSLLLASTHLLNLRLRRRHGACAN"
FT   gene            329573..330898
FT                   /locus_tag="XAC0276"
FT   CDS_pept        329573..330898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0276"
FT                   /product="nitrile hydratase activator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35168"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP6"
FT                   /protein_id="AAM35168.1"
FT                   /translation="MSLSPQRDARLPVTVLSGFLGAGKTTLLNRILHNRDGLRVAVIVN
FT                   DMSEVNIDAQLVREGGAALRRTEETLVEFSNGCICCTLRDDLLQEVRRLAEQGRYDYLL
FT                   IESTGIAEPMPVAATFAVRDADGFSLSDIARLDTMVTVVDGSRFLEDFGSAATLADLGQ
FT                   QAGPDDTRGLVQLLGEQVEFADVLVISKCDRIDAQQLQRLRAVLRALNRDAAIVDAAHG
FT                   EVPLQQLLDTGRFDFTRAQLAPGWMQELRGQHTPETEEYGISSFVYRARRPFHPQRFAR
FT                   MVHSGLPQVIRSKGFFWLASRMDWVGELSSVGGATQTSAAGFWFAARHRVDAQAVGQPL
FT                   QTSITPLPYTDIGWQRQQTQCWTAPLPQPHEVGDASEYAAMQRLWHPLWGDRRQELAVI
FT                   GVDMDAPRTRAVLDACLLSDQELRQGPAQWQLLDDPFPHWAR"
FT   gene            complement(331068..332300)
FT                   /locus_tag="XAC0277"
FT   CDS_pept        complement(331068..332300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35169"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP5"
FT                   /protein_id="AAM35169.1"
FT                   /translation="MRLTSFFRSTHPVAPEPLNPATTDTTMTAATPSLHSLSHAPKAGT
FT                   AQGAAKSRQGMLASARKSLATLRKQLPSMCMGAPATKIAQSQPALATPAPNAARRGENQ
FT                   RPPVPQAGVDARWQAPEAMPPPRSRVPMHTAAPPPQPLSAARAAERFQQRQGGPEELPQ
FT                   QRVPSLARRDLARRDQVWQPQQPTHPSRPAPAASPKAATPAPPSPSRRLRPVRIMNLEL
FT                   AALNEQCHHIGRRLYKERRAPGPEERSVFEMRAALIAERDAVRDRQLDGMLAALAPLEK
FT                   IAAPKTTSNRLAMVQRDVMQSNRHALLAVRRENIDMTKMQVYFVRAQRRLESLKESGAP
FT                   PDKIRRLERMMQGYTNVLALQDIVRQTDEQLHRMGAPRLMDSIPTTAQERALSEQNELD
FT                   AHREAIENGYY"
FT   gene            complement(332399..333280)
FT                   /locus_tag="XAC0278"
FT   CDS_pept        complement(332399..333280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0278"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35170"
FT                   /db_xref="GOA:Q8PQP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP4"
FT                   /protein_id="AAM35170.1"
FT                   /translation="MPMHFLLFAVVCSVLVSVLLKLAPRHRIDVFQAITWNYATAALLA
FT                   WLILHPALDTLRSTTAPWVALLLLAVALPSIFLVLARSVAVAGIVRTDVAQRLSLVLSL
FT                   AAAFTVFGEPVNGWKLAGLALGMVAIACIVRRPRQHVATDPLPSTTGLPWLVGVWMGFA
FT                   LIDLLLKHIAQAGTPSLTSLTLCFALAFLLMLGVQSVRWARGARPSTRSMLAGVLLGAL
FT                   NFGNILCYVRAHQVLPHSPATVFASMNLGVVVLGALVGKLGFAERLGLRGWLGLALAAP
FT                   AIAAIAWGIRLG"
FT   gene            333341..334003
FT                   /locus_tag="XAC0279"
FT   CDS_pept        333341..334003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35171"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP3"
FT                   /protein_id="AAM35171.1"
FT                   /translation="MSNPSFPTESAALTLEGPVGPLDVAVDLPEPDVAAHAVTAIFCHP
FT                   LSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGNSAGAFDHGVGEQDDLRAVAEWV
FT                   RAQQPGHTLWLGGFSFGAYVALRAACSLQPQVLISIAPPAGRWDFSDIQPPAQWLVIQG
FT                   DADEIVDPQAVYDWLETLEQQPELVRMPDTSHFFHRKLIDLRGAIQHGVRRWLPAAV"
FT   gene            334091..335176
FT                   /locus_tag="XAC0280"
FT   CDS_pept        334091..335176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0280"
FT                   /product="ATPase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35172"
FT                   /db_xref="GOA:Q8PQP2"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP2"
FT                   /protein_id="AAM35172.1"
FT                   /translation="MTPSQRYAAGVQRGDWRADPAQQAALAELDRIHEALVDSAQDGWL
FT                   DRLSAFWKKPEPVRGLYFWGGVGRGKTFLVDLFYDGLPIEQKYRTHFHRFMRGVHEQLR
FT                   EHAGQSDPLARIAQQWRENLRVLVLDEFFVTDIGDAMLLARLLERLFAEGVTLVTTSNT
FT                   APENLYANGLQRDSFMPAIGLLQKFCVELYAEGTEDYRMRALTRSPVYRAPLDAQADDW
FT                   LAQRWAELSGNAEARAGNIEIEARKIPVRARGKSIAWFDFAALCEGPRGPSDYIEIARE
FT                   FTTVLLGGIPHFDRMNEDAARRFVNLIDELYDRHVNLVCTAQDAPPALYSGQRLAGAFE
FT                   RTASRLIEMQSAEYLATAHRA"
FT   gene            335549..336010
FT                   /locus_tag="XAC0281"
FT   CDS_pept        335549..336010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0281"
FT                   /product="transcriptional regulator marR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35173"
FT                   /db_xref="GOA:Q8PQP1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP1"
FT                   /protein_id="AAM35173.1"
FT                   /translation="MDTATATTARTDALLQLDNQLCFALYSANLAMHKLYRGLLKALDL
FT                   TYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVSRTRAANDERQVI
FT                   IALTETGRALRSKAGAVPEQVFCASACSLDELRQLKQELEKLRSSLGAG"
FT   gene            336110..336538
FT                   /gene="ohr"
FT                   /locus_tag="XAC0282"
FT   CDS_pept        336110..336538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="XAC0282"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35174"
FT                   /db_xref="GOA:P0A0V4"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0V4"
FT                   /protein_id="AAM35174.1"
FT                   /translation="MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGG
FT                   DGTNPEQLFAAGYAACFIGAMKAVAAQDKLKLPGEVSIDSSVGIGQIPGGFGIVVELRI
FT                   AVPGMDKAELQTLVDKAHQVCPYSNATRGNIDVTLTLA"
FT   gene            336818..337519
FT                   /gene="catD"
FT                   /locus_tag="XAC0283"
FT   CDS_pept        336818..337519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catD"
FT                   /locus_tag="XAC0283"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35175"
FT                   /db_xref="GOA:Q8PQP0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQP0"
FT                   /protein_id="AAM35175.1"
FT                   /translation="MSAPRPTLLLLPGLLNDAQLWQAQRVALADVADCVVGDITQGDSM
FT                   RALAMQLLAQMPLRFALAGFSLGGYVAQEILRIAPERVERLALLDTSARADPPERAAQR
FT                   RAQEASVRGANAFHGFGERLLRHYVHPSRWQDEVLLERVRDMTQRLGVEVFLRQNRLQR
FT                   EDGRALLRAYPGPLLVLCGQGDAITPPALHEEMAALAAHARLVQVPACGHLSPLEQPRA
FT                   VSDALREWLLA"
FT   gene            complement(337783..338676)
FT                   /locus_tag="XAC0284"
FT   CDS_pept        complement(337783..338676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35176"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN9"
FT                   /protein_id="AAM35176.1"
FT                   /translation="MHYRHPDFLPMATSCAVRNAAGPDSRASLMRSPVFLAPLWLLVAC
FT                   AAQAQTTAPRLSSQRCDVSTSYDVLADTGGIWLRRKQGLPREIFFHGGELNVDRQPQPV
FT                   SAADAQRLRELEQGTRALMPAVASIAQSVVDITFDALNGVVHVLSGSARQQRKVEQLRT
FT                   AARAQVDGSLGRGRWEQALFDERFEANVEQAAEALAGSLTRSVLWTVMTGRTAQLERRG
FT                   TELDAQMEQRMQARSDALEAQAQTLCTQAQALYGVQQALDYRFQGERLQMLELNTHQQK
FT                   HDADAAVSSAVATAAR"
FT   gene            338728..339228
FT                   /locus_tag="XAC0285"
FT   CDS_pept        338728..339228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN8"
FT                   /protein_id="AAM35177.1"
FT                   /translation="MTAFKRLAHLILTTDGVNYVAQQHRSRTMLDPRIEKVDLALTEIA
FT                   QDPSEKVALWQWACREMLHETLIGMHQLSHLAGIARQVANDWREPVDVIAPAKPYLAAS
FT                   ALADRRLPQVLDGLGSTHDDNDRATLWRLRYASLIASTLQGMQALAEKHRIDRQAMAIG
FT                   SLN"
FT   gene            complement(339534..340739)
FT                   /gene="avrXacE1"
FT                   /locus_tag="XAC0286"
FT   CDS_pept        complement(339534..340739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avrXacE1"
FT                   /locus_tag="XAC0286"
FT                   /product="avirulence protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35178"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN7"
FT                   /protein_id="AAM35178.1"
FT                   /translation="MGLCVSRPATSGSSVAASPEQHPNPASEQVTPHTPSVPETSVPPS
FT                   LQGLPTRCVPRARRGRSGKPTLQPHEVQQAAYQLGMRLSGRPIEDVRDRQRLADATATV
FT                   HETRLALHHGRGNIESDFRLSDGRSSTCSYLSYSFLSYWPGKHDIDLMAGCALAVSAGN
FT                   CDQNAAVNTRRHAVRMEGGGQITNVCDEACAHMYALYQPPGSAEADDSAVVLDSWSDGP
FT                   AVLLRDSRWAGTYRRTSTYPIERFDKPGAIDALARTRALQAEIEDPQTEFHAHLRGVES
FT                   VVRTPPVPGKIYASTPVIAPDLVQRTRQRLQELSPRTRKALAADAARQAYGLDDAQPIS
FT                   PRTTTAILKDAARLDALGRPPLSWAPTSHTRLKRFVTSARTNARQAFWYRSGWRPPVTV
FT                   AR"
FT   gene            complement(340916..341944)
FT                   /locus_tag="XAC0287"
FT   CDS_pept        complement(340916..341944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0287"
FT                   /product="quinone oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35179"
FT                   /db_xref="GOA:Q8PQN6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN6"
FT                   /protein_id="AAM35179.1"
FT                   /translation="MTSIINRRIVLASRPHGEPSADNFRIEEVPVAPTGHDQILVRNRF
FT                   LSLDPYMRGRMDEGPSYAAPVAIDAVMEGGTVGEVIASNHADYHPGDLLVLPGGWQAHS
FT                   LLTPTTPLRKLPKDDSLPPSTALGVYGMPGFTAYAGLHEIGKPQPGETLVVAAASGPVG
FT                   ATVAQLARLQGLRVVAIAGGAEKVRYLRDTLHVDVALDHRADDFAEQLRAATPNGIDIY
FT                   FENVGGKVFDAVLPQLNEFARIPVCGVIATYNSRGQAHPGPDRLPDFMGQVLRKRLTVR
FT                   GFIQHDFIRLMPAFLREMGQWLREDKIQYREHVLHGLDSAPQGLIDVLRGKNFGKAVVA
FT                   LA"
FT   gene            complement(342074..343045)
FT                   /gene="mocA"
FT                   /locus_tag="XAC0288"
FT   CDS_pept        complement(342074..343045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mocA"
FT                   /locus_tag="XAC0288"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35180"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN5"
FT                   /protein_id="AAM35180.1"
FT                   /translation="MTQPRALGRSGLQVQPIVFGGNVFGWSADEATSFALLDAFVDAGF
FT                   NLIDTADAYSGWVPGNRGGESETIIGRWLARSGKRDKVLIATKVAKWSEHPGLSPDNIA
FT                   AAVEDSLTRLQTDVIDLYQAHEDDESIPLEATLAAFGRLIEQGKVRAIGASNYSAARLR
FT                   DALDISEQYKLPRYESLQPEYNLYDRASYEAELEPLVRERELGVISYYSLASGFLTGKY
FT                   RSADDAGKSSARGASVVKQYVNPRGLRILQALDDLAVTHNATPAQIALAWLIARPGLTA
FT                   PIVSATSVTQLHDVLAAARVALSADQIAQLDSASAPESSAPR"
FT   gene            343314..344135
FT                   /locus_tag="XAC0289"
FT   CDS_pept        343314..344135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35181"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN4"
FT                   /protein_id="AAM35181.1"
FT                   /translation="MGVVVAMSAPLAMAVKPADSATLPAPDAALQAAIDGNWRDRVYVQ
FT                   RDQYRHPGQTLAFFGIKPTQTVIEITPGGGWYSEILAPYLREQGKYVAAVVDPASAPEG
FT                   RSREYAQRARDELEKKFHAKPEVYGKPSLVSYVPKSPSFGVDNSADLVLTFRNVHNWRM
FT                   AGTAEAMFAGFYKVLKPGGVLGVVEHRAKADVPADDKSGYVGQAQVIAMAEAAGFTLVG
FT                   KSEVNANPRDTKDYPGGVWTLPPSNSHDKADDAKYQAIGESDRMTLKFVKR"
FT   gene            344222..344800
FT                   /locus_tag="XAC0290"
FT   CDS_pept        344222..344800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0290"
FT                   /product="pseudouridylate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35182"
FT                   /db_xref="GOA:Q8PQN3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQN3"
FT                   /protein_id="AAM35182.1"
FT                   /translation="MAMLVLLNKPYGVLSQFSDRSQPPKRTLAEFGLPPDVYAAGRLDH
FT                   DSEGLLVLTDDGALAHRLTDPRHKQPKTYWVQVEGAPQAEHLQALRDGVALNDGPTRPA
FT                   QVRMLDPAPQLWPRDPPVRVRKTVPDAWLELQITEGRNRQVRRMTAAVGLPTLRLVRVA
FT                   IGDWRLDALAPGQWRAEATTNARPSRSRR"
FT   gene            complement(344924..347917)
FT                   /gene="oar"
FT                   /locus_tag="XAC0291"
FT   CDS_pept        complement(344924..347917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oar"
FT                   /locus_tag="XAC0291"
FT                   /product="Oar protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35183"
FT                   /db_xref="GOA:Q8PQN2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN2"
FT                   /protein_id="AAM35183.1"
FT                   /translation="MTALSPTLRPSALALALLFASASPLAFAQSTTGSIAGQAPTSATR
FT                   IAVRSDTGLTREVEVDARGRYALGQLPLGTYSVVAKDAAGNVLTSRQAVTLTVGTTTDV
FT                   SFGAVTQLDGVSVTADRAAAAIDVTTVDSRTVITAEQLRRLPLGRSAEAIAQLAPGVVG
FT                   NSGSGTYSGPSGEQLVSFGGSSAAENAYYINGFNTTDPLRGLGGLTLPYGSIDQQEIYT
FT                   GGYSAKYGRSDGGVINAVGKRGTNEWHFGGQALWEPASTRADKDDVRYPANGALYRPDS
FT                   QDRQWVSTQSVYAGGPLIQDKLFVFGSYELERRQGRELDSVEDTNADTGYQYDRPRWYG
FT                   KLDWNITDNHLLELTGASSRNVYRGSIYNYDYAALTRGSLRGQDDTTKTGGNLWSAKYT
FT                   GYLTDRLTVSALYGKMKTDDYVGNPAYDGSLTYLSNTSLQNPALNGGNPITNAQTTSLL
FT                   VDPDRGNRTDNLRLDLNYVIGQHSITAGIDNQNARALNRGSVTSGDGYYWIYGQSNPNV
FT                   PINTGLGVPATGGIVNGEDGYYVRRYISSALASVRSAQRAQYIEDNWQVSDRLLLNLGL
FT                   RLDQFTNYNRDGDAYIKQSSGQWAPRLGFSWDVDGDGHFKVFGNAGRYYLALPLNPAFN
FT                   AAGATLATSTYYTYGGIDANGYPTDLTQFTQAVSSNNNYGVLPDPKTVATSGIKPSFQD
FT                   EFILGFSKTLGESWVYGAKGTYRLLRSGVDDYCDIDAVLAKSDALGYNVTKQSNPVSCW
FT                   LINPGKANTFTLVDTGGNYVSVPLNNAELGMPAFKRNYYALNLSLEHPFDSRWYAKVDY
FT                   TFSRSYGTTEGQLLSNIGQTAVATSQAWDYAQLMDHTNGPQSNDHTHQLKVYGYYQLSP
FT                   QWLVSANLAVVTGAPFSPLGSYGPNFEDPAGYGIAYHYYQGQPAPPGSQGRLPTMTQLD
FT                   LGLAYRPDIADGKLGFNLDVFNVFNTQTALWRYPYSELDPGQPDPLYGAANVRQAPRSL
FT                   RVSVSFDY"
FT   gene            complement(348207..348638)
FT                   /locus_tag="XAC0292"
FT   CDS_pept        complement(348207..348638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35184"
FT                   /db_xref="GOA:Q8PQN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN1"
FT                   /protein_id="AAM35184.1"
FT                   /translation="MSKLTVITERALERALELAGTAGDQLRHAASNAGDQARNAGSSLR
FT                   HFGPSASEWLKTGAALGAVRTGGKAASKLVKRNPAVTVAAAVAGLGLIGYAVYRKRQRD
FT                   QQVLGGNVHRLDREHASNANARRAAYQRRGAVTPSDGIE"
FT   gene            complement(348799..351300)
FT                   /gene="hrpB"
FT                   /locus_tag="XAC0293"
FT   CDS_pept        complement(348799..351300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="XAC0293"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35185"
FT                   /db_xref="GOA:Q8PQN0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQN0"
FT                   /protein_id="AAM35185.1"
FT                   /translation="MTDPAFPISPLLPRMRDSLAAHPRLVLEAPPGAGKTTQVPLALLD
FT                   APWLAGRKIVMLEPRRVAARSAAQFMARQLGEPVGETVGYRIRFENKTSARTRIEVVTE
FT                   GILTRLIQDDPMLESVGVLLFDEFHERHLAGDLGLALALDVQAQVRDDLRIVAMSATLD
FT                   GERLAGFLEAPRLSSAGRSFPVEIAHFPARRDEALEPQTRRAVEHALSTHPGDVLVFLP
FT                   GQREIARVHGALQDVLDPAVQVLALHGELSVEAQSQVLQPGPQGRRRVVLATNVAESSV
FT                   TLPGVRVVIDSGLAREPHYDPNSGFSRLDVAAIAQASADQRAGRAGRVASGWAYRLWPQ
FT                   SQRLEPQRRAEITQVELTGLALELAAWGSSALRFVDAPPSGALAAAHELLQRLGALTAS
FT                   GGITALGRRMLALGTHPRLAAMLAQAGEATRVALACDLAALLEARDPLRQGGDGLAARW
FT                   RALAAFRQGRSAADANRGGLAAIDSAARQWRRRLRCDSVPPSSVEAHALGDLLSHAFPD
FT                   RIAARHPADPLRYLLANGRSARLFDHSDLRGEPWLVASELRYEAKDALLLRAAPVDEAY
FT                   LRRSLPERFVQQDVVQWDADKRALVARRQSSFDRIVLDSRPAGRVDPAHAAGALTDAVR
FT                   QLGLDALPWTENLQQWRARVQSLRRWMPELALPDLSDAALLETLDTWLRPAFAGKTRLD
FT                   ALDEASLGEALKSALPWERRQSIDRHAPTRISVPSGMERPISYALDHAGQPLPPVLAVK
FT                   LQELFGLAETPRIADGRIPLTLHLLSPGGRPLQVTQDLKSFWATTYPDVKKEMKGRYPR
FT                   HPWPDDPWTAAATHRAKPRGT"
FT   gene            complement(352363..352836)
FT                   /locus_tag="XAC0294"
FT   CDS_pept        complement(352363..352836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35186"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM9"
FT                   /protein_id="AAM35186.1"
FT                   /translation="MIHNDVLRSIRYMLDLSDDKVVDITHLADPEFALDKPQVQAWLKK
FT                   EDEPGFEPCTDAMLARFLDGLVLRFRGRDESQPPRPLETRVGNNLVLKKLRVAFELKDV
FT                   DMHAIFASAGFPLSKPELSALFRQPGHKNFRPCGDQLLRAFLKGLTARMREAG"
FT   gene            complement(353002..353361)
FT                   /locus_tag="XAC0295"
FT   CDS_pept        complement(353002..353361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35187"
FT                   /db_xref="GOA:Q8PQM8"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM8"
FT                   /protein_id="AAM35187.1"
FT                   /translation="MAAASSGGGMSTLSTHVLDTASGRPAAGVPLRLFAGDTLHFEGVT
FT                   NHDGRCPDLAALALQPGRYRLEFDLARYWQATGMALADPPFLDRIPIAFGIADDGHYHV
FT                   PLLLSPYGYSTYRGS"
FT   gene            complement(353331..354752)
FT                   /locus_tag="XAC0296"
FT   CDS_pept        complement(353331..354752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0296"
FT                   /product="monoxygenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35188"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM7"
FT                   /protein_id="AAM35188.1"
FT                   /translation="MSLAHLERTLAHDLQCLAHGGDAWVQPRVHPSGHVYDVIIVGAGQ
FT                   SGLGAAFALQRERVHNVLVIDENPAGQEGPWVTYARMQTLRTPKHITSIDLGVPSLTFR
FT                   AWWEAQYGSAAWDALDKIPRARWMDYLRWYRTTLRLPVRNATRVVRVEPHLAPGIHRLH
FT                   LAMGAPLLARKLILATGIQGGGQWVVPEWISRALPAHRYAHTSSHIDFAALAGKRVGIL
FT                   GGGASAFDNACFALEQGVASAEVFVRRTELPRINPFRHMEQAGIIPRFLALPDADKYRM
FT                   MASFFAHNQPPTNDTFQRACAHAGFALHLGAPWLDVAERDGEIVVRTPQREHRFDFLAV
FT                   ATGLVTDPQLRPELAALSGRIACWGDRYQPPPGQANPVLDAHPYLGPGFELLPRTPDDA
FT                   ALLHGLFAFNYSALINHGPSAAALSGLKVALPRLARAVADQLFLDDRQAIVDQYLAYDQ
FT                   PEFVGQWPQPAQAVA"
FT   gene            complement(354749..355240)
FT                   /locus_tag="XAC0297"
FT   CDS_pept        complement(354749..355240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35189"
FT                   /db_xref="GOA:Q8PQM6"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM6"
FT                   /protein_id="AAM35189.1"
FT                   /translation="MSVVDDPGLDDAAFMARYRDLFEHSPWVVERALRRRPFVDVHRGL
FT                   MQVVYDASPQDQVALIRAHPELAGKAAIDRTLTAASAAEQASAGLDRLDEDEFKRFHAL
FT                   NQAYRHRFGFPFVICVRLHDKAGILAALEQRLDASRNAEIATAIAEIGKIVHLRLEALS
FT                   "
FT   gene            complement(355237..355632)
FT                   /locus_tag="XAC0298"
FT   CDS_pept        complement(355237..355632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35190"
FT                   /db_xref="InterPro:IPR024507"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM5"
FT                   /protein_id="AAM35190.1"
FT                   /translation="MSIAASEIDLPEVIAQVTAAFHAYEAALMRDDIAAMDTLFHAAPS
FT                   TVRYGVGEVLYGIDAIRAFRIGRGGSPQRQLAHVQVHGFGHDFATTHAEFIREGSSARG
FT                   RQSQSWVRFADGWKVVAAHVSLQGTHA"
FT   gene            complement(355629..356519)
FT                   /locus_tag="XAC0299"
FT   CDS_pept        complement(355629..356519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35191"
FT                   /db_xref="GOA:Q8PQM4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM4"
FT                   /protein_id="AAM35191.1"
FT                   /translation="MNAARDLVGYGATPPAAQWPGSARIAVQFVVNYEEGAENCVLNGD
FT                   AGSEAFLSEMVGAQAHAGARAMAMESLYEYGSRAGFWRLHRLFTARNVPVTVFGVAQAL
FT                   ASNPDAVAAMQAAQWEIASHGLRWIDYQHVDEATERAHIAEAIAVHTRVTGSRPLGWYQ
FT                   GRTSPNTARLIAEEGGFVYDADSYADDVPYYDHRHGRAQLIVPYTLDANDMKFVAYNGF
FT                   ADGEPFFRYLRDSFEQLRGEGGRMLSIGLHGRIVGKPARAAALARFVDHVLASGDAWIA
FT                   RRIDIARHWLQVHPA"
FT   gene            complement(356516..357772)
FT                   /locus_tag="XAC0300"
FT   CDS_pept        complement(356516..357772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0300"
FT                   /product="serine-pyruvate aminotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35192"
FT                   /db_xref="GOA:Q8PQM3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM3"
FT                   /protein_id="AAM35192.1"
FT                   /translation="MSPDLRQLHTFGELDPPQRLLMGPGPVNAHPRVLRAMAADLLGQF
FT                   DPEMTTYMNEVMALYRPLFGTENRWTFLVDGTARAGIEAALVSLVSPGERVLVLNFGRF
FT                   GLLLTEILGRLGADVHSVDAPWGQVLPLSAIAEAIERVAPQLVATVHGDTSTTMAQPLD
FT                   GVGALCRAAGALSYVDATATIGGMPIASDRWDVDVVTGGLQKCLGGPSGSAPITVSERA
FT                   AEAIFARRHVERGIVRADIANGSGPRIASNYFDLAMIMDYWSDKRLNHHTEATTMLYGA
FT                   RECARVALQEGLDARFARHAAAGRAVSAGIRALGLEVFGDDAHRMTNVTGVVIPPGIDS
FT                   EAVRRRMREDFEIEIGTAFGPLQGRIWRIGAMGYNAMKHKVLITLAALEAVLRAEGYAC
FT                   THGLAVEAALAAWHAEVQA"
FT   gene            complement(357762..359033)
FT                   /gene="amaB"
FT                   /locus_tag="XAC0301"
FT   CDS_pept        complement(357762..359033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="XAC0301"
FT                   /product="N-carbamyl-L-amino acid amidohydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35193"
FT                   /db_xref="GOA:Q8PQM2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM2"
FT                   /protein_id="AAM35193.1"
FT                   /translation="MLSAQRSSPVHSSGARAVARCDALGLPPYSDTPGGLFRAWLTPAH
FT                   RAAVAQVSEWMRQAGMQVRLDAAANLVGRYEGARADAPALLIGSHLDSVRDAGRYDGPL
FT                   GILLGIECVAALHAHGRRLPFAIEVIAFGDEEGSRFPASMFCSRAVAGTLDPTTLAVTD
FT                   TAGITVASALAEWNLDIAHVQHAARAPGSVLAYLETHIEQGPVLEAEGLPLGIVSAIAA
FT                   QRRFALRFEGRAGHAGTTSMALRRDALSAAAEALLAIERIARAGSSDLVATVGKLQVAP
FT                   GATTVVPGRVDCSLDVRAGSDAGRDAAVQQIEQALAQIAIHRGIAIAIEPLQTLAASPC
FT                   APALIMRLEQAVAAQGIAPRQLVSGAGHDAMVMAALCPTAMLFVRCAGGISHHPDEHVD
FT                   PADVEIALAAMRHFIDHLGDPLVT"
FT   gene            359407..360360
FT                   /locus_tag="XAC0302"
FT   CDS_pept        359407..360360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0302"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35194"
FT                   /db_xref="GOA:Q8PQM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM1"
FT                   /protein_id="AAM35194.1"
FT                   /translation="MGSLFHRLLQSCGFHERDSPMARDNFKDLLALIAIVREGSFTRAA
FT                   AKLGVSQSALSHTIRGLEATLGLRLLTRTTRSVAPTEAGERLIQTVAPRFAEIEEALSA
FT                   LGEMRNTPAGTVRITATDYAARAILWPKLSRLLRDYPEIKVEIVVDNGLTDIVADRYDL
FT                   GVRLGDQVEKDMIAARIAPDMRMAIVAAPSYLERRPIPKTPQDLTAHSCINLRMKTAGG
FT                   IYAWELEKNGREVIVRVDGQLTFNGIYEALDAAVDGFGIAFVQEDLARPHIKAGRLRWV
FT                   MKDWSPTWPGLHAFYPSRRHSSSAFNLVVDALRYKG"
FT   gene            360678..361877
FT                   /gene="opdE"
FT                   /locus_tag="XAC0303"
FT   CDS_pept        360678..361877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opdE"
FT                   /locus_tag="XAC0303"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35195"
FT                   /db_xref="GOA:Q8PQM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQM0"
FT                   /protein_id="AAM35195.1"
FT                   /translation="MQASSLATDSTSRTAPVATRQTWSAVGSMSLCVALLIASEFMPVS
FT                   LLTPIASDLHASAGMAGQAISISGLFAVVASLLIAPLSSRFNRRHVLIALTGMMLLSLL
FT                   LIANAHSFGMLMVARALLGITIGGFWALSTATVMRLMPEHAVPKALGIVFIGNAVAAAF
FT                   AAPLGSYLGASIGWRGVFWGMLPLVALTIVWQWRSLPSMLAQGATSLGSIVTLLKRRYV
FT                   ARAMLAVMLGFAGAFSAFTYFRPFLETVAQVDVSQLSLLLLGLGLAGFVGTSAATALVP
FT                   KRLFTLLSVLPVALGVVTISMLLAGHLVWAVAVAMIAWGTLNSAMPVAWSTWLSRCVKD
FT                   APESGGGLMVAAIQLSIMLGGAAGGVLLDHVSIGATFVGASVLLLASSLVAGRGDRLQP
FT                   "
FT   gene            complement(362194..362586)
FT                   /gene="gvpU"
FT                   /locus_tag="XAC0304"
FT   CDS_pept        complement(362194..362586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpU"
FT                   /locus_tag="XAC0304"
FT                   /product="gas vesicle protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL9"
FT                   /protein_id="AAM35196.1"
FT                   /translation="MDWYLQKLVGIANTSDVQFGVTLFVEGIVISGQLVSGKRYFEAFA
FT                   QEFSAAYPGGADEKEDIRRAFASHASIYDSEDDTQQSSTPPQFIHLIESRCFSPGGQPL
FT                   PSNRGVLWRGKVNAVSGFTLGSLSAD"
FT   gene            complement(362876..364456)
FT                   /gene="ggt"
FT                   /locus_tag="XAC0305"
FT   CDS_pept        complement(362876..364456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="XAC0305"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35197"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL8"
FT                   /protein_id="AAM35197.1"
FT                   /translation="MLQTLRARRGMVVAPHHLAAQAGRDVLRDGGTAIEAAVATAACLA
FT                   VVYPHMTGIGGDGFWLIHEPDGRVHAIDACGRAAQAATLDFYRGHAHIPWRGPGAANTV
FT                   AGTVSGWALALQQANGNLSLQRLLSDAIHHASAGVPVTLGGAQIAASKGAELRPQPGAY
FT                   REIFEPHAVPLQEGALLQQPQLARSLQRLADEGLEGFYRGSLAHDIAADLHALGSPLSA
FT                   HDLAAHRADASVPLSVVIQGARLYNHAPPTQGLASLLILALFDRLKVESADGHAHLHGL
FT                   IEASKQAFLIRDAHLGDPAWMTLDAQALLDDSAALDALAARIDMSAALPWPQPSQAGDT
FT                   VWFGAIDAHGRAVSCIQSTYFEFGSGLVLPRTGITWQNRGCSFRLAPDGWNALVPGRKP
FT                   FHTLNPALATFDDGRVMAYGTMGGEGQPQTQAAVFSRYARFGMPLQQAVSAPRWLLGRT
FT                   WGEDSTSLKLENRFDPAVVQALRNAGHAVELLPAYSSVMGHAGALVRERDGVLSGASDP
FT                   RSDGAVAAW"
FT   gene            complement(364456..365868)
FT                   /gene="gatA"
FT                   /locus_tag="XAC0306"
FT   CDS_pept        complement(364456..365868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="XAC0306"
FT                   /product="Glu-tRNAGln amidotransferase A subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35198"
FT                   /db_xref="GOA:Q8PQL7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL7"
FT                   /protein_id="AAM35198.1"
FT                   /translation="MLRGHAQLLATFHGPPATAHEGGGPRGQIASIVSTTRSQPTLAAR
FT                   LATQTLTRINQANDRLCAITRLLPARAAADAARVQAALAGGSDGGALAGVPFVVKDLFD
FT                   VAGQVTTAGAAVRAHCPPASRDAAVVQRLGEAGAVLVGTANMDEFAYGFATVNAHYGTT
FT                   ANPHDDQHLAGGSSGGSAAAVAAGLVPFALGSDTNGSIRVPAALCGIYGLRPTHGAVPL
FT                   DGVFPFVDALDVVGPFATSVADLRCVYDVLRGQPLPSCHAGKLRVARLGGWFQRNLDPD
FT                   LEAGLQALLAACNSLASIDLPEAERARAAAFVLTAAEGGHRHRSALTAHGAQFDPATRD
FT                   RLLAGLQLPASAVADAHRFAQWFADAMHALWDQVDVLIAPATPCVAPRIDQDTIQIDGL
FT                   PVSARANLGIFTQPLGLAACPVLAAPLPRPGRLPLGVQLIAAPGREDRLFALAAQLERD
FT                   GLLAFSPPPEPR"
FT   gene            complement(366399..367568)
FT                   /locus_tag="XAC0307"
FT   CDS_pept        complement(366399..367568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0307"
FT                   /product="nucleoside hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35199"
FT                   /db_xref="GOA:Q8PQL6"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL6"
FT                   /protein_id="AAM35199.1"
FT                   /translation="MPHSIAGAMPSTFHDKNAMTDPHLPSSRRRVILEDDIDGFTPAQL
FT                   LLLQSPDVEVLGISAVSGNIWRDEVLAHTCRLLELAGHPQIPVLPGPVHPLINSELATE
FT                   RWEALYGKLVWKGAWTKHWVDGDTVQSAPRYHAHDVVPDLALGNPSVVRPSDEPAALFM
FT                   LRMVRQYPGEVSIIATGPLTNLALAQSLDPAFATLARELVYMGGSLNPRQQRNSVSAQQ
FT                   FAREFINSPRREFNIRWDPEAASIVMRAPWRRITMVPVDPSTATELTAELLARMSAADT
FT                   TIGHALRRREPGFPMWDELATAVWLRPELARHTETLYVDTNTAFDAGYGDILSWAPGYQ
FT                   PGLGEQAQTVVHAVDVPALEQLLVDRLTAPQPPAVGSPLPLRPSGPRSP"
FT   gene            complement(367666..368835)
FT                   /gene="add"
FT                   /locus_tag="XAC0308"
FT   CDS_pept        complement(367666..368835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="XAC0308"
FT                   /product="adenosine deaminase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35200"
FT                   /db_xref="GOA:Q8PQL5"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL5"
FT                   /protein_id="AAM35200.1"
FT                   /translation="MRNFLPGPAQPSGHDQFFSTFGKFDAVVRTRVADTVAAVLEQAAR
FT                   DRVPYVEIIANPPQMDQAAKRMQSLPWKGEDDAANLRALQPDLAPLVQAAQRDLADIDA
FT                   QVRRVLRCDQADARPGCTVEYRYVPYVLRVLPQPMVFGQMALAHALIAAGGSRAVALNI
FT                   VAPEDNPVALADYARHMAMFRFFATRYPGVPLSLHAGELALGLVPPAQLRSHIRQAVDA
FT                   GARRIGHGVDLPYEDDAEVLLQRMRREQVAVEINLTSNDVILGIKGAAHPLALYLRAGV
FT                   PVVLSTDDAGVSRADMTHEYQRAMEEQGIDYPTLKQLARNGLRYSFLPGASLWDADGKA
FT                   AQVCATALQRETDDAACRAFRQGSEKARLQWQLETDLAQYERTLLLQHR"
FT   gene            complement(369343..370656)
FT                   /gene="yieG"
FT                   /locus_tag="XAC0309"
FT   CDS_pept        complement(369343..370656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yieG"
FT                   /locus_tag="XAC0309"
FT                   /product="xanthine/uracil permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35201"
FT                   /db_xref="GOA:Q8PQL4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL4"
FT                   /protein_id="AAM35201.1"
FT                   /translation="MRWPGFALAANGSTVRTEMLAGATTFLTMAYIVFVNPDILATTGM
FT                   DHGAVFVATCLAAALGSLLMGVLANYPIGMAPGMGLNAFFAFGVVGTLGYSWQQTLGLV
FT                   FVSGCLFLLLTVTGARRWLVDGIPTTLRSAIAAGIGLFLALIGLQKAGLVVAHPQTLLT
FT                   LGDLHRPEPLLALAGLLLIGVLEVRRVRGAMLLGILAVTWAALALGLVRYEGVLALPPS
FT                   LAPTVLQLDIVGALRGHGGGGALAAVLHVVLVFVLVEMFDATGTLMGVAQRAGLLHTPA
FT                   QRRQFDRALLADSTVILAGALLGTSSTTAYVESAAGVQVGGRTGLTALVVAALFLLALL
FT                   FSPLAAMVPAYATAPALIYLASVMLRECTQIQWDDVGDALPAAICMLAMPLTYSIATGL
FT                   AFGFITYAALRLGSGRWRGVHPATWTIAGLFVLRYALE"
FT   gene            complement(371027..371986)
FT                   /gene="vanB"
FT                   /locus_tag="XAC0310"
FT   CDS_pept        complement(371027..371986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanB"
FT                   /locus_tag="XAC0310"
FT                   /product="vanillate O-demethylase oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35202"
FT                   /db_xref="GOA:Q8PQL3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL3"
FT                   /protein_id="AAM35202.1"
FT                   /translation="MSLHEVRVADVVDQGHRQRAIRLEPVGAQLPAFEAGAHVDLHLPD
FT                   GLIRQYSIASAPHVRDHYLLCVKLADASRGGSRHLCEQLAPGDRLRISTPRNLFPLHPG
FT                   ERHVLLAAGIGITPLLSMAEALEARGEPFVLHYYARRHADVAFSQRLQQGFTHGQVSLH
FT                   LSDGGQSPRVHVPEELGQARACDQLYLCGPAAFMDHFTVLAKAHGWTAAQLHREHFAAP
FT                   APSLAHDADSAFEVELAASGRVVQVPADCSIASALLDAGIEVPLSCEQGMCGACLTGVL
FT                   AGTPDHRDSVLSDAERATNRQITVCCSRSRSPRLVLDL"
FT   gene            complement(372004..373056)
FT                   /gene="vanA"
FT                   /locus_tag="XAC0311"
FT   CDS_pept        complement(372004..373056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="XAC0311"
FT                   /product="vanillate O-demethylase oxygenase subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35203"
FT                   /db_xref="GOA:Q8PQL2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL2"
FT                   /protein_id="AAM35203.1"
FT                   /translation="MDVAVPTLPLHCTFDAADWQRLAQHWHAVALSSEVSEAPFKATLL
FT                   DEPLVLYRLGSELVAARDVCPHRGVPLSMGTADGGGVVCAYHGLRFGAGGRCNHIPASP
FT                   SQNIPAKMRLHTYAVAERYGLIWVCLAKPAGVSDADIQIPPMPGWDEDGFQQIVCPAFD
FT                   IGGSAARQLEGFIDVAHFAFVRTATFAQPDKREVPAYTTTETPTGFNADYLSTVANYSV
FT                   DMPLPDVDPNFQWLRHFEVHLPFTATLTIHFPVPGKRLVIMNAASPVSKHTTRLLVPIA
FT                   RNFDTHLPVEDVHAFNLRVFEEDRAMVEAQRPEYLPLDPLLEVHIPADRSSIAYRRGLR
FT                   SQGYSDFFLR"
FT   gene            373182..374099
FT                   /locus_tag="XAC0312"
FT   CDS_pept        373182..374099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0312"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35204"
FT                   /db_xref="GOA:Q8PQL1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL1"
FT                   /protein_id="AAM35204.1"
FT                   /translation="MLTFSRFTRYFIEVARCGSIRKASEVLHVSASAIDRQILKAEEEL
FT                   GAQLFERLPGRLRLTAAGELLLVDVRGWEKAYARTLERFDELKGLRRGHVEIAMIDALS
FT                   EGLVPAAVAALVQEYPGITFNLSTARNQRVMEMVTSADVDIGLLLDPVSSVDLEVRAFA
FT                   DIPLGIAMPVGHPLSTRTELQLSETLEHRLLLPAAPLIVGEHAKVLYQRQHIDVKRLTH
FT                   CNDVRTLRGLVRAGAGVGLMSWLDAAPDVADGRLAFVPFRQHLTKPMTLALCVAPQRQL
FT                   SRSAQLAIQALAAKIDAMAVPAVE"
FT   gene            374409..375221
FT                   /gene="mttC"
FT                   /locus_tag="XAC0313"
FT   CDS_pept        374409..375221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mttC"
FT                   /locus_tag="XAC0313"
FT                   /product="type V secretory pathway protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35205"
FT                   /db_xref="GOA:Q8PQL0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQL0"
FT                   /protein_id="AAM35205.1"
FT                   /translation="MQLIDIGANLTHDSFDRDRDAVLQRARDAGVAQLVITGASREHSP
FT                   LALQLAQQHPGFLYATAGVHPHHAVEFTAECEAEMRTLQAHPQVVAVGECGLDYFRDFA
FT                   PRPAQRKAFERQLQLAADNGKPLFLHQRDAHEDFIAIMRSFEGRLGAAVVHCFTGTRDE
FT                   LFAYLDRDYYIGITGWLCDERRGAHLRELVRNIPANRLMIETDAPYLLPRTLKPMPKDR
FT                   RNEPMFLSHIVEELARDRGEDVAVTAANSTAAARAFFRLSAPASTTSG"
FT   gene            complement(375362..376030)
FT                   /locus_tag="XAC0314"
FT   CDS_pept        complement(375362..376030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35206"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK9"
FT                   /protein_id="AAM35206.1"
FT                   /translation="MHLRHLVLPCLDPGLTLRFYRDVLQLPVHGNTVRIGWSTLECVQA
FT                   QHPVGSAHLAFNVAPSRFQAAAQWIGARATLLSDPHGRKHFALDGAWQSHSVYFGGPDG
FT                   AVLELIARNALQDAAAGEGQFRGEELLCLSEIGLPSHNVEVVTRSLAHHFGLRPFAPPL
FT                   EGIAALGDDHGLLIVVDRRRRWFPQQRQLPWADGLRISVDAPEPGLRLRDAQGWELLAA
FT                   "
FT   gene            376314..377240
FT                   /locus_tag="XAC0315"
FT   CDS_pept        376314..377240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0315"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35207"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK8"
FT                   /protein_id="AAM35207.1"
FT                   /translation="MGDAKMGNCLRIPAAHMAPELREHGTPEASTSTPMSHAGSMTAGP
FT                   QEHSAVESCAGSQIADMWLSSLERPARRSSGSRSQSTAQSRPQSKLEKLTETRRSMLQR
FT                   AIILDDQWRSLQERCAGTSVGGRQASNLDNLKGIIDRDRQALESMGHEGGYIAQRRLDR
FT                   IDRNLLNFEKKIGNQKKLESHLAKSNDFLVRLKLLKQELSTRGEKRHILNDVDLNIKDL
FT                   EDISNELAGTDANGSGIEYNGCRGDAIAYFDSVTISLEAMLRSQDPGYWDYMRPALANV
FT                   LKEGYSPSRRKAVSDPGMHDGASDGIS"
FT   gene            complement(377525..378412)
FT                   /locus_tag="XAC0316"
FT   CDS_pept        complement(377525..378412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0316"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35208"
FT                   /db_xref="GOA:Q8PQK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK7"
FT                   /protein_id="AAM35208.1"
FT                   /translation="MELRHLRYFLAVAEEGNFTRAAARVGIGQPPLSQQIQTLERELGT
FT                   PLFRRTHSGAELTAAGEAFLGEVRRVLADVERAAETARRVARGESGRLRLGFTASAAFS
FT                   PVVPRLIRDFRRKWPQVELLLEETNTASLLVGLADGRLDAAFVRYGLSTPAELQLLRFA
FT                   DEPMKIAVPAAHPLATRNSAPLAALAGEPFILFPRSFGSSLYDEILAACRDSGVTLRIT
FT                   QEAPQMSSIINLVAAELGVSVVPASTAQLQRPGVRYLDIEGHMPLARLALAAAPGGLET
FT                   TPLVRHLWALAKLL"
FT   gene            378428..379789
FT                   /gene="ynfM"
FT                   /locus_tag="XAC0317"
FT   CDS_pept        378428..379789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynfM"
FT                   /locus_tag="XAC0317"
FT                   /product="MFS transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35209"
FT                   /db_xref="GOA:Q8PQK6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK6"
FT                   /protein_id="AAM35209.1"
FT                   /translation="MAAATIIYWTGGDGRRILAFPRRTCTAVSSSDHRSGSLPDPSTRS
FT                   DTGVDAPAGVRIRVALFLAGFATFSLLYSVQPVLPEFARAFKVDAATASLPLSLATGAL
FT                   ALAIFCAGAVSENLGRRGLMFVSIAIAAVLNLIAAFLPHWGALVVVRTLSGIALGGVPA
FT                   VAMVYLGEELPASKMGAATGLYVAGNAFGGMSGRIVMSVLTDHTDWRTALAVLSAFDLL
FT                   CALAFFWLLPPSRNFVRRHGINLRFHLRAWAGHLRDRNLPFLFALPFLLMGVFVCLYNY
FT                   AGFRLGGPEFGLSQSQIGMIFSAYVFGIVSSSVAGAASDRFGRGPVVTTGIVLCVLGVA
FT                   LTLAHALALVVAGIVVVTIGFFIAHSAASAWVSRLGGAHRSHAASLYLLAYYAGSSVIG
FT                   ALGGWFWQHGGWGALVGMCLTLLAIAFAAAYVLRQRADDARPYGRFAPHPARGE"
FT   gene            complement(379809..380216)
FT                   /locus_tag="XAC0318"
FT   CDS_pept        complement(379809..380216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0318"
FT                   /product="transcriptional regulator merR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35210"
FT                   /db_xref="GOA:Q8PQK5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK5"
FT                   /protein_id="AAM35210.1"
FT                   /translation="MLRIGALAQQTGASVRSIRHYDAHGLLTSSRSANGYRVFPHACVA
FT                   QVRQIQRLIATGFNLDEILGFPDCMRLVEGAQMCPETAQAHRARLQLIERQLADLERRR
FT                   ARLSATLAQAAPDARAATSSAAQTTRRKRAR"
FT   gene            380408..381247
FT                   /locus_tag="XAC0319"
FT   CDS_pept        380408..381247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0319"
FT                   /product="chloroperoxidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35211"
FT                   /db_xref="GOA:Q8PQK4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK4"
FT                   /protein_id="AAM35211.1"
FT                   /translation="MATASPGAIAATRSYTVTAPDGVRLAVQEHGATDGPAIVFVHGLL
FT                   GSRINWDAQLADARLQRYRLITYDLRGHGVSGKPVAASAYQEGTRWADDLAAVLKAANA
FT                   RETVLVGWSLGGAVISNYLSRYGDTGLAGVVYVDGVIELRAEQLGAHPAIYRDLVSPDL
FT                   RTHLQAVQDFLRLCFATQPPIPVFEALLASASLASWDMQRAVQGMSVDVAGLQRTRLPV
FT                   LLMYGARDALVATEPTVARARQLQPRAQTVLYPDAGHAPFLEDSARFNQDLLRFVEH"
FT   gene            381425..382408
FT                   /locus_tag="XAC0320"
FT   CDS_pept        381425..382408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0320"
FT                   /product="SIR2-like regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35212"
FT                   /db_xref="GOA:Q8PQK3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQK3"
FT                   /protein_id="AAM35212.1"
FT                   /translation="MREQARRSGGRHGAAAGRARGAVAKCSHGFRNDHMTAVPAHDHHT
FT                   LQDFIERHQRLFVLTGAGCSTDSGIPDYRDLQGGWKRPQPVTFQAFMGELSTRQRYWAR
FT                   SLVGWPRFGLAQPNATHHALAALEARGQLEVLLTQNVDRLHQAAGSQAVIDLHGRLDVV
FT                   RCMGCERRMPRTEFQVLLEQANPGWAALEAAQAPDGDADLDDVAFEHFVVPPCPVCGGV
FT                   LKPNVVFFGENVPRARVERAFAHLQAADAVLVVGSSLMVYSGFRFVQTAARNGLPIAAL
FT                   NFGRTRADELLTLKVEQSCAQALAFLHAPPHLPRARSVNDASARSA"
FT   gene            382489..383586
FT                   /gene="frp"
FT                   /locus_tag="XAC0321"
FT   CDS_pept        382489..383586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frp"
FT                   /locus_tag="XAC0321"
FT                   /product="FMN oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35213"
FT                   /db_xref="GOA:Q8PQK2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK2"
FT                   /protein_id="AAM35213.1"
FT                   /translation="MSQLFSPIAFGPLALANRIVIAPMCQYSAQNGRASDWHRIHLGTL
FT                   SQSGAGLLILEAAAVVPEGRISYADLGLYDDATEQALAEVLQSVRRWSPMPIGIQLAHA
FT                   GRKASTDLPWKGGEAIAPDHAHGWQTVSASALPFRQGQPAPQTLDEAGIDAVVDAFVAS
FT                   ATRAERLGLELIELHAAHGYLMHQFLSPLSNQRSDAYGGSLENRMRLTLRIFDAVRAAV
FT                   SEKIAVGVRISATDWVEGGWDVQQSIALSQALDARGAHYIHVSSGGLDPRQQIPLQAGY
FT                   QIPFAQEIRAQVNTPVIGVGLITEPAQAEAILQEGQADAIALARGILYDPRWPWHAAAA
FT                   LGASVTPAPQYLRCEPRDARGVFAN"
FT   gene            383622..384500
FT                   /locus_tag="XAC0322"
FT   CDS_pept        383622..384500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0322"
FT                   /product="dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35214"
FT                   /db_xref="GOA:Q8PQK1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK1"
FT                   /protein_id="AAM35214.1"
FT                   /translation="MPIGFLGLGTMGLPMAHNLLRGGFALSVWNRSPERAHSLRDAGAT
FT                   VVEQPRDAAHGPLLFSMLADDNAVRQTLLERGVLDALPAGSVHVNMATISVALAHELTA
FT                   LHAERGVAYVAAPVLGRVEVAEAGNLNILAAGDEAAVARVQPMFDALGQKTWYIGRAPE
FT                   QANAVKLAANFCLASAIGAMAEASALARGHGVDATQFLGMLTSTLFAAPAYQGYGRLIM
FT                   QREYLPAGFTATLGRKDVDLAIQAGADKQVPMPLGELLRAGLDEAIAHGDGHADWAVLA
FT                   EVSARRAGQVA"
FT   gene            384688..385098
FT                   /locus_tag="XAC0323"
FT   CDS_pept        384688..385098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQK0"
FT                   /protein_id="AAM35215.1"
FT                   /translation="MRRWRTMTDAPVVNQGPVGPDHPEHPDHYLFAQIREAVGVLDAEL
FT                   GKPVDEASERMAARLLPLAKQHGFDQVDYVVLSRHLGEVGENVFLVRGELSDPAHLRAH
FT                   ITTQEAMETSVDASLAQLDEINRRLMLRLPRR"
FT   gene            385337..386188
FT                   /gene="purU"
FT                   /locus_tag="XAC0324"
FT   CDS_pept        385337..386188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="XAC0324"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35216"
FT                   /db_xref="GOA:Q8PQJ9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ9"
FT                   /protein_id="AAM35216.1"
FT                   /translation="MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGR
FT                   FFLRVHFDKPAKTDIAALEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCLNDLL
FT                   FRAHSRQLRVDIAAVASNHTDFAALAGSYGIAFHHLPVSADTRAEQEAQLLALVDALQI
FT                   DLVVLARYMQILSPQLCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYV
FT                   TEDLDEGPIIEQDVARVDHAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVV
FT                   FR"
FT   gene            complement(386341..387024)
FT                   /gene="smeR"
FT                   /locus_tag="XAC0325"
FT   CDS_pept        complement(386341..387024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smeR"
FT                   /locus_tag="XAC0325"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35217"
FT                   /db_xref="GOA:Q8PQJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ8"
FT                   /protein_id="AAM35217.1"
FT                   /translation="MSSASPIGHVLIVEDEPRLAAVLGEYLHAAGYSHDWIADGAQALG
FT                   AFRAQQPDLVLLDLMLPNRGGLDICRDLRNESAVPVIMVTARVEEIDRLLGLEIGADDY
FT                   ICKPFSPREVVARVQAVLRRHRHDPHGAPAPGLQIDEDACRASVDGRALDLTQVEFRLL
FT                   RTLAAAPGRVYSREQLMGRLYADHRIVTDRTVDSHVKNLRRKLADAGGEDWVRSVYGAG
FT                   YRFEP"
FT   gene            complement(387021..388400)
FT                   /gene="smeS"
FT                   /locus_tag="XAC0326"
FT   CDS_pept        complement(387021..388400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smeS"
FT                   /locus_tag="XAC0326"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35218"
FT                   /db_xref="GOA:Q8PQJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ7"
FT                   /protein_id="AAM35218.1"
FT                   /translation="MKLGITAKLFLAILAACVAVLLINGIAVQAFVKRQFLDYLNEQGV
FT                   ERMQETLPRVRAEYARHGNWEFVRDNPDAWFVLMRPERGPGPPREAPPISDQTGAVFRF
FT                   ALLDQDYTPVIGNPEVGRHDILRPVVVGGRTVGWMAMLPFQKALAAADARFYAAQQRAW
FT                   WAIGGACLLVAALLGWLLSRTLLRRLRGLTQATHLLAAGDYATRIDAAARDELGQLARD
FT                   FNLLAQALEHNERARRDFMADISHELRTPLAVLRAELEALQDGIRPMTPNSLGSLHQQV
FT                   GQLGKLIEDLYDVSLTDVGALAYRRAPVDLAVILATVLDGLRARFAAAQLQVQAQIDAG
FT                   PLQVDGDERRLQQLLGNLLENTLRYTDAGGTVQVRCVRRGAVLEMVVEDSAPGVDADKR
FT                   ARLFERFYRTEASRNRASGGSGLGLAICRNIAEAHGGSIHAEASALGGLRMVLRLPALV
FT                   A"
FT   gene            388561..389787
FT                   /gene="smeA"
FT                   /locus_tag="XAC0327"
FT   CDS_pept        388561..389787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smeA"
FT                   /locus_tag="XAC0327"
FT                   /product="acriflavin resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35219"
FT                   /db_xref="GOA:Q8PQJ6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ6"
FT                   /protein_id="AAM35219.1"
FT                   /translation="MLPVAAHRFRTASLRWLLPAAVTTLMAACSSRQPPQMPQTQVGVQ
FT                   TLKVQRLAVDQTLSGRTVAYVTSDVRPQVGGIVRKRLFTEGQDVQAGQVLYEIDPASYQ
FT                   AAYDTAKGDLAQAEAAVLSARPKAQRYQTLVGLDAVSKQDGDDALATLRSNEAAVVAAK
FT                   ASLQTARINLDYTRITAPVSGRIGTSSYTSGALVSAGQSEVLATINQLDPIYVDVTQSS
FT                   AQLLQLRRQLDAGQLKAVDGKAEVTLQLEDGSTYAHSGTLEVVDAAVDTATGTVKLRAV
FT                   VPNPERLLLPGMYVTAKLSMAVDEQAILVPQQAISRNSKGQAVALVVGSDNKVAQRVLT
FT                   TGDAIGDKWVVRQGLKAGDKVIVQGLQKASVGAEVKAVEVTAAAMAGNAAATAPAATQG
FT                   TAAAAPKAD"
FT   gene            389797..392946
FT                   /gene="smeB"
FT                   /locus_tag="XAC0328"
FT   CDS_pept        389797..392946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smeB"
FT                   /locus_tag="XAC0328"
FT                   /product="multidrug efflux transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35220"
FT                   /db_xref="GOA:Q8PQJ5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ5"
FT                   /protein_id="AAM35220.1"
FT                   /translation="MARFFIDRPIFAWVIAIVITLAGALSILSLPLEQYPNIAPPTINV
FT                   SATYTGASAQTVQNSVTQILEQQMTGLDHLLYMSSSSSSAGTASITLTFESGTDPDTAQ
FT                   VQVQNKVSQGEAMLPEAVQSNGVTVTKSTGSSMFMVLAFTSEDGSMDSTDIGDYMVSTL
FT                   QDPISRLNGVGGVNVFGSEYAMRVWLDPEKLRTYSLMPADVSNAISAQNADVSSGALGA
FT                   LPAVQGQQLNATVTSRSKLKTPAQFEAIVLKSQPGGATVYLRDVARVELGSKSYASSSK
FT                   YNGKSASGMGLELATGANALDAAKAVEAKLEQLKPYFPTGLTYEVAYDTTPFVRISIEE
FT                   VVKTLLEAIVLVVLVMYLFLQNWRATLVPVIAVPVVLLGTFGVLALLGYSINTLTMFAM
FT                   VLAIGLLVDDAIVVVENVERLMSEQGMSPRQATYTSMGQISGALVGIALVLTAVFLPMA
FT                   FFGGATGEIYRQFSVTIAAAMLLSLLVALTLSPALCASLLRPIAHGQQVSRKGVLGRFF
FT                   GWFNVRFDRGADGYGRGVGKLIGHRKLGGLVYLALLVVMALLFWRLPSSFLPDEDQGML
FT                   MVMFTTPAGATQQRTQQSIDQATSFILKQPEVAGMMTISGFSFAGSSQNSGMGFIKLKD
FT                   WAQRDAPAQEIANRITGAMMGTLPDAQVFALSPPAINGLGSSSGFTLELQDVAGKGHDA
FT                   LVAARQQLLQLASADKDLTAVRFNGLEDAPTYRVQIDDAKAGALGLDASDINTTLATVM
FT                   GGSYVNDFLNNNRVKRVYVQGEARARMLPADIGCWYVRNSSSEMVPFSAFSSSAWAYAP
FT                   QVLSRFNGVESMEITGSAATGISSGEAMNGIAALVGKLGKDVSYAWSGMSYQEQAAGAQ
FT                   TWMLYAVSLVFVFLCLAALYESWSIPISVMLAVPVGIVGALLATWLRGLSNDIYFQVGL
FT                   LATMGLAAKNGILIVEFAKELEEKGQPLIEATLHAARMRLRPIVMTSLAFLLGVLPMVV
FT                   SSGAGSGGRHSLGTGVLGGTLVSTLLGIFFVPLFYVMVRSVFPGRASDHATAAETSEVA
FT                   P"
FT   gene            392943..394409
FT                   /gene="smeC"
FT                   /locus_tag="XAC0329"
FT   CDS_pept        392943..394409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smeC"
FT                   /locus_tag="XAC0329"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35221"
FT                   /db_xref="GOA:Q8PQJ4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ4"
FT                   /protein_id="AAM35221.1"
FT                   /translation="MMRYGFASVAVACAIALSGCVSMAPHYARPDAPVPSVIGSTGSTG
FT                   NADTGTPNAAALDWRQVVTDARLQQVVALALDNNRDLRVAVLNIEQARAQYRIQRANLF
FT                   PSVDATVSHTAQRAAAATSFTGAAQVIRSASGEVGISSWELDLFGRIRSLKNEALESYL
FT                   ASEQTQRSTRLSLVAEVANDWLTVAADQQRLALAQQTLDSQRKTLRLTELQHDNGIVSG
FT                   LDLAQIQTSVESARADVANYATQLAQSRNALNLVVGTSVPVALLPASDAIETGVALAPL
FT                   PAQLESRVLLQRPDVLPAEHTLKAANADIGAARAAFFPTISLTANAGRGSDALSSLFDG
FT                   DHTWSFSPSVSVPIFRAGALKAELDVATLQKDITIAQYELAIQTAFSEVADALAERTQL
FT                   EERMHAQQAMVDAAQRSFSLSDARYRNGVDSYLVALDAQRTLYSAQQTLISLRLTEANN
FT                   RVTLYKVLGGGADAQSAVASTQGPAPALQR"
FT   gene            complement(394471..396144)
FT                   /gene="cmfA"
FT                   /locus_tag="XAC0330"
FT   CDS_pept        complement(394471..396144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmfA"
FT                   /locus_tag="XAC0330"
FT                   /product="conditioned medium factor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35222"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ3"
FT                   /protein_id="AAM35222.1"
FT                   /translation="MAALQLAGARATAVATPLHAQRTLLGTAEHGTSGMRYAVESARNG
FT                   AWSLTLQSSSPVAQRGYVLMEGDARTQLASYLRTRQQQVGQSLTLNALLSGNDARGATL
FT                   LTAQAGTIDQASLRVIDPQGGVRSLPMADDGKHGDGAAGDGVYGGTFQPTSEGTWIAQV
FT                   IVHGHDQAGQPFVRTSEHVVPVVDTSLRLLGNALGARAAEGTQLTIALPVAARGNAPSH
FT                   YRVFGQVWGTDAKGKDVPVAWIAGMLTPQQGQLHLSLDERWIARAGARAPFTLRSLRIE
FT                   DPDHYIPLVQAGALPLQVPALRRASLAHASTAIDESMRMGPRPTALASAMATAQPQAAG
FT                   SQLVLVHGYCSNGVWPQAQFTNASTFLDAKQNRSNDQFAQRLAQFASQWSSFSTVAHSQ
FT                   GGMAALHLYTYYWSGLDNATGGRVMQSVGTPYQGTNLSGVLAAVGSWFGVGCGTNSDMT
FT                   YDGAKAWLAGIPADARAKVNYYTTSFAKTNWYTNDYCNAASDLVLNDPEDGTVEQVNAQ
FT                   LPGGVNRGHTTGQCHTTGMRDPAQYLDANRNAVMNANAAR"
FT   gene            complement(396860..397738)
FT                   /gene="metF"
FT                   /locus_tag="XAC0331"
FT   CDS_pept        complement(396860..397738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="XAC0331"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35223"
FT                   /db_xref="GOA:Q8PQJ2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ2"
FT                   /protein_id="AAM35223.1"
FT                   /translation="MPSGASTITDTYSLEVSVKDIGALTNAAPRILPGSDMFIPYLPGQ
FT                   TEAARLAAAQRVRRLGFEPVPHLSARRIGSLEELQAVIARLVGEADVTRCLVIAGDPST
FT                   PKGPFADSVSLIETGVFERSGIRTIGVAGHPEGHPIMRTTEQWDVLERKCRSIQERGMA
FT                   PLIVTQFGFDADIVMTWLEALRARGMTHPVRVGVPGPASVAVLARYAASCGVGACASVL
FT                   SNYGISIGKLFGNAGPDRFVDRLVSRLTEAHGDVRLHFFPFGGIAQSVEWVAHYRSCEA
FT                   SQDRVSSVAAD"
FT   gene            complement(397869..398525)
FT                   /locus_tag="XAC0332"
FT   CDS_pept        complement(397869..398525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35224"
FT                   /db_xref="GOA:Q8PQJ1"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ1"
FT                   /protein_id="AAM35224.1"
FT                   /translation="MDATAQRMPLPLPDGHAKVLLHSCCAPCSGEVMEAMLASGIDYTI
FT                   FFYNPNIHPRKEYELRKDENVRFAEQFGVPFIDADYDRDNWFERARGMENEPERGVRCT
FT                   MCFDMRFERTALYAHEHGFPVITSSLGISRWKNMQQINDCGMRAAAKYPGLMYWEYNWR
FT                   KGGGASRMIQISKRENFYQQEYCGCVYSLRDTNRHRVDSGRKRIQLGVKFYGDDE"
FT   gene            complement(398525..399439)
FT                   /gene="metR"
FT                   /locus_tag="XAC0333"
FT   CDS_pept        complement(398525..399439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="XAC0333"
FT                   /product="transcriptional regulator metE/metH family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35225"
FT                   /db_xref="GOA:Q8PQJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQJ0"
FT                   /protein_id="AAM35225.1"
FT                   /translation="MLERIHLTIVQQVEQQGSLTAAAGVLNLTQSALSHSMKKLEQQLG
FT                   TDIWLREGRSLRLTQAGQYLLAVANRVLPQLDLAEERLGQFAQGERGALRIGMECHPCY
FT                   QWLLKLVAPYLATWPDVDVDVKQKFQFGGIGALFGYEIDLLVTPDPLFKPGLRFEPVFH
FT                   YEQVLVVAKRHALASAAYVKPQQLTREVLISYPVDLERLDIYSQFLLPAGVTPRRHKAI
FT                   ETTDIMMQMVASGRGVAAMPRWLVEEYAARMDVVPVRLGARGIPKQIYLGAREADIAID
FT                   YLRAFIELARAPANATAYPQGPH"
FT   gene            399630..400217
FT                   /gene="sflA"
FT                   /locus_tag="XAC0334"
FT   CDS_pept        399630..400217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sflA"
FT                   /locus_tag="XAC0334"
FT                   /product="NADH-dependent FMN reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35226"
FT                   /db_xref="GOA:Q8PQI9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI9"
FT                   /protein_id="AAM35226.1"
FT                   /translation="MTVKHPLRVVAVSGGMQRPSKAVALAEHLLELIADQVPCERHLVE
FT                   IGALAPHFAGALWRTQVPGTVEQALCLVEQADVLVVATPVYRGSFTGLFKHFFDFIDQD
FT                   ALIDTPVLLAATGGSDRHALVIDHQLRPLFSFFQARTLPLGVYATDRDFLDYRVHNDAL
FT                   AERARLAVQRALPLIELTRHARSSAAQGVAAA"
FT   gene            400359..401342
FT                   /locus_tag="XAC0335"
FT   CDS_pept        400359..401342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35227"
FT                   /db_xref="InterPro:IPR015004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI8"
FT                   /protein_id="AAM35227.1"
FT                   /translation="MTHVLNFTIKSLRFDEDYHPSATTRNTTNFANLARGQRRQENLRN
FT                   TLAMINNRCNDLAHWDNPNRDRYAVELDIISVEMHIGERALDDAFPLIEILKPTIVDRH
FT                   TGARIDGIAGNNFSSYVRDYDFSVLLPAHNQDASGFNIPDDFGDLHGKLFKHFVHSPAY
FT                   CAHFQKSPVICISVSTSRTYHRTGNRHPILGIEYRQDAVSLTDQYFEKMGLQVRYFMPP
FT                   SSVAPLAFYFFGDLLGDYTNLELIGTIATMETFQKIYRPEIYNANAAAGPTYQPSLKHQ
FT                   DYSSTQIVYDRQERSQLAVTQGKFTEEHFIRPYGNLLAQWASSRAS"
FT   gene            401371..402399
FT                   /gene="metE"
FT                   /locus_tag="XAC0336"
FT   CDS_pept        401371..402399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="XAC0336"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35228"
FT                   /db_xref="GOA:Q8PQI7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR016456"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI7"
FT                   /protein_id="AAM35228.1"
FT                   /translation="MTKLLPTSTAGSLPKPSWLAQPETLWSPWKLQDAELIEGKQDALR
FT                   LSLQEQQHAGIDIVSDGEQTRQHFVTTFIEHLSGVDFEKRETVRIRDRYDASVPTVVGA
FT                   VSRPRSVFVDDAKFLRQQTRQPIKWALPGPMTMIDTLFDAHYKSREKLAWEFAKILNQE
FT                   ARELEAAGVDIIQFDEPAFNVFFDEVNDWGVATLERAVEGLKCETAVHICYGYGIKANT
FT                   DWKQTLGSEWRQYEESFPKLQTSSLDIISLECHNSHVPIDLIELVRGKKVMVGAIDVAS
FT                   TTIETPQEVAETLRKALRFVDADKLYPSTNCGMAPLARHVARGKLSALSAGAQIVRGEL
FT                   SA"
FT   gene            complement(402606..403562)
FT                   /gene="kdgT"
FT                   /locus_tag="XAC0337"
FT   CDS_pept        complement(402606..403562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="XAC0337"
FT                   /product="2-keto-3-deoxy-D-gluconate transport system"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35229"
FT                   /db_xref="GOA:Q8PQI6"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQI6"
FT                   /protein_id="AAM35229.1"
FT                   /translation="MRIKATVERLPGGMMLVPLLLGALCHTLWPQAGSTLGSFSNGLIS
FT                   GTVPILAVWFFCMGATIQLRASGRVLRRSGSLVLTKIAVAWLVAVLCAPLLPIGGVSSG
FT                   PLAGLSVLALVAAMDMTNGGLYAALMQQYGSSEDAGAVVLMSLESGPLISMLILGASGL
FT                   ASFEPQLFVGAVLPLLLGFALGNLDAELRQFFAQATKTLVPFFGFALGNTLDLSTIAHT
FT                   GTSGVLLGVAVVVITGLPLLLADRWIGGGNGTAGVAASSTAGAAVATPALIAGMAPQFA
FT                   PAAPAATALVASAVIVTSLLVPLLTALYARRGDARSG"
FT   gene            complement(403716..405365)
FT                   /locus_tag="XAC0338"
FT   CDS_pept        complement(403716..405365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35230"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI5"
FT                   /protein_id="AAM35230.1"
FT                   /translation="MTQGRDSEVRQCHQTDIKSKYNCCHCRYVRTTGAWQALPRRAAAL
FT                   LAAPDRRSRRPVSLARAGPMKKRNLATVLCALSATASGSTLAAELELYVDRKTKQIFAE
FT                   PAPGRDKLGTFVQVDENGKLPASAMPAVPAQPLPPAPGAATPADAAIAQVAPMPAPVAT
FT                   PAPAKSGDAGKKWYDKLSLRGYTQIRYNQGIGGDAQDLRAPGDRFIGNDQSLGIRRARL
FT                   VLSGDLNEHVSLYFQPDFASTPTGSTTSNFAQLRDAYADIFFDKKREYRVRVGQSKMPY
FT                   GWENLQSSQNRLSLDRADALNSGLRDERDIGAVFYYSPTVAKGRFQDLVKSGLKGSGDY
FT                   GVIGAGVYNGQGANRAERNDSMHAVVHATYPFKFANGQYLEVGADAYAGRFVPTAAAVN
FT                   IGGRSFTPAITEPNGYTDQRVAAHIIYYPQPFGLQAEWTVGRGPELDVAQRRIRTRSLS
FT                   GGYVQAMFKHDFNYGTLLPYLKWQTYRGGSKFDTNAPRMRLDEVEAGVEWQPMDALELV
FT                   FAYSKMKRTDVGTAPYPVVEGDLLRLQLQVNY"
FT   gene            complement(405999..406877)
FT                   /locus_tag="XAC0339"
FT   CDS_pept        complement(405999..406877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0339"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35231"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI4"
FT                   /protein_id="AAM35231.1"
FT                   /translation="MTSISPLTLVTGASGQLGALVVEALLGHLPANRIVATARDTASLA
FT                   EFAKRDIAVRQADYANPQSLDTAFAGVGRVLLVSSNAVGQRVPQHRNVIEAAKRAGVEL
FT                   LAYTSILHADTSTLSLAAEHVATEALLRESGVPHALLRNGWYTENYTGSIAAEVAHGAV
FT                   IGSAGEGRISAATRADYAAAAAAVLASDAPQAGQVYELAGDTAFTMAEYAAEVAQQSGK
FT                   PVAYHDLPEVDYAAALVQIGLPAGFAQVLAQCSAASRDGALFDDRHTLSRLIGRPTTPL
FT                   RDAVAAALAAR"
FT   gene            407014..407445
FT                   /locus_tag="XAC0340"
FT   CDS_pept        407014..407445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35232"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI3"
FT                   /protein_id="AAM35232.1"
FT                   /translation="MNAIALFPPPPSLEGPFDATKCPVRDVLDQIGDKWTLLILLTLIP
FT                   GPSRFSAIQRAVPDISKRMLTQTLRNLERNGMITRKVYATKPPSVEYALSKLGIALLGP
FT                   VSQLLTWAGENHGSIRAARERFDRAQQAAVALDPDEAMA"
FT   gene            complement(408352..408600)
FT                   /locus_tag="XAC0341"
FT   CDS_pept        complement(408352..408600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI2"
FT                   /protein_id="AAM35233.1"
FT                   /translation="MENYQLVTSPLCRSVTTDGRTIRLEIYRGPDTGWTLEAVDEFNNS
FT                   TVWDDLFATDQAALDEALRTIRDEGIDSLIGPPSGVH"
FT   gene            complement(408997..409815)
FT                   /locus_tag="XAC0342"
FT   CDS_pept        complement(408997..409815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0342"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35234"
FT                   /db_xref="GOA:Q8NL47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NL47"
FT                   /protein_id="AAM35234.1"
FT                   /translation="MCRVLRVNRAGYYAWLKSPDSERAKEDERLLGLIKHHWLASGSVY
FT                   GHRKIAKDLRDLGERCSRHRVHRLMRTEGLRAQVGYGRKPRFHGGTPCKAAANLLDRQF
FT                   DVTEPDTAWASDFTFIRTHEGWMYLAVVIDLFSRQVVGWAMRDRADTELVVQALLSAVW
FT                   RRKPSAGCLVHSDQGSVYTSDDWRSFLASHGLVCSMSRRGNCHDNAPVESFFGLLKRER
FT                   IRRRIYPTKDAARAEVFDYIEMFYNPQRRHGSTGDLSPVEFERRYAQRGS"
FT   gene            complement(409869..410141)
FT                   /locus_tag="XAC0343"
FT   CDS_pept        complement(409869..410141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0343"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35235"
FT                   /db_xref="GOA:Q8NKZ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NKZ0"
FT                   /protein_id="AAM35235.1"
FT                   /translation="MSSKRYTDEFKIEAVRQVTDRGFKVAEVAERLGVTTHSLYAWLRK
FT                   FGKPGVVQRAEADQSAEVRRLKIELRRVTEERDILKKAAAYFAKG"
FT   gene            410422..410838
FT                   /gene="int"
FT                   /locus_tag="XAC0344"
FT   CDS_pept        410422..410838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="XAC0344"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35236"
FT                   /db_xref="GOA:Q8PQI1"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQI1"
FT                   /protein_id="AAM35236.1"
FT                   /translation="MTPPTPKLLDQVRGRLRLRHYSLRTEQAYVSWIRRFILASGQRHP
FT                   GQMGQVEGEAFLTKLAARGQVSAGTQEVARLLSMLEGNCRLVAGLLYGSGMRLLECLRL
FT                   RSKAMDIVRGEIAVRDGWDASICGMWSAGRAQPS"
FT   gene            complement(411090..412928)
FT                   /gene="ilvD"
FT                   /locus_tag="XAC0345"
FT   CDS_pept        complement(411090..412928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="XAC0345"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35237"
FT                   /db_xref="GOA:Q8PQI0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQI0"
FT                   /protein_id="AAM35237.1"
FT                   /translation="MPEYRSKTSTHGRNMAGARALWRATGMRDGDFHKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIERVGGVAKEFDTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTKLAEHKLDLI
FT                   DAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVAT
FT                   HADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIATFEAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEGEVAFGMQDIDRLSKRVPQLCKVAPNTPKYHIEDVHRAGGIMAILGELARG
FT                   GLLHTNAATVHARTLADAIAQWDVTQTDDENVHTFYKAGPAGIPTQIAFSQATRWDSLD
FT                   TDRSDGCIRDVAHAFSQEGGLAVLYGNIARDGCVVKTAGVDESIHVFEGTARVFESQDA
FT                   AVKGILADEVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVREGDRILIDIPNRSINLLISDEELALRRAEQDAKGWK
FT                   PVEVRPRKVTTALKAYALLATSADKGAVRDKALLDG"
FT   gene            413313..414674
FT                   /locus_tag="XAC0346"
FT   CDS_pept        413313..414674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0346"
FT                   /product="degenerated cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35238"
FT                   /db_xref="GOA:Q8PQH9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH9"
FT                   /protein_id="AAM35238.1"
FT                   /translation="MSDHPSPRRAPAAPPHSTTPPVAGGITRRRVLQGAAGAAVVATAG
FT                   WAGRAAAQSASLPFAGLNLSGLASNSYVENAEIGTHYRAITAQHVAAAGSCPLFRLPTT
FT                   AARFTRGQGAPLNESYCKQVQDALDNIAARGKRAIVELHDYMRLPQRVAAKSGYRRDAS
FT                   GAVVDARGIRVGDLAAAELWADTYPLRNFNYVGYLDGRDQLLKLYEYRVIGTPGCTLYN
FT                   DAGLPDLWARIVNRFKQHPAVFGWGVMNEPYQGAERNADGTVLSMAAHWQKTATACSKT
FT                   IIDRDRNHFVFVCGNGYASARRWQDDSMDLFDIPDPYDRIVYEAHNYLDNNGSGGGNWI
FT                   GPGGRNEVIQPDTGINMVSPFIEALQQAGKRGYLGEHGYPAGNRSAEIATTRMLAHLQA
FT                   YNIPSTQWCFGPGWPDDDVLGMSRDVGADIQAKANLAAVQAFFDVRLSSYIPPR"
FT   gene            414729..414989
FT                   /locus_tag="XAC0347"
FT   CDS_pept        414729..414989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0347"
FT                   /product="proteinase inhibitor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35239"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH8"
FT                   /protein_id="AAM35239.1"
FT                   /translation="MDIPCRAGCAACCIAPSISSAIPGMPHGKPAGVPCVQLDGQGRCR
FT                   LFGLPTRPAVCTSLRPSPDMCGASRAQALATLTALEHATRP"
FT   gene            complement(415047..415592)
FT                   /locus_tag="XAC0348"
FT   CDS_pept        complement(415047..415592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0348"
FT                   /product="transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35240"
FT                   /db_xref="GOA:Q8PQH7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH7"
FT                   /protein_id="AAM35240.1"
FT                   /translation="MTPIRSFLDHTPQLGARVYVDPACTIIGKVSLGDDVSIWPGTVIR
FT                   GDVNHVQIGARTNVQDGTIIHVSHHSPFNKAGYPTVIGEDVTVGHGTILHACTIEDLCL
FT                   IGMGACVLDGATVRRYGFVGAGAVVGPGKVVGEAELWLGNPARLARTLSDKEIESLHYS
FT                   AQHYVRLKDQYLGASPAS"
FT   gene            416057..417367
FT                   /gene="vanK"
FT                   /locus_tag="XAC0349"
FT   CDS_pept        416057..417367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanK"
FT                   /locus_tag="XAC0349"
FT                   /product="MFS transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35241"
FT                   /db_xref="GOA:Q8PQH6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH6"
FT                   /protein_id="AAM35241.1"
FT                   /translation="MRQHTASFGHFVLERMTPFQWRAVAVCVLLTMLDGFDVMAMAFTA
FT                   PHVSADWQLSGKLLGMLFSAGLIGMALGALGLAPLADRIGRRALTLACLAILTIGMGMS
FT                   ALASTAWQLGALRLLTGLGIGGMLACVAVTAGEFSSPRWRNTAIVLQVTGYPVGATLGG
FT                   MIAELLMQQWSWPAVFVLGAVASLLCVPLVLAFLPESLEFLIMRRPPDALARFNAVLAR
FT                   MGLPPHDALPPLPPQSATQPQGYSALFDVAMRRHTLLIALGFFSLMFAFYFVISWTPKL
FT                   LVTAGSSATEGVTGGVLLNLGGICGGLLFSGLASCVRLSRLTVGSLLLMGLAMLASGLC
FT                   STQLSWALAVALLTGAAMFAAVGGMYAIVPIVFNAAVRSTALGWAIGVGRFGAILSPFC
FT                   AGALLDAGWSPAMLYLACSVPLLFAVVAVLGMRLPNR"
FT   gene            417517..418776
FT                   /locus_tag="XAC0350"
FT   CDS_pept        417517..418776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35242"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH5"
FT                   /protein_id="AAM35242.1"
FT                   /translation="MLRTIDSDQLRPGMYVYKLLGAWVHHPFWKTSFLVDSDDVEKIHD
FT                   SRIEQLVIDTARGLDVEAPITSGASAEPGVPPSPAPAPAPAAPEPPEPAATSRSVRTNS
FT                   VTAQVGIEAEVVRARRIFEDGRDMVEAMFRDVRLGRTVDTEAAMPLVEAINDSVLRHPQ
FT                   ALISVARLKTADDYTYLHSMAVAGLMSGLARQLGLPESQVVEAAMGGLLHDMGKAVTPL
FT                   EILNKPGRLTNEEMEVMRKHPLDGHRLLVAGGVQNAVVLEIALHHHEKMDGSGYPNQLV
FT                   GENISLMSRMGAVCDVYDAISSDRPYKRGWDPAESLKQMASWKGHFDPVVFQAFVRRLG
FT                   IYPVGSLVRLESQKLAVVIEQTPDALLKPKVRVFYSAKLRSHVLVQDIDLSRPDCHDRI
FT                   AQMESPAEWGFRDLEKLWLP"
FT   gene            419273..419749
FT                   /locus_tag="XAC0351"
FT   CDS_pept        419273..419749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0351"
FT                   /product="transcriptional regulator MarR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35243"
FT                   /db_xref="GOA:Q8PQH4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH4"
FT                   /protein_id="AAM35243.1"
FT                   /translation="MPVTALATPLPDAVTTVDQARLLRLLGYRITRTELMVRRMFQECV
FT                   AAFDLKPVDFSLLMLVDGNPGINQRQIGDVLHVSPPNLAIVVARLVKRRLLRQVRGRQD
FT                   RRMQHLSLTAAGAALLAAAEAEVLRMEQQLSAVLGSSEAPLLRALDRLDRLDTP"
FT   gene            419917..420909
FT                   /locus_tag="XAC0352"
FT   CDS_pept        419917..420909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35244"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH3"
FT                   /protein_id="AAM35244.1"
FT                   /translation="MRGAGVAAGWRLRALLCLAAGLAAGAAPAQSAPQSAALTNGINTG
FT                   GTSFLDGFTSTTPGLAVVTYLRHNALDAIKDARGNDIPVFDNPRIDSTVLLTQFAYVTP
FT                   YQVFGGSLGITALVPLVNLDASFGRNSIATLRDNGAGVGDVTFGPYLQMPPLIRNGRPV
FT                   FSQRFEFDAVAPIGKYDGNRDLNQSSGYWSLIPSYAFTVLPTPNWEVSARINYIYNFRS
FT                   ERRPNLPPGFDFRNGQAGDAGWINFATSWEVAPKLRLGINAYYLTQFRDNRTNDQRVPD
FT                   SRQRAFYAGPGGVWRFDAKNILFANVYLPVEVRNAASGNNVNFEYVHVF"
FT   gene            420943..421710
FT                   /gene="drb0080"
FT                   /locus_tag="XAC0353"
FT   CDS_pept        420943..421710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drb0080"
FT                   /locus_tag="XAC0353"
FT                   /product="3-alpha-hydroxysteroid dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35245"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH2"
FT                   /protein_id="AAM35245.1"
FT                   /translation="MNLQNKTIVVTGVASGIGAEVARLARFHGAKVIGVDRTPVQMTLH
FT                   GFHQADLGDPASIDALVKALPNQIDALANIAGVPGTAPLDVVARVNYLGLRHLTQGLLP
FT                   RIVSGGSIINVASILGAEWPQRLDLHKQLAATDSFESGSAWLAAHPVAHDTCYQYFKEA
FT                   LIVWTLLQSRPWFADHGVRVNNVSPGPVFTPILGDFAAMLGEERVKADAKRMTRPAYAD
FT                   EVAEGIVFLASDAARWINGITLPIDGGLASTTL"
FT   gene            421742..423223
FT                   /gene="xylC"
FT                   /locus_tag="XAC0354"
FT   CDS_pept        421742..423223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylC"
FT                   /locus_tag="XAC0354"
FT                   /product="benzaldehyde dehydrogenase II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35246"
FT                   /db_xref="GOA:Q8PQH1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH1"
FT                   /protein_id="AAM35246.1"
FT                   /translation="MNALTSATAAATDTPAWHGCIFNGDWVPGRGGSLPIHEPATGALL
FT                   HEVGKADLSDLAAAIAQAKQAQRAWSATPPRERAAVFHRAAQAMQARSAEAALLIARET
FT                   GGILPKAQREVDESVVFYQQAAAMPLQASGQMLPTSAGQLSLARRLPLGVIGVISPFNF
FT                   PLILSLRSVAPALAMGNAVILKPDPRTPYTGGVIIAQVLEQAGLPKGLLHVLHGDAQLG
FT                   QALVESPDVPMIAFTGSTAAGRCIGEIAGRHLKKVSLELGGNNAVIVLDDADLDKAASA
FT                   VAFGAYMHQGQICMATGRVLVHRSVAQALTQQLAEKARHLPVGDPVSGTVALGPIIDQR
FT                   QLQRVVDIVNDSVAAGAVVEAGATHEGLFYAPTVLSNVRPGMRAFDEEVFGPVINITVF
FT                   DTDDEAAELANQGEYGLAAGILSASVSRALALGEKLHTGLLHINDQTVADEVVNPFGGT
FT                   GASGNGTSVGGPADWEQYTHWQWLTIKNEVPQYPF"
FT   gene            complement(423572..424459)
FT                   /gene="pobR"
FT                   /locus_tag="XAC0355"
FT   CDS_pept        complement(423572..424459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobR"
FT                   /locus_tag="XAC0355"
FT                   /product="PobR regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35247"
FT                   /db_xref="GOA:Q8PQH0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQH0"
FT                   /protein_id="AAM35247.1"
FT                   /translation="MATSVPDTAAVPAFGLYGEQHADAAELLHWESIAARSRLHDWQIV
FT                   PHRHEDLAQLVYVQRGPATLQLDGRTQRLRRASVVWLPPLCVHGFAFDPAVRGHVITLC
FT                   MPLVRTALNAAPLLQQVMTAPAVVHAQHARKWLDVLFGSIAQDHARRSIGYDVAAQAAA
FT                   AQLVIWMARTALERARHAAAISPHADPALRHLRAYQDLIDQHYRAHWPISRYADQLGVT
FT                   PGHLNALCQRLAGASALQLLQRRIMLEARRTLRYTSLSVQQIAASLGFFDAAYFSRYFA
FT                   RHAGCSPTRFRVGE"
FT   gene            424556..425740
FT                   /gene="pobA"
FT                   /locus_tag="XAC0356"
FT   CDS_pept        424556..425740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="XAC0356"
FT                   /product="P-hydroxybenzoate hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35248"
FT                   /db_xref="GOA:Q8PQG9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG9"
FT                   /protein_id="AAM35248.1"
FT                   /translation="MRTQVAIIGAGPSGLLLGELLRLAGIDCVIIERQTPQHVLARIRA
FT                   GVLEQGSVELLQRAGVGERLQREGLLHHGFELCLDGQRERIDLLRGCGRGVTVYGQTEV
FT                   TADLMHARQRSGAPTHYNAQDVTLCDVEGATPAVEFTQDGQRKRLHCDYIVGCDGYHGI
FT                   SRASIPAERLRLFERVYPFGWLGVLADTPPVHEELIYARHPRGFALCSMRSPTRTRYYI
FT                   QVPASAQVEAWSDQAFWDELRARLPPALAAQLVTGASIEKSIAPLRSFVAEPMQYGRLF
FT                   LAGDAAHIVPPTGAKGLNLALGDVGLLAQLFERWKASGDAGALEQYSTLALQRVWEAER
FT                   FSWWMTTLLHRFDDEDAFTARLHGAELDYLLGSEAGRATLAENYAGLPLAALSD"
FT   gene            426165..426704
FT                   /locus_tag="XAC0357"
FT   CDS_pept        426165..426704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35249"
FT                   /db_xref="GOA:Q8PQG8"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG8"
FT                   /protein_id="AAM35249.1"
FT                   /translation="MPLSTQEYSMKKLLSRTLLLVMLVAPMAAFAQTAVTANPNHQKML
FT                   LGSTWYETANKRLVYDFWRTVFEAGQVQYAPMYMDKNYIQHNPNVANGRDAFIAFLTAF
FT                   VKPTPVQPRVQLPLVAITADGDLVTLVSVRTLPNPNKPGTTYTTTWFDMFRIEKGLIKE
FT                   HWDPDTIAGRASTGGQ"
FT   gene            complement(426815..428332)
FT                   /gene="glpK"
FT                   /locus_tag="XAC0358"
FT   CDS_pept        complement(426815..428332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="XAC0358"
FT                   /product="glycerol kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35250"
FT                   /db_xref="GOA:Q8PQG7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQG7"
FT                   /protein_id="AAM35250.1"
FT                   /translation="MFEESSMEKQYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIF
FT                   PQPGWVEHNPREIMTSVYTTITELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIY
FT                   NAIVWQSRQTKDICAQLKEAGHEQMVRDKTGLLIDAYFSGTKVKWILDHVEGARERAQK
FT                   GELAFGTIDSWLIWNLTGGKVHVTDYTNASRTMMFNIHTLQWDAELLAMLDVPAQMLPE
FT                   VRSSSEVYGMTQTQYFYGEQVPIAGIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNT
FT                   GDKAVASKAGLLTTIAWGIDGKVEYALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAE
FT                   RAGDNDGVYIVPAFVGLGAPYWRSDIRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLT
FT                   AMQSDSGIELKELRADGGAIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATG
FT                   FWSSREEIAKQWAVDRRFEPAMADDKRQALYAGWQQAVEATMGFRIS"
FT   gene            complement(428455..429276)
FT                   /gene="glpF"
FT                   /locus_tag="XAC0359"
FT   CDS_pept        complement(428455..429276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="XAC0359"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35251"
FT                   /db_xref="GOA:Q8PQG6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG6"
FT                   /protein_id="AAM35251.1"
FT                   /translation="MSRQLVGELISEAVAMFIIIALGDSVAAMYILYDPSPYQNAYWGV
FT                   CIAWGLAVTLAIYVTGSVSGTHANPAVTLALALFRGFSWKKVLPYWVAQVIGAFLGAAI
FT                   VYQLYGPVIDHFNQLHQLTREAGGAAGVFFTAPGLAVTPMHALVDQIIITAFLIFGIFA
FT                   ITEQFNEAAPTANSGALMIGLLVATLGASMGYLEAWAMNPARDFGPRLFAYFAGWGEAA
FT                   LPAKDNYWWIPIVGPLIGGPIGALAYQWLILPFLPARVRHLQGGPKPLDPL"
FT   gene            complement(429451..430956)
FT                   /gene="glpD"
FT                   /locus_tag="XAC0360"
FT   CDS_pept        complement(429451..430956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="XAC0360"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35252"
FT                   /db_xref="GOA:Q8PQG5"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG5"
FT                   /protein_id="AAM35252.1"
FT                   /translation="MYDLLVIGGGINGVGIARDAAGRGLSVCLCEQDDLAAHTSSASTK
FT                   LIHGGLRYLEQYEFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMIRAGLF
FT                   LYDHLGGSKRSLPRSRRLSLRTHPVGAPLQESLRTGFVYSDAWVQDARLVVLNAMDAAR
FT                   RGAKIHTRTRCVGAWRDAGFWYAELEDRQGRRRTVQARALANAAGPWAVSFLDTVASVP
FT                   HEHALRLVKGSHIVVPKLFDHDHAYIFQQPDRRIVFAIPYEHDFTLIGTTDVDYEADPA
FT                   APKIDAAEVQYLCDAVNLYFQQQISPADVVWNYSGVRPLLDDAEDNAAEVTRDYQLEVV
FT                   TEGAPLLNVFGGKLTTYRKLAEEAVDRLTHALGTRKPAWTARGEALPGGEQRDIASLLE
FT                   RVGRARPWLPAATAQRLVRNYGTCAEHLLGDAQSLTDLGTHFGADLYQAEVDYLRQHEW
FT                   AVAADDILWRRSKLGLRIDAAGRQRLEDYLQTQSIRQRDVVSA"
FT   gene            complement(431189..431959)
FT                   /gene="glpR"
FT                   /locus_tag="XAC0361"
FT   CDS_pept        complement(431189..431959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="XAC0361"
FT                   /product="glycerol-3-phosphate regulon repressor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35253"
FT                   /db_xref="GOA:Q8PQG4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG4"
FT                   /protein_id="AAM35253.1"
FT                   /translation="MNPRQEQLVALVRQQGFAEVEGLATRFEVTPQTIRRDLTLLCDAG
FT                   VLRRYHGGVSMPSSVENLAYTARKALQAREKQHIAARVARFIPDDASLFINLGTTNEEV
FT                   ARALLQHRGLRVITNNLNVAVMLSANPSFEVIVAGGVVRGRDQGVTGEATVELIRQFKV
FT                   DFGVIGISGIDLDGTLLDFDYQEVRVAQAIIEHSRHVLLAADHSKFGRNAMVRLGAIAQ
FT                   VHDWFTDRPPPQELASVLAEAGTRVHLADADGTD"
FT   gene            complement(432510..433493)
FT                   /gene="pobB"
FT                   /locus_tag="XAC0362"
FT   CDS_pept        complement(432510..433493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobB"
FT                   /locus_tag="XAC0362"
FT                   /product="phenoxybenzoate dioxygenase beta subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35254"
FT                   /db_xref="GOA:Q8PQG3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG3"
FT                   /protein_id="AAM35254.1"
FT                   /translation="MRKDTQWHRARVVSIADACPGVREIVLDPGSAARGFEVGSHVDFR
FT                   VQLHGRDDMRSYSLVGEPRADGYYQIAVRQMPDSRGGSLHMWTLAPGDVVEMSPPSNNF
FT                   ALDESGEEILLIAGGIGITPIIGMAQRLARRHRAFRLLYAGRSRSAMAYVDTLEALLGE
FT                   RLQLQCDDSAGPPDLAAELARLSPNAEVYVCGPLGMLETVRQHWHAAGRPRARLHFETF
FT                   GNSGRVPAQAFVVKLPGLGLEVPVAENESMLDALADAGVELIAECRRGECGLCAVEVLD
FT                   SSADIDHRDVFLSDEQRRENRKLCACVSRAVGGSISIDTGYRSELG"
FT   gene            complement(433594..434670)
FT                   /gene="vanA"
FT                   /locus_tag="XAC0363"
FT   CDS_pept        complement(433594..434670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="XAC0363"
FT                   /product="vanillate O-demethylase oxygenase subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35255"
FT                   /db_xref="GOA:Q8PQG2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG2"
FT                   /protein_id="AAM35255.1"
FT                   /translation="MSQSKPLFPLNAWYAVAWDHEIKHVLSPRKLCNLDVVVYRTTSGA
FT                   VVALEDACWHRLVPLSMGKLRGDDVVCGYHGLVYNTQGRCVHMPSQDTINPSACVRSFP
FT                   VAEKHRYVWIWPGDPAKADTRLIPDLHWSHDPAWAGDGRTIHAKCDYRLVLDNLMDLTH
FT                   ETFVHGSSIGQDEVAEAPFDVVHGDRSVVVSRWMRNIDPPPFWASQIARHLDYRGKVDR
FT                   WQIIRFEAPSTIAIDVGVAITGTGAPEGDRSQGVNGYVLNTITPETDTTCHYFWAFMRN
FT                   YALHDQSLTTLTRAGVTGVFGEDEAVLEAQQRAIDAHPDHTFYNLNVDAGGMWARRVID
FT                   RLIAQEQRAQDLSLRMVG"
FT   gene            434923..435786
FT                   /gene="gctA"
FT                   /locus_tag="XAC0364"
FT   CDS_pept        434923..435786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gctA"
FT                   /locus_tag="XAC0364"
FT                   /product="glutaconate CoA transferase subunit A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35256"
FT                   /db_xref="GOA:Q8PQG1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG1"
FT                   /protein_id="AAM35256.1"
FT                   /translation="MAEIVALADAVSQLIADGDCVAMEGFTHLIPHAAGHEVIRQRKRA
FT                   LRLVRMTPDLIYDQLIGAGCAAALRFSWGGNPGVGSLHRLRDAVEHAWPQPLQIREHSH
FT                   ADMANAYVAGASGLPFAVLRGYVGSDLPRVNDSIKFLQCPYTGQTLATTPAVNPDVTVI
FT                   HAQRADRRGNVLLWGILGVQKEAALAARKVIVTVEEIVDSLDAPPNACILPRWVVDAVC
FT                   VVPGGAAPSYAHGYYARDNRFYLAWDAIARDRARFDAWIQAHILDTDDFAGFQRVYAQS
FT                   QQQVAA"
FT   gene            435783..436571
FT                   /gene="gctB"
FT                   /locus_tag="XAC0365"
FT   CDS_pept        435783..436571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gctB"
FT                   /locus_tag="XAC0365"
FT                   /product="glutaconate CoA transferase subunit B"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35257"
FT                   /db_xref="GOA:Q8PQG0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQG0"
FT                   /protein_id="AAM35257.1"
FT                   /translation="MSAYSTNEMMTVAAARRLPDGAVCFVGIGLPSTAANLARLTHAPD
FT                   VTLIYESGPIGARPQVLPLSIGDGELAETADTVVSTPEIFRYWLQGGRVDVGFLGAAQI
FT                   DRHANLNTTVIGSYDAPKTRLPGAGGAPEIAASARQVFIIMRQSERSFVSRLDFITTVG
FT                   HLDGGDARARAGLPGAGPTVVVTDLCVMEPDPVTRELTVTSLHPGTTREQVSAATGWPI
FT                   RFAADLAHTTPPRAAELDALRALQARTDAAHGAQATGAQA"
FT   gene            436568..437776
FT                   /gene="pcaF"
FT                   /locus_tag="XAC0366"
FT   CDS_pept        436568..437776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="XAC0366"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35258"
FT                   /db_xref="GOA:Q8PQF9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF9"
FT                   /protein_id="AAM35258.1"
FT                   /translation="MNEVYLIDGIRTPIGRYAGALSSVRADDLGAVPIAALLARQSQLE
FT                   PAAIDDVCLGCANQAGEDNRNVARMSLLLAGLPPSVPGSTLNRLCGSGLDAIGTVARGI
FT                   RAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQLEDTTMGWRFINPRLQAVYGTELM
FT                   GETAENVAQRYAIAREDQDAFALRSQQRVAAAQAAGFFDAEIAPVAVAGRKGGDASTVE
FT                   HDEAPRPNTTAEMLAKLKPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQTHRLTPRA
FT                   RVLGFASAGVEPAYMGIGPVPAAQRLMARLHLRIAQFDAIELNEAFAAQALACTRAFGL
FT                   ADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEAGNGRFGLASMCIGVGQGVALAI
FT                   ERL"
FT   gene            437856..438590
FT                   /gene="pcaH"
FT                   /locus_tag="XAC0367"
FT   CDS_pept        437856..438590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="XAC0367"
FT                   /product="protocatechuate 3,4-dioxygenase beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35259"
FT                   /db_xref="GOA:Q8PQF8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF8"
FT                   /protein_id="AAM35259.1"
FT                   /translation="MRDPTTDRPAIADPLLGYRRSPPGTQPAYLHPAYASTTLRGPTRD
FT                   PIDLPVTLSEVTGPRLDRLTLGAHAADLTAGFGGAPLGERIIVSGRVLDENGRPVRNSV
FT                   VEVWQCNAAGRYQHAGDQHDAPLDPNFRGTGQVLTDERGRYSFKTIKPGAYPWRNHYNA
FT                   WRPAHIHFSLHGDGIGQRLVTQMYFPGDPLLAHDPIFNCVDDALARERMVSSFDWENAV
FT                   SEYALAYRFDIVLRGRKQTVWE"
FT   gene            438595..439158
FT                   /gene="pcaG"
FT                   /locus_tag="XAC0368"
FT   CDS_pept        438595..439158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="XAC0368"
FT                   /product="protocatechuate 3,4-dioxygenase alpha chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35260"
FT                   /db_xref="GOA:Q8PQF7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF7"
FT                   /protein_id="AAM35260.1"
FT                   /translation="MSLHATPSQTVGPYYRLGLEPLYRQQIAPAHAAGTHVQISGRIVD
FT                   GAGAPVADAVLEVWQADAGGIYAHAADGRCEAHDPSFDGWGRVPTDARGRFSFSTIKPG
FT                   RVAGPDGKQQAAHLTVLVFMRGLLRGVSTRLYFADDPQLGSDPILALVPAERRATLLAQ
FT                   PHPGGAYTWDIHMQGDAETVFFRY"
FT   gene            439511..440863
FT                   /gene="pcaB"
FT                   /locus_tag="XAC0369"
FT   CDS_pept        439511..440863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="XAC0369"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35261"
FT                   /db_xref="GOA:Q8PQF6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF6"
FT                   /protein_id="AAM35261.1"
FT                   /translation="MSATSSLLGSLFGEPACDALFDDAARLQAMLQFESALARAQAQCG
FT                   VIPAQAAQAIAAACDVQHYDRAALAQATALAGNPAIPLVKALTAQVAAHDNAAARWVHW
FT                   GATSQDVIDTGTVLQLRAALDLLLPRLHALCADLAVLAERERNTGLPGRTLLQQAVPVT
FT                   FGLKVAGWLDALQRAQQRLHALRRDALVLQFGGAAGTLASLQERGLEVAQALASTLELP
FT                   LPALPWHTARDRIVEVGCAFGLLAATLGKIGGDVALLMQSEVGEAFEPAAAGKGGSSAM
FT                   PHKRNPVSSVAAVAAATRVPGLVATLFSAMAQPHERAAGQWHAEWDTLPQIVCLTAGSL
FT                   AQMQLCLSGLELDRTRMQAHLDSHGGLLYAEAAVFALASHLGKPQAHALVEQAALRAQA
FT                   QQRHLREVLGEDAQVSAVLTHAQLQAVFDSASWHGMSSVWIDRVLAGSSSR"
FT   gene            440874..441656
FT                   /gene="catD"
FT                   /locus_tag="XAC0370"
FT   CDS_pept        440874..441656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catD"
FT                   /locus_tag="XAC0370"
FT                   /product="b-ketoadipate enol-lactone hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35262"
FT                   /db_xref="GOA:Q8PQF5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF5"
FT                   /protein_id="AAM35262.1"
FT                   /translation="MAYLQLPTHRLHYRLDGTEGRPWLTFCNSLGTDLHMWDVQLEAFA
FT                   PHYRILRYDRRGHGYSETPPGPYSVADLGQDVLTLWDALEIAQSDFCGLSIGGLTGQWL
FT                   GLQAPQRLRRLVVCATAQKIGSAATWETRIEQVRSEGLPTLIDATLQRWFTPEFATSHA
FT                   QRLDMIAAAFVSTSPAGYIACCQAVADADFRGALDGLSLPLLALAGDDDPVCPPPDLRE
FT                   IAYAAPDGHYAQVPGRHICNLESPAAFNHAVLGFLQGQ"
FT   gene            441683..442096
FT                   /gene="pcaC"
FT                   /locus_tag="XAC0371"
FT   CDS_pept        441683..442096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="XAC0371"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35263"
FT                   /db_xref="GOA:Q8PQF4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF4"
FT                   /protein_id="AAM35263.1"
FT                   /translation="MHEDERYQAGMRERRRVLGDAHVDRALAARSDFTEEFQDLITRYA
FT                   WGGIWTRDGLPAHTRSLITLSMMIALGHDEEFKLHVRAARNNGVTPAQIKEVLLQAAIY
FT                   CGVPAANHAFALARPILEEQAADAGTASTAQPG"
FT   gene            442350..443192
FT                   /locus_tag="XAC0372"
FT   CDS_pept        442350..443192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0372"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35264"
FT                   /db_xref="GOA:Q8PQF3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF3"
FT                   /protein_id="AAM35264.1"
FT                   /translation="MLSQVRTDDGRTLAVWSRVPVQPRGTIVLVHGRTWSALPNFDLQV
FT                   PGEPRDARSVLAALAQAGFAAYAVDLRGYGGSPRDRTGWNTPARAVADVRNVLAWVAQT
FT                   HPGLPPPALLGYSNGARVALLLAQQQPQEISALVLFGFPDDVDTPPASAVPADRPLRTP
FT                   TTAAAAGEDFITANAAPPVVRAAYVAQALAADPVRTDWRAMEQFAFHPEQVATLPVLLL
FT                   RGVDDPIATQADNAHLYARLRSEDRSWVTLPHADHVAQVEDSHAAWVDAVVSFLRRPR"
FT   gene            complement(443452..444342)
FT                   /gene="pcaR"
FT                   /locus_tag="XAC0373"
FT   CDS_pept        complement(443452..444342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="XAC0373"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35265"
FT                   /db_xref="GOA:Q8PQF2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF2"
FT                   /protein_id="AAM35265.1"
FT                   /translation="MHGPVRCRIPMPEPASSRRKRPAAVVAAGSDRGLPHELMQQIAAA
FT                   QGDPDFMTSLGRGLVVLSVFAQHAREVTMSQISLETGISRAAVRRVLHTLAKLGYVGEQ
FT                   GRGYVLLPRVLGIGGAYAASSSMTAAAQPVLDGLRDQLHESCSLGVLDGDDLLYVARSE
FT                   TVRIMSIGLRPGTRLPAYCTSMGRVLLAALPGDTLQAYLERTTLRPRTDRTVTQASALL
FT                   EVLARTRREGMCLTDQELEIGLRSIAVPVRNLRGEVIAALNIGAQAGRVSLQTMQTQLL
FT                   EPLKQAAQRLGTLLS"
FT   gene            444461..445321
FT                   /locus_tag="XAC0374"
FT   CDS_pept        444461..445321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35266"
FT                   /db_xref="GOA:Q8PQF1"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF1"
FT                   /protein_id="AAM35266.1"
FT                   /translation="MKTPNGLQPLIDDGVIDEVLRPLKSGKEASVYVVSAGAEILCAKV
FT                   YKDMAQRSFQARVQYQEGRKVRGSRQARAMGKATKFGRKEAEAAWKNTEADALYQLVDA
FT                   GVHVPKPRGYFHGVLLMDLVTDDAGHSAPRLGEVELEPDQARAFHASLIGDVVKMLSLG
FT                   LVHGDLSEYNVLVSPDGPVVIDFPQVVSAAGNNAARDMLLRDVHNLRDCLGRFAPELLD
FT                   THYGEEMWALFEKGELRPDSALTGRFKFDTRRADVRAVRASIEDARQENLIRQQGREAA
FT                   AEDND"
FT   gene            445592..446560
FT                   /locus_tag="XAC0375"
FT   CDS_pept        445592..446560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0375"
FT                   /product="lipase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35267"
FT                   /db_xref="GOA:Q8PQF0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQF0"
FT                   /protein_id="AAM35267.1"
FT                   /translation="MSFDPDVVRLFAQLQEAAQPPMDTLPIEGARAMMRAVGAQFGFQR
FT                   LEMAEVRDLQADAATGAVPLRVYRPTGLATGPAPTCLYVHGGGGLVGDLESHDDVCRQL
FT                   AARAGCQVLAIHYRLAPEHPAPAGVEDVIATLHWLVAHPDTVGADVQRLAVCGDSIGGA
FT                   MAAVAALAARDAGIALRCQLLVYPLTDARQDSGLYPSRSLNAGLPPLTAAAVEFFNRHL
FT                   LPDMAVANDWRVSPMLAPDVAGVAPALVVVCDRDMLYDEGRAYAERLRAAGVEVTLHSF
FT                   PGMIHGFINMGSVLRAAGETLDLAALTLRQRLLPAIERRAA"
FT   gene            complement(446861..447541)
FT                   /locus_tag="XAC0376"
FT   CDS_pept        complement(446861..447541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35268"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE9"
FT                   /protein_id="AAM35268.1"
FT                   /translation="MFRSVCALLLSTVACSWPAHAKTEEDGRYWLSVYAQGKLPVENLY
FT                   WSMDVHPRWREEGEQFDQLILRPAVFYRLNPKASVWMGYDTIISHPAGQPSNRENRWWG
FT                   QFQYQFDPIADITITSRTRLEQRHREGFNDEGYRVRQMIRAVRPSGFSPQLSWVAFNEV
FT                   FVNLDQTRWGAQRGLDQNRVFVGINWKFNAIANADVGYLNQFVNTRAVDRENHVLMTTF
FT                   RFNF"
FT   gene            complement(447779..449683)
FT                   /gene="gidA"
FT                   /locus_tag="XAC0377"
FT   CDS_pept        complement(447779..449683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="XAC0377"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35269"
FT                   /db_xref="GOA:Q8PQE8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQE8"
FT                   /protein_id="AAM35269.1"
FT                   /translation="MSDSFYRYDVIVIGGGHAGTEAALASARAGARTLLLTHNIETVGA
FT                   MSCNPAIGGIGKGHLVKEIDALGGAMARAADLAGIQWRTLNASKGPAVRATRCQADRNL
FT                   YRTAIRCIVEAQPNLTVFQAAVDDLIIHHGASEADSVRGVITQTGLRFQAPSVVLTAGT
FT                   FLAGKIHVGQTQYAAGRMGDPPATTLAARLRERPFAIDRLKTGTPPRIDGRTLDYGVMA
FT                   EQPGDDPLPVMSFMGQVSDHPRQVSCWITQTTEQTHEIIRNALHRSPLYSGQIEGIGPR
FT                   YCPSIEDKVVRFAEKTSHQIFVEPEGLEVAEIYPNGISTSLPFDVQLALVRSIHGFANA
FT                   HITRPGYAIEYDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAAR
FT                   HVQGLPAWSPRRDEAYLGVLVDDLITHGTTEPYRMFTSRAEYRLQLREDNADARLTGVG
FT                   RAMGLVDDARWARFAAKQEAVQRETARLSALWATPGNALGREVADALGVTVSRETNVLD
FT                   LIKRPELTYATLMRVPTLGPGVDDAQVAEQVEISVKYAGYLDRQRDDIARQQRHETTPI
FT                   PDGFDYASVRGLSIEVQQKLERVRPQHIGQAQRIPGMTPAAISLLLVHLERARRSQVA"
FT   gene            complement(450255..450725)
FT                   /locus_tag="XAC0378"
FT   CDS_pept        complement(450255..450725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE7"
FT                   /protein_id="AAM35270.1"
FT                   /translation="MKFRLIFAAGLLALGGCATYDYTGGGSGGYYRGAPAVQYRYPPGY
FT                   SPYFYGNPYGLPYGYGAGSIGLYDYPVYPVYRGGGYYYRQYDRRPQYRPPRPNGSFNNG
FT                   PRPGGSRPQQPNRPPATGAPPSRPPPRIGAPPRVIREIQRQTAPRTTREQIP"
FT   gene            450882..451841
FT                   /gene="ilvA"
FT                   /locus_tag="XAC0379"
FT   CDS_pept        450882..451841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="XAC0379"
FT                   /product="threonine dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35271"
FT                   /db_xref="GOA:Q8PQE6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE6"
FT                   /protein_id="AAM35271.1"
FT                   /translation="MIETVPLAHSDVLQAAARIAPHCAPTPLLTSHSLDALSSAQLFFK
FT                   AEHLQRSGAFKFRGACNAVWSLPDALAARGVVTHSSGNHGAALALAARTRGIGCHVVVP
FT                   EGAVAAKLANISRNGATLWRCAPTIAAREQMCAEVQAGSGATLVHPYTDRAVIAGQGTA
FT                   TLELLHQSGVLDVLVAPVGGGGLAAGAALALQASPDCELVLAEPAGAADTARSLAAGQR
FT                   LVDFVPDTICDGLRGTLGAPNFAVLQRAGAQVITVDDAAVVQAMRLVWQLLKQVVEPSS
FT                   AIALAAVLAQPARFAGRRVGLILSGGNVDLDALPWVAA"
FT   gene            451838..452443
FT                   /locus_tag="XAC0380"
FT   CDS_pept        451838..452443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35272"
FT                   /db_xref="GOA:Q8PQE5"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE5"
FT                   /protein_id="AAM35272.1"
FT                   /translation="MSRRSRGLGLWGWGWRLCMLALIWLVAVAGWIVWIGDRDQAAPAD
FT                   VIIVLGAAAYDARPSPVFEERIRHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYA
FT                   LRHGIPPDAIVIETTSRTTRQNLEQARTLMERHGLHRAIIVSDPLHMARALRLSQELGI
FT                   DALASSTPSTRFRSFHTSWRFLLQEVYYFHRDLVVQGS"
FT   gene            452486..452905
FT                   /locus_tag="XAC0381"
FT   CDS_pept        452486..452905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35273"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE4"
FT                   /protein_id="AAM35273.1"
FT                   /translation="MSETHRQHAIGLVQAYYAAFNRGDWDGMLAFLAEDVAHDLNQGPR
FT                   EIGRNEFAAFLQRMNDSYREQLRDVVVIANDDGTRVGAEYVVHGVYHTTDEGLPEATGQ
FT                   TYVLVGGAFFDVRGDKITRVTNYYNLQEWIAQVSR"
FT   gene            complement(453120..454025)
FT                   /gene="aspH"
FT                   /locus_tag="XAC0382"
FT   CDS_pept        complement(453120..454025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspH"
FT                   /locus_tag="XAC0382"
FT                   /product="aspartyl-asparaginyl beta-hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35274"
FT                   /db_xref="GOA:Q8PQE3"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE3"
FT                   /protein_id="AAM35274.1"
FT                   /translation="MLKWLLIALFIASALYIHYRGRVRHRLSRQLLDHSTFMAPINTLM
FT                   YLCSRVPTTPFIDPGKEFPELAPLRASWPLIRDEAVALQQMQKIRAAEGYTDIGFNSFF
FT                   RRGWKRFYLKWYGTAHPSAAELCPQTTALLKSIPTVKAAMFAELPPGSELRPHRDPFAG
FT                   SMRLHLGLATPNDDRCFIDVDGQRHSWRDGEWTMFDETYIHYARNDTDQDRIILFCDIE
FT                   RPMRWRWAAAVNRFVGRSLLSAGASPNQEGDKTGGINRVFRYFYAARLKAKALKERNNP
FT                   LYQVLKWGIFILVVVGIVLL"
FT   gene            complement(454275..455159)
FT                   /gene="bioC"
FT                   /locus_tag="XAC0383"
FT   CDS_pept        complement(454275..455159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="XAC0383"
FT                   /product="biotin synthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35275"
FT                   /db_xref="GOA:Q8PQE2"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE2"
FT                   /protein_id="AAM35275.1"
FT                   /translation="MTSTFDPRHVRRAFARAASTYTAAAALQREAETRLLESLDYLGEQ
FT                   VPKVALDVGAGPGHASAAIKKRWPKAQVIALDQAMPMLRQARKAAGWWKPFTQVCADAR
FT                   ALPVADGSVDVIFSNLCLQWVEDLPTVFAGFRRALRPGGLLLCSTFGPETLIELRDAFA
FT                   QSDPAPHVSRFPPIAQFGDALLMSGFRDPVLDRDLFTLTYNDLPALMRELRAMGATNAL
FT                   SNRRATLTGRGRFVAASAAYEPLRRPDGTLPSSWEVIYAHAWAPAPGAPIREHGHEVAS
FT                   VPVSAIPIRRRID"
FT   gene            complement(455227..456009)
FT                   /locus_tag="XAC0384"
FT   CDS_pept        complement(455227..456009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0384"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35276"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQE1"
FT                   /protein_id="AAM35276.1"
FT                   /translation="MDLGIAGRWALVCAASKGLGLGCARALAGEGGNVVIAARGREALE
FT                   HAADALRALPGSGEVRCVVADIATPEGRSAALAACPQVDILINNAGGPPPGDFRQWERA
FT                   DWLRALDANMLAPIELIRATVDGMRARRFGRIVNITSSAVKAPIDILGLSNGARAGLTG
FT                   FVAGLARSTVADNVTINNLLPGQFATDRLRGNFAAIAQQQGSSADEVAERKRAGIPAAR
FT                   FGEPDEFGAACAFLCSAQAGYITGQNLLIDGGSYPGTF"
FT   gene            complement(456054..456815)
FT                   /gene="bioH"
FT                   /locus_tag="XAC0385"
FT   CDS_pept        complement(456054..456815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="XAC0385"
FT                   /product="biotin biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35277"
FT                   /db_xref="GOA:Q8PQE0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQE0"
FT                   /protein_id="AAM35277.1"
FT                   /translation="MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPG
FT                   HGFSRDDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMIAATP
FT                   RFVRGSDWPSAVQREVFVQFGVELSRDYRGTLERFLALDTLGSAHARSELRSLRETLTA
FT                   RGEPAPEALQQGLTLLERTDLRRTVPQLARPSLWIAGQRDRLVPAAGMHAAAALSPHAQ
FT                   ALTIAGGGHAPFLGHADQVSEALQRFVASVP"
FT   gene            complement(456916..457245)
FT                   /locus_tag="XAC0386"
FT   CDS_pept        complement(456916..457245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35278"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD9"
FT                   /protein_id="AAM35278.1"
FT                   /translation="MWEALSRLYLDSDSCDDDGIARVLAASPFALEQLRTMLLYEVHPV
FT                   LIGNLRSVAGVWDGFDPDWLAAAIQARRARRRHWPARWRWCGHARAQWALLAPRILALR
FT                   AAATH"
FT   gene            complement(457482..458687)
FT                   /gene="bioF"
FT                   /locus_tag="XAC0387"
FT   CDS_pept        complement(457482..458687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="XAC0387"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35279"
FT                   /db_xref="GOA:Q8PQD8"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQD8"
FT                   /protein_id="AAM35279.1"
FT                   /translation="MARPDLHERISSLRKLRVAQERVRVRRQVGRRDGVRLEIDGRWLT
FT                   GFCSNDYLGLSQQFEVVAALQDAAARDGAGATASHLICGHHTAHETLEREIAEWLGYPS
FT                   ALLFGSGFIANLAVQQALLSEEDDVCVQDRLNHASLLDATRLAGCRLRRYPHLDVEGAM
FT                   RQLKGAPEGAAMLATDGVFSMDGDVAPLRALSLVARMQQALFYVDDAHGVGVLGPQGRG
FT                   CVADAGLGVAEVPLQLVTLGKALGGYGAVVVGEEALVRHLAETARPYIYTTALPPAQVA
FT                   ATLAAVRLARRDDWRRARLVELIGAFRDGARKHGFELMASDTPIQPLLCGEEATVMAMS
FT                   AALEHAGFMVGAIRPPTVPEGKARLRVTLSALHTQQQVQALIEAIVQARDVVSRQPLRA
FT                   SA"
FT   gene            complement(458779..459813)
FT                   /gene="bioB"
FT                   /locus_tag="XAC0388"
FT   CDS_pept        complement(458779..459813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="XAC0388"
FT                   /product="biotin synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35280"
FT                   /db_xref="GOA:Q8PQD7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQD7"
FT                   /protein_id="AAM35280.1"
FT                   /translation="MSVVLRHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVS
FT                   TLLSVKTGGCPEDCAYCPQAQRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAW
FT                   RSPKERDIPKVAAMIREVKAMGLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYY
FT                   DSIIHTRQYQDRLNTLEHVRDVGLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVP
FT                   INQLVQVPGTPLHGTQQLDPFEFVRMIAVARIAMPKSMVRLSAGRETMSDELQALCFLA
FT                   GANSIFYGEKLLTTGNPDTERDQALFQRLGLRPMQVTVDAAEHDHPGTVHAEITRSAAC
FT                   EHAA"
FT   gene            459857..460588
FT                   /gene="comF"
FT                   /locus_tag="XAC0389"
FT   CDS_pept        459857..460588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="XAC0389"
FT                   /product="competence protein F"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35281"
FT                   /db_xref="GOA:Q8PQD6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD6"
FT                   /protein_id="AAM35281.1"
FT                   /translation="MSMQETVNFNQVRSVYRWPQRVLRLLLPSLCLVCAEAGTPDGDLC
FT                   PACRAALPDHGHACLCCATQLFASDAVVLCGQCLQHPPALQRVHACFTYRWPVDGLLRR
FT                   FKFHQDLAAGRLLSELMARRCVGLPRPQALVPVSLHRQRLRQRGYDQALELARPLGRAL
FT                   QLPCQPLLRRVRATAPQSELDAAERQRNLRDAFEVRGALPAHVALVDDVMTTGATLHAA
FT                   AKALRKAGVQRVDAWVCARVP"
FT   gene            complement(460839..461744)
FT                   /gene="ubiA"
FT                   /locus_tag="XAC0390"
FT   CDS_pept        complement(460839..461744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="XAC0390"
FT                   /product="hydroxybenzoate octaprenyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35282"
FT                   /db_xref="GOA:Q8PQD5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQD5"
FT                   /protein_id="AAM35282.1"
FT                   /translation="MSKHGVEQLPAARALTWPQRLGQYWKLVRGDRPIGSLLLLWPTWW
FT                   ALWLAADGLPPLWTLFVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSG
FT                   REALWVFVALMLVAFALVLTLNWLTVMLSVPGVFLAASYPYLKRHTHLPQVYLGMAFGW
FT                   GIPMAFAAVQGSVPLLGWLLYAANILWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFD
FT                   LIAQGILYALMAATLVMVGLRADLGAAYWAGLGAAALLVAYEFRIARHRERGPCFRAFL
FT                   HNNWVGLAIFVGIAVAVAGR"
FT   gene            complement(461935..462432)
FT                   /locus_tag="XAC0392"
FT   CDS_pept        complement(461935..462432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0392"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35283"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD4"
FT                   /protein_id="AAM35283.1"
FT                   /translation="MLPSVARPVRMPMDPDRPFDVQTTKSPRSLEGFCSSQDTPGTEFG
FT                   APGGIRTPDQWLRKPLLYPAELRAPGRTLCQNSRHARDGAGRRRTWASHGVTGDVMTPA
FT                   SRPGQSVGRNPMPRFERTGPRPCNGVAVSSGSLQNASPLNVTSLTVRLSTHPSAVTAEL
FT                   AL"
FT   gene            462225..462301
FT                   /locus_tag="XAC0391"
FT   tRNA            462225..462301
FT                   /locus_tag="XAC0391"
FT                   /product="tRNA-Arg"
FT                   /note="Found by tRNAscan"
FT   gene            complement(462712..464652)
FT                   /gene="hpaF"
FT                   /locus_tag="XAC0393"
FT   CDS_pept        complement(462712..464652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaF"
FT                   /locus_tag="XAC0393"
FT                   /product="HpaF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35284"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD3"
FT                   /protein_id="AAM35284.1"
FT                   /translation="MFNINRLLRSRPRTDTADQAPAEDRPSHQPSAAEGLLSPLLARPR
FT                   RRESAAAPRNAGQRSPFRSPLRASGQPAALAGASSAPPRSIEHDIDDWLAQSLPMAERV
FT                   RTGYNLHDGQRDTSREVLQSVADAIRRAATRHSTELVLDYGLPATTLPDAIGRLDALQK
FT                   LTLLHTGLQSLPDSLGQLHQLRHLQIAGALGLKTLPPSLTRLSNLRTLQLTMIPLDELP
FT                   VGIGRMQGLRSLTLGGGHYARLPASIVELSGLTELRMPHSSHFRELPENIGLMQGLRSL
FT                   EVASNSELEQLPGSLTQLHRLEKLTLSSNRRLAHLPEDIGQLRGLTELSLKNCAALRQL
FT                   PDSVGDLAQLQLLDLRGTGLQTLPQSLARLPAQCDIKVPDHLAGQLLQIRDPERAAREP
FT                   QRAAQRLAERRRRAPVPAAQQAGASWNRMPEFARVLRTVDADLGERFDKWTQGLAQTAR
FT                   ISGASITPADMPLLDQVVTEAIRSPEFRSSFGQFLSDHTLKTLNMDGMTQVGGFGPAVR
FT                   GDVKTAFAEMLKHKLMHTQDHQTALGLLQDALQNPDLGLSREMLLRSRNELTGRVEMWP
FT                   PLKAYISMHDVEGQAAQDAAITWTMAQFEEAQQGGIGDAEAKQESERAQANANRFIEQR
FT                   ARVLLREWDIR"
FT   gene            complement(465213..467687)
FT                   /gene="hrpF"
FT                   /locus_tag="XAC0394"
FT   CDS_pept        complement(465213..467687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpF"
FT                   /locus_tag="XAC0394"
FT                   /product="HrpF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35285"
FT                   /db_xref="GOA:Q8PQD2"
FT                   /db_xref="InterPro:IPR008718"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD2"
FT                   /protein_id="AAM35285.1"
FT                   /translation="MGAPVRPYKRKLIRRCFCQFCHCEAAHMSLNTLSTGSNPSQLLGT
FT                   PLNESDSSELLGSDSSKDDSDLPSTMDDIFLLIYQLLAALQTNAPTSTSGNGSADAPTS
FT                   APSGDASTPSSASDDQANQPIEKRTSWPSLGYDFDPKDIKGKDAPPALEGSTVTWNGGT
FT                   LTPSELQIVSTLNAHKDQMPLEYKNLDDKINDPSTPADLKAALQGLKQDPRLFFAIGSQ
FT                   GDGKCGGKIKAQDLWDFSDSHPQVKAMGGKNDQFNPKDIKGSTPPPAVDGSSVTWDGGT
FT                   LTQNELEIVSTLNRHKDQCPLKWSDLDAKINDPSTPPDLKKALTDLQSDPRLFFAIGSQ
FT                   GDGKCGGKIKDGDLGKFVSHHAQVAEYADKQAKNYTQNYVASDSPDKTKASVMNESDAM
FT                   RELYRYSDYLPDDLNQDTFKSLVDGESSTKKCPPQVIAAAQYFRDHPDQWKALAGDSGS
FT                   MSKPDFLQKASSEIHLTADEQKTLDTINSHQDAFYGDGKEVTRDKLDSISKDDKADPAV
FT                   KEAATQLLNDPLLFGLLNNSITGYKKPHRFFGGGHVVDSGKISQDDFRRFYDNMSAANK
FT                   TVDKPVTHDASSAEQQKAVSDMLMGKDDPPAIKKPKKDVGVFQEGLHEFLKWDSKILDW
FT                   MSVGLSALNGIPIIGEITDAASIALESEAQAAQVVDTAIQGGDMSLALKLAGINMAGAV
FT                   VGAVGGPTARIGAKAVAKGVAEAAAKGTAKGVAKGAGRTAAERPSAAEFAKGYVGGTAI
FT                   SKSVEILKTPVLAGLHYEEYRLDKQKEGEIHQKMENAGGIPMGKQIVPTNVANNFEGDL
FT                   RQNLRNIRVRRR"
FT   gene            complement(469018..469818)
FT                   /locus_tag="XAC0395"
FT   CDS_pept        complement(469018..469818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0395"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35286"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD1"
FT                   /protein_id="AAM35286.1"
FT                   /translation="MVRQLSPAPVLDLCSASRRGDLAGQRHGDLAGEFSVQFEFRSGID
FT                   ADRSDCATGSQSQRLPPCTDLPVTLLGGRGDGMPSLRVAVHLAAATTRLQTRWRIRPWR
FT                   RCARRTRINALAERSCSPSFPPTQFLAFLQRTLERFQPLIQRLGERVAWQCARRLPPMV
FT                   TQRGAYGLDGRNREGLRADLHAQCLQGRTQCPTARPRQAQQASPPPWHASGQVSVRKAR
FT                   RSSGRWALPEPQASVRWCVDARLQARHARYPVASPERYWHRSWL"
FT   gene            complement(470065..470535)
FT                   /gene="hpaB"
FT                   /locus_tag="XAC0396"
FT   CDS_pept        complement(470065..470535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaB"
FT                   /locus_tag="XAC0396"
FT                   /product="HpaB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35287"
FT                   /db_xref="GOA:Q8PQD0"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQD0"
FT                   /protein_id="AAM35287.1"
FT                   /translation="MSSARFETIVRQMCEALDLPDVQSVLSRRVLWVEGFEVYLHEPTP
FT                   QPDDEVQEQALYLRISYGLPPAGRTLTVYRLLLEANLSVYAQDQAQLGLNDAGVIVLIV
FT                   RVPLDDDVDGAWICDLLAHYAEHGRYWNNNIFVAHDEMFEGIATGNYLWLRA"
FT   gene            complement(470590..470871)
FT                   /gene="hrpE"
FT                   /locus_tag="XAC0397"
FT   CDS_pept        complement(470590..470871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpE"
FT                   /locus_tag="XAC0397"
FT                   /product="HrpE protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC9"
FT                   /protein_id="AAM35288.1"
FT                   /translation="MELLPQISSIKSRFDQGTDAYTGGVSGGISGEAALTGANGQMSSL
FT                   ISDMNASDEAQKSMNNKITQLKNDLDFNVALNKFIGKAGDNAKQLVGQ"
FT   gene            complement(470950..471192)
FT                   /gene="hrpD6"
FT                   /locus_tag="XAC0398"
FT   CDS_pept        complement(470950..471192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpD6"
FT                   /locus_tag="XAC0398"
FT                   /product="HrpD6 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35289"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC8"
FT                   /protein_id="AAM35289.1"
FT                   /translation="MFDAMTDTVTQDMSKILQTKAADPSGERLRNLEAALDATAQQIRV
FT                   RWSAASDQTSRNDFNAVHDGITAARNIVAHIAGMS"
FT   gene            complement(471202..472140)
FT                   /gene="hrpD5"
FT                   /locus_tag="XAC0399"
FT   CDS_pept        complement(471202..472140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpD5"
FT                   /locus_tag="XAC0399"
FT                   /product="HrpD5 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC7"
FT                   /protein_id="AAM35290.1"
FT                   /translation="MTMQLRVLTGTHAGARLDLAQGRYTLGSDPQTDIRIDDWPGCSLI
FT                   IEVDQDGQIRYSSDTVPETSFVAFQPVRFGPLVLCIGDAGADWPDDVALLEQLLSPAPT
FT                   PAPRTSRRKVLRTAVGAMLALSAAALIPSLQPAFLSNAATGQRPENAVNQAKALLKQLG
FT                   FREAHAERVGTRVLIEGLVPSSADAARLRTQVHRYDPGVAVNVAVVDEVLATLRDSLAD
FT                   PALSVRYNGNGVFSVSGSSDNAERASRRIADVRSDLGPEVRSLHVEISQQDPSVKPPEN
FT                   YDAALLADGLHYVETPDGTKHMTSLPQQAAQ"
FT   gene            complement(472137..472952)
FT                   /gene="hpaA"
FT                   /locus_tag="XAC0400"
FT   CDS_pept        complement(472137..472952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaA"
FT                   /locus_tag="XAC0400"
FT                   /product="HpaA protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC6"
FT                   /protein_id="AAM35291.1"
FT                   /translation="MIRRISPGTLPPSVSTEHGTSHHHANSAGTAAASPTDAATHIPRL
FT                   RPAPPRRRRRGVRSLDGQEDELDATEQEENEAKRECILRGRVSVAVAAAQGREQGQGDQ
FT                   HGSGRNAHADDPQTGPWQAGAPAALSDGVDARIDGILDRYVMTRDADPMVRRHALAAAL
FT                   VELRAIGVSHPAIASLTTTVWRLMREHFRSSGSATPTENLQALRKRLMELMPSELEPVP
FT                   ALRNFHLLLPLILLNAEKPRRQVDRTHAVTRLNTLLIELPQQAAQEVRP"
FT   gene            complement(472949..473209)
FT                   /gene="hrcS"
FT                   /locus_tag="XAC0401"
FT   CDS_pept        complement(472949..473209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcS"
FT                   /locus_tag="XAC0401"
FT                   /product="HrcS protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35292"
FT                   /db_xref="GOA:Q9RBK3"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RBK3"
FT                   /protein_id="AAM35292.1"
FT                   /translation="MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFIQAVMSLQ
FT                   DASISFALKLVVVVAAIAVTAPWGASAIMQFGQALMQAAFP"
FT   gene            complement(473214..473858)
FT                   /gene="hrcR"
FT                   /locus_tag="XAC0402"
FT   CDS_pept        complement(473214..473858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcR"
FT                   /locus_tag="XAC0402"
FT                   /product="HrcR protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35293"
FT                   /db_xref="GOA:Q9RBL2"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RBL2"
FT                   /protein_id="AAM35293.1"
FT                   /translation="MQMPDVGSLLLVVIMLGLLPFAAMVVTSYTKIVVVLGLLRNAIGV
FT                   QQVPPNMVLNGVALLVSCFVMAPVGMEAFKAAQNYGAGSDNSRVVVLLDACREPFRQFL
FT                   LKHTREREKAFFMRSAQQIWPKDKAATLKSDDLLVLAPAFTLSELTEAFRIGFLLYLVF
FT                   IVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGLVLSYR"
FT   gene            complement(473845..474759)
FT                   /gene="hrcQ"
FT                   /locus_tag="XAC0403"
FT   CDS_pept        complement(473845..474759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcQ"
FT                   /locus_tag="XAC0403"
FT                   /product="HrcQ protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35294"
FT                   /db_xref="GOA:Q8PQC5"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC5"
FT                   /protein_id="AAM35294.1"
FT                   /translation="MFGDPRAARQCGFATHRRRISPNDAARLRLQLDTGQMDVRIAARD
FT                   GLALLLNEDDHALRVSIAGILLADRLGALAPLGLGAAEVIAFERDAEPDDCHGIGITLG
FT                   DLDAIALTASAPLLATLRTAVAALAAPAPLPVWLAALRVNTRLRIGERTASAALLQSLR
FT                   PGDVLLHCTASAAATSGEVLWGIAGGAVLRAPVRLNLQQMILEATPTMQHDTFEPEVAQ
FT                   SASNVAELELPVQLEVDQLALSLSTLSGLQPGQILELSVPVDQADIRLVVYGQTIGIGR
FT                   LVTVGEHLGVQILSMSESTHADA"
FT   gene            complement(474891..475505)
FT                   /gene="hpaP"
FT                   /locus_tag="XAC0404"
FT   CDS_pept        complement(474891..475505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaP"
FT                   /locus_tag="XAC0404"
FT                   /product="HpaP protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35295"
FT                   /db_xref="InterPro:IPR013390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC4"
FT                   /protein_id="AAM35295.1"
FT                   /translation="MRILPVSGALQRQAAPATPARSAQRSSFLQLRQRLRSAQLALPCM
FT                   VLPPQCDEDRPEPDAEDRFTEAHDGAPATTDPALPVDGTKYQEPLQGTDNGAVGRHIAT
FT                   EWIRTQRAQMAIDHIALRVAEFCNATPVRSAGSWEAWLDIDQGLVAQTTLFLRLSPDQL
FT                   SLRFNTSSPDARELLWCGRQRLEAALNSTLSSTLQISIEVV"
FT   gene            complement(475529..477466)
FT                   /gene="hrcV"
FT                   /locus_tag="XAC0405"
FT   CDS_pept        complement(475529..477466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcV"
FT                   /locus_tag="XAC0405"
FT                   /product="HrcV protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35296"
FT                   /db_xref="GOA:Q8PQC3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC3"
FT                   /protein_id="AAM35296.1"
FT                   /translation="MLGDRVRATRYFAYSGEVAIAALVVAVIGLMILPLPTPLIDTLLG
FT                   INITLSVVLLMVTMYVPDSISLSSFPSLLLFTTLLRLSLNIASTKSILLHAEAGHIIES
FT                   FGELVVGGNLVVGLVVFLIITTVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLR
FT                   GGNLTADEARRKRARLAMESQLHGGMDGAMKFVKGDAIAGLVITMVNILAGIVVGVTYH
FT                   GMTAGEAANRFAILSVGDAMVSQIASLLISVAAGVMITRVANENETRLSSLGLDIGRQL
FT                   TSNARALMAASVLLACFAFVPGFPAVLFLLLAAAVGAGGYTIWRKQRDISGTDQRKLPS
FT                   TSRKGAKGEAPHIRKNAPDFASPLSMRLSPQLANLLDPARLDQAIESERRKLVELLGLP
FT                   FPGIAIWQSESLQDMQYEVLIHDVPETRAELGDTDDMQAALARQAIAPLHARAHLFVGI
FT                   QETQWMLEQVAVDYPGLVAEVNKAMPAQRIADVLRRLLEERIPVRNIKSILESLVVWGP
FT                   KEKDLLMLTEYVRCDLSRYLAHTATAGTGQLPAVMLDHAVEQMIRQSIRATAAGNFLAL
FT                   PPEQANQLVEQVERIVGDQAQHPLAVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEV
FT                   QLQPIGRVVV"
FT   gene            complement(477460..478533)
FT                   /gene="hrcU"
FT                   /locus_tag="XAC0406"
FT   CDS_pept        complement(477460..478533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcU"
FT                   /locus_tag="XAC0406"
FT                   /product="HrcU protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35297"
FT                   /db_xref="GOA:Q8PQC2"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC2"
FT                   /protein_id="AAM35297.1"
FT                   /translation="MSEEKTEKPTEKKLRDARRDGEVPVSPDVTAAAVLFGALMVMKSA
FT                   GDYFSDHMRALMTIGFDFPENTRDATAINRALGHIGIQGLVLMLPLLVACLVAGVAGGA
FT                   FQTGLNASLKPVAPKFDSLNPATGVKKLFSLRSLINLLKLIIKAILIGVVLWAGIRILM
FT                   PMIIGLAYQTPPDIAQIAWRTLGMLFALGVLLFVLVGAADWSVQHWLFIRDKRMSKDEQ
FT                   KREVKESEGDPEIKGKRKEFANQMVFGDPRERVAKAKVMVVNPTHYAVALAYEPDDFGL
FT                   PQVVAKGVDDGALELRAFAHNQGIPIVANPPLARALYQVELGDAVPEPLFETVAVVLRW
FT                   VDELGRDHSDGDGALPC"
FT   gene            478747..479202
FT                   /gene="hrpB1"
FT                   /locus_tag="XAC0407"
FT   CDS_pept        478747..479202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB1"
FT                   /locus_tag="XAC0407"
FT                   /product="HrpB1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35298"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC1"
FT                   /protein_id="AAM35298.1"
FT                   /translation="MEKIQCPGSVVSGLIELITVGLTHDKIQDAAAVLAAVRVLRPELK
FT                   ALDTFDAWISIKRGNYVEGARLLRELEGDAGSKPLCRALYACCLFAMGDQSWHGVADGL
FT                   IEEDADADAVALVKALSGRRTPTAAPAEVPVESSAPMEVPNSQYLRA"
FT   gene            479236..479628
FT                   /gene="hrpB2"
FT                   /locus_tag="XAC0408"
FT   CDS_pept        479236..479628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB2"
FT                   /locus_tag="XAC0408"
FT                   /product="HrpB2 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35299"
FT                   /db_xref="InterPro:IPR013391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQC0"
FT                   /protein_id="AAM35299.1"
FT                   /translation="MTLIPPVQAIAGTSITSTQALSPVAAPNQALVNRFQALMQSSSPL
FT                   PPAMQRVGNPSMMSRVVDVQNDGVRTIAEHIDAFSMQAPTMGLQEMAAQQIKLMHELTM
FT                   VGFNLNVSVGVAQSGKNAVQTLVKNQ"
FT   gene            479630..480391
FT                   /gene="hrcJ"
FT                   /locus_tag="XAC0409"
FT   CDS_pept        479630..480391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcJ"
FT                   /locus_tag="XAC0409"
FT                   /product="HrcJ protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35300"
FT                   /db_xref="GOA:Q8PQB9"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB9"
FT                   /protein_id="AAM35300.1"
FT                   /translation="MRALRYLVVLLVALLLSACSQQLYSGLTENDANDMLEVLLHAGVD
FT                   ASKVTPDDGKTWAINAPHDQVSYSLEVLRAHGLPHERHANLGEMFKKDGLISTPTEERV
FT                   RFIYGVSQQLSQTLSNIDGVISADVEIVLPNNDPLSTSVKPSSAAVFIKFRVGSDLTSL
FT                   LPNIKTLVMHSVEGLTYENVSVTLVPGGAESDAQFTASAPPRPSPWPWLAGCALALCLA
FT                   VAAALYWWPNPQAGRWGGWQRLRELTKGKAG"
FT   gene            480399..481028
FT                   /gene="hrpB4"
FT                   /locus_tag="XAC0410"
FT   CDS_pept        480399..481028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB4"
FT                   /locus_tag="XAC0410"
FT                   /product="HrpB4 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35301"
FT                   /db_xref="InterPro:IPR013393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB8"
FT                   /protein_id="AAM35301.1"
FT                   /translation="MDNTRIDNAARCVQRWTDALAHLAESLDAARVAHWLGPVAASGWA
FT                   AAPVYRRMRVIQAWSGWSGLSPSALGLHANQLAVLMPALLAKVLIARALFSRGLAVRRC
FT                   IERERLDWLEQCVGPAVLEHVRQNASAGLPVPLLPRDADQAAWVGDGWRRMQADGVWPN
FT                   PVVAKLLALSLPLGAAQVAALAADGASDAFLAALPTLMPEASCVSG"
FT   gene            481013..481714
FT                   /gene="hrpB5"
FT                   /locus_tag="XAC0411"
FT   CDS_pept        481013..481714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB5"
FT                   /locus_tag="XAC0411"
FT                   /product="HrpB5 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35302"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB7"
FT                   /protein_id="AAM35302.1"
FT                   /translation="MRLWLRSTPDAIGLDCDVIPREALASVLALDAATAEVHARCEQAL
FT                   SQAQTRAQTLIDEAQQQAEAILHDARQKAERSARLGYATGLRRQLDEWNESGLRHAFAA
FT                   DTAAQRARERLAEIVARTCEHIILGHDPAALYARAAQALEGALDEAKALRVSVHPDAVD
FT                   AARRAFDATATEAGWTLQVELCGDADLAVGACVCEWDTGVFETDLRDQLRSLRRVIRRV
FT                   LAAPQEPVDAG"
FT   gene            481704..483032
FT                   /gene="hrcN"
FT                   /locus_tag="XAC0412"
FT   CDS_pept        481704..483032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcN"
FT                   /locus_tag="XAC0412"
FT                   /product="HrcN protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35303"
FT                   /db_xref="GOA:Q8PQB6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB6"
FT                   /protein_id="AAM35303.1"
FT                   /translation="MLAEMPLLETALERELATLAFGRRYGKVVELVGTMLKVAGVQVSL
FT                   GEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPVGPAL
FT                   LGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLMTLGEG
FT                   QRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVV
FT                   VCATSDRSSIERAKAAYVGTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPT
FT                   RRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILS
FT                   REIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQG
FT                   SDAVADEAIDRIDAIRDFLSQPTDRLSAYESTLEQLASVTDDA"
FT   gene            483025..483534
FT                   /gene="hrpB7"
FT                   /locus_tag="XAC0413"
FT   CDS_pept        483025..483534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB7"
FT                   /locus_tag="XAC0413"
FT                   /product="HrpB7 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35304"
FT                   /db_xref="InterPro:IPR013392"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB5"
FT                   /protein_id="AAM35304.1"
FT                   /translation="MREPAHTWSVLHQLKARRCERMQERSSDCRRALEHCDRELARCRQ
FT                   EAEACTTRLASCDAALMDKAGVGGSIDIDTILQHERFRTVLVEACRAAEQAQTAASQSL
FT                   QSARDELASVQQALSKLQAQAQVYADKAASARRARQAQREAAEEEDAIEALVALRSHRT
FT                   AQRGAR"
FT   gene            483531..484361
FT                   /gene="hrcT"
FT                   /locus_tag="XAC0414"
FT   CDS_pept        483531..484361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcT"
FT                   /locus_tag="XAC0414"
FT                   /product="HrcT protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35305"
FT                   /db_xref="GOA:Q8PQB4"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB4"
FT                   /protein_id="AAM35305.1"
FT                   /translation="MNDATDALLAISSQGVSLLTLLALCGVRVFVMFIVLPATAQDSLP
FT                   GIARNGVIYVLSSFIAYGQPADALAKIQTVGLVGVVFKEAFIGLLIGFAASTVFWIAES
FT                   VGLLIDDLAGYNNVQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGMLMLLGALFESFRW
FT                   WPLTQLGPNMGAVAESFVIQQSDSMMAAVVKLSAPVMLVLVLVDLAIGLVARAADKLEP
FT                   SNLSQPIRGVLALLLLALLTSVFIAQFGEALGFLHFQQQLHDAANVGGKRAASH"
FT   gene            484443..486266
FT                   /gene="hrcC"
FT                   /locus_tag="XAC0415"
FT   CDS_pept        484443..486266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcC"
FT                   /locus_tag="XAC0415"
FT                   /product="HrcC protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35306"
FT                   /db_xref="GOA:Q8PQB3"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB3"
FT                   /protein_id="AAM35306.1"
FT                   /translation="MAPACTTVHRRRAPLAAVLMLSLLPVLSPHADAAQVPWHSRTFKY
FT                   VADNKDLKEVLRDLSASQSIATWISPEVTGTLSGKFETSPQKFLDDLAATYGFVWYYDG
FT                   AVLRIWGANESKSATLSLGTASTKSLRDALARMRLDDPRFPVRYDETAHVAVVSGPPGY
FT                   VDTVSAIAKQVEQGARQRDATEVQVFQLHYAQAADHTTRIGGQDVQIPGMASLLRSMYG
FT                   ARGAPVAAIPGPGANFGRVQPIGGGSSNTFGNAAQGQGGGASGILGLPSSWFGGASSSD
FT                   RVPVSPPLPGSGTAATAGSPASVWPELSKGRRDESTPIDAGGGAELASDAPVIEADPRT
FT                   NTILIRDRPERMQSYGTLIQQLDNRPKLLQIDATIIEIRDGAMQDLGVDWRFHSQHTDI
FT                   QTGNGSGGQLGFNGALSGAATDGATTPAGGTLTAVLGDAGRYLMTRVSALETTNKAKIV
FT                   SSPQVATLDNVEAVMDHKQQAFVRVSGYASADLYNLSAGVSLRVLPSVVPGSPNGQMRL
FT                   DVRIEDGQLGSNTVDGIPVITSSEITTQAFVNEGQSLLIAGYAYDADETDLNAVPGLSK
FT                   IPLLGNLFKHRQKSGSRMQRLFLLTPHVVSP"
FT   gene            complement(486984..487397)
FT                   /gene="hpa1"
FT                   /locus_tag="XAC0416"
FT   CDS_pept        complement(486984..487397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpa1"
FT                   /locus_tag="XAC0416"
FT                   /product="Hpa1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35307"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB2"
FT                   /protein_id="AAM35307.1"
FT                   /translation="MNSLNTQLGANSSFFQVDPSQNTQSGSNQGNQGISEKQLDQLLTQ
FT                   LIMALLQQSNNAEQGQGQGQGGDSGGQGGNRQQAGQSNGSPSQYTQMLMNIVGDILQAQ
FT                   NGGGFGGGFGGGFGGGLGTSLGTSLASDTGSMQ"
FT   gene            487918..488334
FT                   /gene="hpa2"
FT                   /locus_tag="XAC0417"
FT   CDS_pept        487918..488334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpa2"
FT                   /locus_tag="XAC0417"
FT                   /product="Hpa2 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35308"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB1"
FT                   /protein_id="AAM35308.1"
FT                   /translation="MFAAALACAAPFARADCFEEAAGYQHVNPWVLRAIAWQESRGRAD
FT                   AVHRNNNGTVDYGKMQINSIHLRRLSSYGISRDALMHPCISVYVAAWRLREMTNKYGNT
FT                   WAAVGAYHSETPGERDKYAHAIHSILLRRGVIAE"
FT   gene            complement(488678..489847)
FT                   /locus_tag="XAC0418"
FT   CDS_pept        complement(488678..489847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35309"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQB0"
FT                   /protein_id="AAM35309.1"
FT                   /translation="MRTSSSPTTMIQTTRRRWIAGTPGASIASEEVTPSLQGQLSTAYA
FT                   PCRVGVPHITHDRPIDASGCEAILRCNRDARQFPPEAVVAMQAVSGTLHLALHTLRRNR
FT                   ENRNPDAAARGFHNLNLEQWEALSEDERHHKRSEQQHYSDLVTRLALAGILSNIAIGAA
FT                   GKASGRPELAARLLAGELKIAPYAAARDAIQATFRMVGMRAPTNGGVSDHHVTSAGRFY
FT                   GMANVLTNLASNELELPDFASARQRWAGLMSPFNMGEATNVVFRQAAVNAALNVGLETA
FT                   DWLNVTQHEADEAGTQQIWEPTLKARREDYERVMDHSVARTAAINSNIAFGTAVNMIGT
FT                   WLGLSPARSALLSNALSGMAAGMQYKIIAGTWQAAAAVREAEAARTQAE"
FT   gene            complement(490639..490950)
FT                   /locus_tag="XAC0419"
FT   CDS_pept        complement(490639..490950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35310"
FT                   /db_xref="GOA:Q8PQA9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA9"
FT                   /protein_id="AAM35310.1"
FT                   /translation="MPHDPSVVAHVEKTCTAQLAHFASDITRVDVHLRDENGQRGGAAD
FT                   RTCSIEAHVAGLPPIAATNSAETTASAVTGAARKLRTAIEHARGKQHSKATAPPPDML"
FT   gene            491230..493722
FT                   /locus_tag="XAC0420"
FT   CDS_pept        491230..493722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35311"
FT                   /db_xref="GOA:Q8PQA8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA8"
FT                   /protein_id="AAM35311.1"
FT                   /translation="MPAPVRCLPVSEFRFTCGARQGLLRRLLLLAALWMVCIGTAVAQD
FT                   EDTVLETAQTQLDSMQKVLTQAEAGLEKSDTDQLRKLADDVTGAQRQAQDLARSLEPPL
FT                   KELSVRLAGLGEEQKTDPPDLRDQRRALTRERNGLDAELKRANLLALDAKDLADRLEGE
FT                   RAQRFSEKLSARAASPLSPALWNEIAQEWPDDRTRLQALSDEAVQAMRTGTATNGIAGL
FT                   VIGTLAALMLAFPLRIFLRHLGRRYAASRAPGGRLRRSGLALWFLLVGTLTLGMAAWAL
FT                   AESVRALSELPTDLEQLLSAFVVISCVSAFVGSLSASLLMKHQPTWRLFPLDDATVDRL
FT                   RVHCLATAAVSWFSGMAIRINDVARSSGALTIATDAVAALLYAGLILSALAGLTLSLRA
FT                   HAANVGAADADSSAPPPVVSRGGGYIVLIRLLGHLAVVFALVAALFGYINLALFVEQQI
FT                   IWITLVCSVLALLVMFADDLTTWVFKPESRFSRALSHALNVGSGRLVQVGLLISAAVRV
FT                   LLVLLGIAALVTPYGANLAAVTGWLENVSHGIAIGKELVITPGDVARALCVFLLGMGLV
FT                   HIVQKWLLNTYLPKTELDAGARNSISTVARYLGWLIVAVWGLTALGLDLKRLALVLSAL
FT                   SVGIGFGLQAITQNFVSGLILLAERPVKIGDWVRIGDQEGDVRRISVRATEIQVGDRST
FT                   FIVPNSELITKSVRNMTLSNPMGRVQLQFSVPLETDVAKVRDMLLALFAEHEKVLAEPA
FT                   PSVFIDSLAGGHVNFNSFAYVSSPRDSYGVRSQLFFALLQRMATVGIALQSPQEIRFSR
FT                   AGAAVAREAGDGAPASDD"
FT   gene            complement(493819..495903)
FT                   /gene="mdoB"
FT                   /locus_tag="XAC0421"
FT   CDS_pept        complement(493819..495903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoB"
FT                   /locus_tag="XAC0421"
FT                   /product="phosphoglycerol transferase I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35312"
FT                   /db_xref="GOA:Q8PQA7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR020881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQA7"
FT                   /protein_id="AAM35312.1"
FT                   /translation="MLLLLWLLVASPRLAWLKAGLLSLFLLLLSAWGLVDRLSGDGINA
FT                   ATLYHLRADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRIRRFQRPRGGGAVFAGFVG
FT                   MLLVGIAASPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLHKRKNIVWIYGESLERTY
FT                   FDEQVFPGLMPNLRAVATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMD
FT                   RMGMFLPEARCLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHYFQDQGV
FT                   APKHFSAWGVHDDVLLDDAWDTFQTLSRAGQPFLLTTLTMDTHHPAGHLPSACKGQQYD
FT                   SPLGDIGLLHAIKCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLSDVLAKQKR
FT                   ENLLLFLGEDIAPQQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSFLASDAPPSASAA
FT                   ASRDSGKDYPRYLAYARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKT
FT                   VYLENTSRQFDRTHSKGTLAYVDRCTAFEDGSADGDWCALVVDRHQSMKLYRDPDLARG
FT                   IAIDAPLEATQQGPRPRVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSER
FT                   KVVLAQQWVVPDAAGRIRMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS
FT                   "
FT   gene            complement(496358..498076)
FT                   /locus_tag="XAC0422"
FT   CDS_pept        complement(496358..498076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0422"
FT                   /product="ABC transporter substrate binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35313"
FT                   /db_xref="GOA:Q8PQA6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA6"
FT                   /protein_id="AAM35313.1"
FT                   /translation="MALSQNDPHRAPAASPADHAVVGGMSRRTQILRLLLRYRGSGVFA
FT                   GMNLDPAAINEYEVPAEGTPDQFVSDLESLGPTFVKLGQMLSTRPDIVPPEFATALERM
FT                   QENTSSVPVERIRQIIEEELGVSVNKAFSFFDPVPLGCASLAQVHRAALRDGTPVAIKV
FT                   QKPEVAAQVRSDLDVLKSFATAADRLTGIGRRVRFADWLGEFGKTLRAELNYEDEAETL
FT                   ARFGKHLKPFPLLWVPQPVWDLSSRKVLTMQLAEGVRVDKISGLRRTEQPMDELAAELV
FT                   KGYLDQMFVHGEIHADPHPGNLRVLQDGRLAIFDLGMVAHVPPRLRERLLKLLFAAVDG
FT                   RGEEVAEETIALSTRLEDYDEERYQRETGQMIARYAAHDATSEGRVVLDLVRIATSTGL
FT                   RTPPELSLLGKTLLNLEGVCRALSPTLDTRRIVERHLQHVMRARLKKSLSAANLASEAM
FT                   ELQHLVREGPRRMSEILSLAAENRLQMRVTGLEESHLMESLQKIANRVAAGIVTAALIM
FT                   ASAQMMRIETGLKLWGYPAIAMVLFLLGVVLGLGIVVSALLFDRRVRAREERGHR"
FT   gene            498318..499259
FT                   /locus_tag="XAC0423"
FT   CDS_pept        498318..499259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35314"
FT                   /db_xref="GOA:Q8PQA5"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA5"
FT                   /protein_id="AAM35314.1"
FT                   /translation="MAGASLFTLLDDIATLLDDVSILTKVAAKKTAGVLGDDLALNAQQ
FT                   VTGVTADRELPVVWAVAKGSLVNKMILVPAALAISALEAWLRGRGYNVPLVMPLMMIGG
FT                   AYLCFEGVEKLAHKFLHNDEQEAQRHAERTRALADQNVDVVALEKDKVKGAIRTDFILS
FT                   AEIIVLSLGVVSEVSFGQQVAVLVAIALAMTIGVYGVVAAIVKLDDLGLYLTRKGAALA
FT                   ALGRGILVAAPWLMKFLSVAGTLAMFLVGGGILVHNIPVLHHLVVDLAESSGSMGWLVE
FT                   ALGNMLVGVVAGALVLGAVMLFQKLRGSKPAH"
FT   gene            complement(499340..500968)
FT                   /locus_tag="XAC0424"
FT   CDS_pept        complement(499340..500968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35315"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA4"
FT                   /protein_id="AAM35315.1"
FT                   /translation="MADQPEHPSRPRGGLRRLLPWGGTDTARPAAALPTVINGERGGHG
FT                   LAAHQLVPAKAKSGAHDPAAATALLIRLFSHAAHPEALLLAFAEGIASLHGELGDMGVR
FT                   LSAAYAAGDWPGYGRALRQLIDKYIRTIDIGDSLAEGRTEAEQLRDLLRHALGNALATL
FT                   LQRSPELAEEAQTLASALRHWRPGHELITLEQRLRELSHQIGLRAEDASEQQNLLLGLF
FT                   DLLLENVGELLDDRSWLQGQITVVRQLISGPLDVSSIEQARGTLREVTYKQGLLKQGIA
FT                   ESKTAMREMMVSFVDRLDGMATSTGEYHDRVAGYSQAIGEARGIPDLNRLLQDLLQDTA
FT                   GVQAQALAARDELLAARRQVEDSEQRIASLEQELKDVAGLVREDQLTGALNRRGFEELF
FT                   QREAVRTQRSGQPLCVAMLDLDDFRRLNETHGHAGGDAALRHTVEVAKAVLRTTDAIAR
FT                   FGGEEFVLLLPDSTIFEASAAVIRLQRALSQRSLLHDDVRVFISFSAGVALRGTDETQD
FT                   EVIRRADRAMYDAKAAGKNRVINAD"
FT   gene            501616..503040
FT                   /gene="glgA"
FT                   /locus_tag="XAC0425"
FT   CDS_pept        501616..503040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="XAC0425"
FT                   /product="glycogen synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35316"
FT                   /db_xref="GOA:Q8PQA3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQA3"
FT                   /protein_id="AAM35316.1"
FT                   /translation="MFVVSEMADFIKAGGLGDVAAALPRALRHRYDVRVLIPGYRAVLE
FT                   RAGKVEIVGRVLAHAALPACDIGRIVQSDGLPIYILLSKELFERDGSPYVSTSGSEFED
FT                   NAIRFATLSHAAAQIAAGHAGLGWKPRLLHLNDWPCALAAGYVRWSGGTTPCLLTIHNL
FT                   AYQGLVPYSMAAALGIPAERVAELEFYGQMSFLRGGIVNADHVNTVSVSYAKQITGPAQ
FT                   GCGLDRLLAGRAAKGALTGIVNGIDASWDPRTDQYLDSHFSVNQWQGRQANAAQVRKAF
FT                   GLRESAGPLFAVVSRLVHQKGLDLICEVAPQIVAAGGQIAVIGGGEPEIEQQVAELTRR
FT                   YPGQVGAFIGFEEGLARRMFAGADFLLMPSRFEPCGLSQMYAQRFGCLPIAHATGGLID
FT                   TVDDGVTGFLFQHASVEALRRCLERAFRTFRLPSLLSAMRRAAMLRPSGWDVAGKKYLS
FT                   LYEHTAATAPALATVP"
FT   gene            503109..505268
FT                   /gene="glgB2"
FT                   /locus_tag="XAC0426"
FT   CDS_pept        503109..505268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB2"
FT                   /locus_tag="XAC0426"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35317"
FT                   /db_xref="GOA:Q8PQA2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQA2"
FT                   /protein_id="AAM35317.1"
FT                   /translation="MSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLI
FT                   DPRGKLLARMQASAIDGVFEGTLAVDGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQ
FT                   IAAGDGQALRRALGAQHLHCGDVPGVRFALWAPHAQRVAVVGDFNGWDVRRHPMRQRIG
FT                   GFWELFLPRVDAGARYKYAVTAADGRVLLKADPVARQTELPPATASVVPSAATFAWTDA
FT                   AWMANRDPAAVPGPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLP
FT                   ITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHG
FT                   LAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIEHYHLDGLRVDA
FT                   VASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPG
FT                   VTAAISDGGLGFTHKWNMGWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLS
FT                   HDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQS
FT                   LDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGTHRAEGFDWSVADDARNSVLAFVRH
FT                   DPDGGAPLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPV
FT                   GMHGHAQRLRLTLPPLATIYLQAEK"
FT   gene            505271..507028
FT                   /locus_tag="XAC0427"
FT   CDS_pept        505271..507028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0427"
FT                   /product="maltooligosyltrehalose trehalohydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35318"
FT                   /db_xref="GOA:Q8PQA1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA1"
FT                   /protein_id="AAM35318.1"
FT                   /translation="MNQRDAITPAWGAWPAGEGQVRFALWAPEAKNVDVVFANGARSAL
FT                   QAGQDGFFSALIDCAADARYRYSVDGGEPVPDPASRWQPEGVHGPSAVQPTDGYAWQNT
FT                   QWQGRPWDEAVIYEVHVGTCGGYAGVQAQLPQLAAMGITAVELMPLSAFPGAHNWGYDG
FT                   VLPYAPVEAYGTPDELKALIDAAHGHGLMVLLDVVYNHFGPDGNYLHSYAAPFFNEDKP
FT                   TPWGAAIDFRKPPVQRYFLDNALMWLHEYGFDGLRLDAVHAISPNAFLDTLRETIEASL
FT                   PAGRHVHLVLENEANQASQLQRGYTAQWDDDFHNALHVLLTGEEEGYYAAFADKPTEHL
FT                   ARVLGEGFAYQGEPDPRGHVRGEPSGALPPHKFVVFAQNHDQIGNRARGERLTVLVSPQ
FT                   RLRAALALTALTPMIPLFFMGEPWGAKQPFLFFTDFGPPLDEAVREGRRREFAHFAAFA
FT                   DEAQRATIPDPNSHATFAASRSPIADAAHGDGAQWASWFKALLDVRRQWLVPGLAQARA
FT                   VRASVLADGAVTATWELPGGLWHIAFNVGTQPVPLPPLRGRVAHVENVAADARQLPVDG
FT                   FIAWHEAQA"
FT   gene            507025..508974
FT                   /gene="malQ"
FT                   /locus_tag="XAC0428"
FT   CDS_pept        507025..508974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="XAC0428"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35319"
FT                   /db_xref="GOA:Q8PQA0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQA0"
FT                   /protein_id="AAM35319.1"
FT                   /translation="MSARDHGGDDLGTLAAAAGVMVDWVDASDQPRQVCEQSVHAVLSA
FT                   LELPAATAAQRADSLRRCQAQATEAAPLLTVQVGQPLPLRVAAHAGGRWTDDSGASEDA
FT                   RADAQGHLRAPRRFGYWTLQIGAITQQVAVAPPRCFSVADACGQPSPRAWGMALQVYSA
FT                   RSLDDGGIGDAAGTVEWLRYAALAGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLH
FT                   AAPVRILGELALDAINAVPGLRERFDGLHNAALIDWQASAHAKWELLRQLYTRVSPDHA
FT                   DLVAFRNAGGAALEGFARFAAQDFGDNDPQLHVFTQWLAARSWSDAQREAHERGMKIGL
FT                   IADLAVGFDPNGAEAAAAADTVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAP
FT                   YIALLRAVLHDRGGIRIDHILGLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRH
FT                   RAIVIGEDLGVVPPGIREELSQRGVMGIDVLMFTRNDDGAFVSPTLWRPDAIATTTTHD
FT                   LPTLTGWRTGRDIEWRRKLELIQPAQASDDAAARDKDVARLDAAVEHAGLSNARAPLLG
FT                   ALRFTATSVSPLALLPVEDALALDEQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGF
FT                   AEARRVAAVSEPHP"
FT   gene            508971..511580
FT                   /gene="glgY"
FT                   /locus_tag="XAC0429"
FT   CDS_pept        508971..511580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgY"
FT                   /locus_tag="XAC0429"
FT                   /product="maltooligosyltrehalose synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35320"
FT                   /db_xref="GOA:Q8PQ99"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ99"
FT                   /protein_id="AAM35320.1"
FT                   /translation="MIDLRATARLQLHAGFTLHDALAQVPYYAGLGISHLYLSPIGTAV
FT                   PGSTHGYDNIDPTVVNPELGGEDALVALSQAAREHGMGLIADIVPNHMATHAQNGWWWD
FT                   VLRNGRSARHADWFDIDWRAPGRDGKLWLAVLDRPYATALAEGLITLVIEDDGSAALAH
FT                   YDQRYPIRPQTLDIPEKAARAQWLRDYNDGAKRGDGRLHKLIERQPYRLNWWRVGNDML
FT                   NYRRFFDITSLVALRVELPAVFDAVHALPLRLVAEGHLDGLRIDHVDGLTDPTGYVRKL
FT                   RSRLDAAGRTRGLKPGTLGLYLEKILAPGEHLPADWPCDGTTGYDFMDQVGGVLHDAAG
FT                   FKPLARAWQKVSGRSGDFAQEERTARDEILRGPLQSEFNRAVGALSALARLDPPTREFS
FT                   PQMLARGLCVLLRWFPVYRTYAGAKGITGSEAERLRATAAKARDGMPESIVAAVDAIER
FT                   WLLDDAGADRAQIALRRILRRRVEQLSAPLNAKAVEDTAFYRHGVLLSRNEVGSHPTHF
FT                   ANEAAEFHAQNLERAKHYPRALLATATHDHKRGEDLRMRLAVLSEQPRWWIEQSAQFDA
FT                   LADALASPALAGGDQQMLWQTLVAAWPIGLGADQTEPLADYAERIAQWLLKAVREAKLH
FT                   TSWTDGAPTYEQAVQATVEQVLCSRAGLPLRRALLRASNHIAAAGARNSLVQTTLRLTV
FT                   PGVPDLYQGTEGWDLSLVDPDNRRPVDYAQRQQWLQQARDWNTLLRSWRDGAVKARLTA
FT                   LLLQLRREFPALFAKGDYQPLTVTVSGDAQVLAFRRQYRGQSLVVAVTRLGAGVEGEGD
FT                   LPLLVAPAAWGQASLALGEGTYRNVLDGSTLQSQRGRVALSTLFARAPVAVLLSQEN"
FT   gene            511612..511788
FT                   /locus_tag="XAC0430"
FT   CDS_pept        511612..511788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35321"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ98"
FT                   /protein_id="AAM35321.1"
FT                   /translation="MERQARLAQLARQIWEAEGRPDGHADRHWAMAERLVEAEERAAEQ
FT                   AAEYAATPIAARQ"
FT   gene            511906..514068
FT                   /gene="glgX"
FT                   /locus_tag="XAC0431"
FT   CDS_pept        511906..514068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="XAC0431"
FT                   /product="glycogen debranching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35322"
FT                   /db_xref="GOA:Q8PQ97"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ97"
FT                   /protein_id="AAM35322.1"
FT                   /translation="MATRKFTQRSRIREGRPNPLGATWDGLGVNFALYSRNATRVELCL
FT                   FDERGREQERIALPEYTDEVWHGYLPDARPGQLYGYRVHGPYAPDAGHRFNHNKLLLDP
FT                   YAKQIVGELKWAPHLFGYTIGHRDKDLSFDRRDSAAFMPKSAVIDPAFTWGQDRPPQTP
FT                   WNRTVIYEAHVRGLSMLHPAVPPEERGTFSALKTDELIDHISSLGVTAVELLPVHAFVD
FT                   DQYLLEKGLRNYWGYNTLGFFAPQARYMSTRTVAEFKQMVARLHHAGLEVLLDVVYNHT
FT                   AEGNELGPTLSFKGIDNASYYRLADDRRFYINDTGTGNTFDLTNVGALRMVMDSLRYWV
FT                   QEMHVDGFRFDLASILGRERYGFDPSGSFLDAVRQDPVLSQTKLIAEPWDIGPGGYQVG
FT                   NFPPGWVEWNDKFRDNVRAFWRGDGGQLAELATRLTGSADLFDHSGRRPTASVNFVTAH
FT                   DGFTLRDLVSYEGKHNLANGEDGRDGSDHNISSNYGVEGETNDPAIKQLRRQQMRNLLA
FT                   TLLLSQGTPMLLAGDEFGHSQNGNNNAYCQDNELTWIDWTAATKAAAADQAAFVRRLIR
FT                   IRQRYPLLHRARFFDGKFDEALGLKDLTWLAPNGTEMDEAGWHDPEARALMLRLDGRSP
FT                   TTGLREIAANVTLLMLINAASTAVSFTLPAMHDEHWRVLVDTARHGGRVVAGGSEWKAP
FT                   AHSLTLLAVERDRIVSSARIVSEGAR"
FT   gene            514037..514717
FT                   /locus_tag="XAC0432"
FT   CDS_pept        514037..514717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35323"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ96"
FT                   /protein_id="AAM35323.1"
FT                   /translation="MRGSSPKERADGEDGLMDVLLAGATGLVGRHVLQQLLGDTRCTGV
FT                   VAITRRPLAQIHPKLRNQVIDFERLDHWTAPRMEAAICALGSTMKQAGSRDAFYRIDHD
FT                   YPLAIARAACAQGTSVFVLNSAAGANAQSRIFYNRVKGELERDLREIGFPSLTFVRPGL
FT                   IGGEREEPRTGEHIGSIVLGALGPLLPRRFRINPAERIAAAMVSAALAPARGEHSVEAA
FT                   ELAG"
FT   gene            complement(515296..516054)
FT                   /locus_tag="XAC0433"
FT   CDS_pept        complement(515296..516054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0433"
FT                   /product="3-oxoacyl-[ACP] reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35324"
FT                   /db_xref="GOA:Q8PQ95"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ95"
FT                   /protein_id="AAM35324.1"
FT                   /translation="MSNTALRPQRVLIAGGSRGIGLAIAEAFVRHGAQVSICARNAAGL
FT                   AQAADALAAQGAPVHTLPCDLADATQIDAYVHAAAQALDGLDVVINNASGFGHGNDDAS
FT                   WQAGLEIDLMAAVRCNRAALPYLRRSDAAVILNISSINAQRPTPRAIAYSTAKAALNYY
FT                   TTTLAAELARERIRVNAIAPGSIEFPDGLWDTRSREQPELYARIRDSIPFGGFGQVQHV
FT                   ADAALFLASPQASWITGQVLAVDGGQSLGV"
FT   gene            516405..517841
FT                   /locus_tag="XAC0434"
FT   CDS_pept        516405..517841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35325"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ94"
FT                   /protein_id="AAM35325.1"
FT                   /translation="MRVIKRNLHMETHITVIGAGFCGTALVRALAQTADAQVRITLVGV
FT                   AETFGSGIAYGAARPEHLLNVRAKDLGIDAQAPGAFADTLHLGESGRLEFLPRLAYGDY
FT                   LRSELDAAVSGAQASIMRLSQEAVAVERVRKGFRVFLANGDAFQSDRVVLAVGALQPQA
FT                   LAGIGPRLSVHPRYIGWPWQGEALARLSPDDDVLIVGTGLTMVDVALTLHTRGHRGRLL
FT                   AISRRGLAPQAHLRQPGAPLELPPHLQRALKDADLRGLLRGVRQLSAVVDDWRRVVDAL
FT                   RPHLQSLWQRLELSQRARFLRHLRPYWEVARHRVAPGAAEQLAQLQASGQLQIVSARLL
FT                   RARWVPDGVEAVIRPRGSADAQTGHYDAVIRATGLDTDIDRTSDPLIAGMREAGLLRAD
FT                   PLGLGVDTDAQLRVRDNAGQIVPGLYCVGPLLRGRYWEITAVPELRVATRALADRLLLG
FT                   ATPALQPTPEQVRREVNARL"
FT   gene            518070..518501
FT                   /gene="virK"
FT                   /locus_tag="XAC0435"
FT   CDS_pept        518070..518501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virK"
FT                   /locus_tag="XAC0435"
FT                   /product="VirK protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35326"
FT                   /db_xref="InterPro:IPR010694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ93"
FT                   /protein_id="AAM35326.1"
FT                   /translation="MPRLVPAALFATLCACALPALATESLNNRAEVLAALDAGYDVSVS
FT                   TDLARCTPEEGTPATQTRGGRHIDAYRITADGTVAFSDAHFTVANDGKPIQQFMRYQLR
FT                   PDDTLRFTTYMYDLPGLQQRGPVLAYQCKINAGVRFHAD"
FT   gene            complement(518627..520138)
FT                   /gene="oprN"
FT                   /locus_tag="XAC0436"
FT   CDS_pept        complement(518627..520138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprN"
FT                   /locus_tag="XAC0436"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35327"
FT                   /db_xref="GOA:Q8PQ92"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ92"
FT                   /protein_id="AAM35327.1"
FT                   /translation="MSSLRTLAALVVASLVTGCAVGPDYARPEAPLPDRYIGQADVAQR
FT                   QAAVPTELSTWRDGFNDPDLSRYVNAALAQNLDLAQAGARVDPARAGLSAATAALLPAG
FT                   NVSGSATRAYQSLETPLGQVLNSTPNFDRHASVYEANLGASWELDLFGGLRRGRQAALA
FT                   DYQATEAGVAATRLAVAAQTADIYIGVRGLQARLDVAQRQVATQQGLLSMVTLLHGKGL
FT                   AAELQLQQAQGALAQAQAGVPGLEAGLVAAMNALDAMLGVPPGTHRAELSAAIKPIPPA
FT                   PQIADSGAPGDLLRRRPDLIVAERRLAASNARIGVAMAEYYPKFSLSGLLGSATAISGA
FT                   NLFTGDAAQSSGVLGLRWRLFDFGRINAQIAQAKGQQAEQLAAYRLAVLRATEDVENAF
FT                   TALIKREQQAVVLTQGVDALGKARGASALAYEKGTVSLIEVLNADDSLLSASDALVQAR
FT                   TDAAHSAVATFKALGGGWQAGGADAGAIAVAVDSNRRHDDTTATE"
FT   gene            520225..520842
FT                   /gene="ameR"
FT                   /locus_tag="XAC0437"
FT   CDS_pept        520225..520842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ameR"
FT                   /locus_tag="XAC0437"
FT                   /product="transcriptional regulator tetR/acrR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35328"
FT                   /db_xref="GOA:Q8PQ91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ91"
FT                   /protein_id="AAM35328.1"
FT                   /translation="MSKASNYPVSGRGPADHDVRDQIVVAATEHFSRYGYEKTAVSDLA
FT                   KEIGFSKAYIYKFFESKQAIGEMICSHCLGEIEADVLAAVSAASSPPEKLRSLFRAIIE
FT                   ASLRLYSRERKLYEIATSAATERWPPVIAYEGHIQALLQDILVQGRQNGDFERKTPLDE
FT                   LTQAIYLVMRPYINPVLLQHSLEHAGDVPLLLSGLVLRSLSP"
FT   gene            520919..522016
FT                   /gene="mexE"
FT                   /locus_tag="XAC0438"
FT   CDS_pept        520919..522016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexE"
FT                   /locus_tag="XAC0438"
FT                   /product="component of multidrug efflux system"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35329"
FT                   /db_xref="GOA:Q8PQ90"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ90"
FT                   /protein_id="AAM35329.1"
FT                   /translation="MRRRRLVASTLLCVLPLGLSACGGKAQTDPRTAAPLVRVATVGDA
FT                   NAVVRTFSGTVAARVQSDLGFRVAGKVSERVVDAGQRVRRGQRLLRIDPIDLQLAARAQ
FT                   QDAVAAARARAQQTADDEARYRDLRGTGAISASAYDQIKAAADAAKAQLSAAQAQADVA
FT                   RNANRYTDLLADADGVVMETLVEPGQVVAAGQPVVRLAHAGRREAIIQLPETLRPRVGS
FT                   VAQASLFGNAAVSVSATLRQLSESADRLTRTFEARYVLDGALAQAPLGTTVSLRIADDT
FT                   AINAQPGLQVPLAALFDAGKGPGVWVIAGNPAKVSWRPVAVLGLDDDHANVAGKLARGE
FT                   RIVALGGASVARRRAGAHCRRKRGR"
FT   gene            522065..525163
FT                   /locus_tag="XAC0439"
FT   CDS_pept        522065..525163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0439"
FT                   /product="cation efflux system protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35330"
FT                   /db_xref="GOA:Q8PQ89"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ89"
FT                   /protein_id="AAM35330.1"
FT                   /translation="MSEGRFNLSALAVRERAVTLFLIVLISLAGLVAFLKLGRAEDPAF
FT                   TVKVMTIVTAWPGATPQEMQDQVAEKLEKRLQELRWYDRSETYTRPGLAFTTLTLLDST
FT                   PPSQVQEQFYQARKKVGDEVANLPAGVIGPMVNDEYADVTFALFALKAKGEPQRLLARD
FT                   AEMLRQRMLHVPGVKKVNIIGEQPERIFVEFSHARLATLGVSAQDVFAALNAQNAVNAA
FT                   GSVETRGPQIFIRLDGALDSLQKIRDTPLVVQGRTLKLSDTATVKRGYEDPSTFLIRSG
FT                   GEPALLLGIIMRDGWNGLDLGKSLDAEVGAINAELPLGMRLSKVTDQAVNIDASVGEFM
FT                   TKFFVALLVVMLVCFVSMGWRVGIVVAAAVPLTLAAVFVVMLATGKNFDRITLGSLILA
FT                   LGLLVDDAIIAIEMMVVKMEEGYSRVAASAYAWSHTAAPMLSGTLVTAVGFMPNGFAAS
FT                   TAGEYTSNMFWIVGIALIMSWVVAVVFTPYLGVKMLPEMKKIAGGHAAMYDTPHYNRFR
FT                   NVLGHVIARKWLVAGAVVGLFTLAMGGMGIVKKQFFPISDRPEVLVEVQLPYGTSINQT
FT                   SAATAKVEAWLAKRDEARIVTAYIGQGAPRFFLAMGPELPDPSFAKIVVRTDDQHQRDI
FT                   LKLRLRQAVAEGLASEARVRVTQLTFGPYSRFPVAYRVSGPDPQVVRGIAGKVEQVMRG
FT                   SPMLRTVDTDWGVRTPTLYFSLDQDRLQAVGLSSTAVAQQLQFLLSGVPITQVREDIRS
FT                   VQVVARSAGTTRLDPARIADFTLAGGNGQRVPLAQVGKVDIRMEEPIMRRRDRVPTITV
FT                   GGDVDDQLQPPDVSAAISKQLQPLIATLPSGYQITQAGAIEESGKATTAMLPLFPIMLA
FT                   ATLLIIILQLRSISAMVMVFLTSPLGLIGVVPTLLLFQQPFGINALVGLIALSGILMRN
FT                   TLILIGQIHHNQAEGLDPFHALVEATVQRARPVILTALAAILAFIPLTHSVFWGTLAYT
FT                   LIGGTLAGTVLTLVFLPAMYSIWFKIRPDPDKGRSAPAVAQHA"
FT   gene            525281..526087
FT                   /locus_tag="XAC0440"
FT   CDS_pept        525281..526087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0440"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35331"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ88"
FT                   /protein_id="AAM35331.1"
FT                   /translation="MQQQTVVLITGVSSGIGRAAAEHFARTGCIVYGSVRHLAGATPLT
FT                   AVELVEMDIRDAASVQRAVDGIIARAGRIDVLVNNAGANLVGAIEETSVDEAAALFDIN
FT                   VLGILRTVQAVLPHMRARGQGRIVNVSSVLGFLPAPYMGVYAASKHAVEGLSETLDHEL
FT                   RQFGIRVTLVEPAYTKTSLGSNSPAAQATIADYDRERGVVARTVTHSIDTAPEPHGVAA
FT                   TVVEAALGRWRMRRTPAGQASLLSKLRRFLPASAVDGSLRKQLGLR"
FT   gene            526420..526614
FT                   /locus_tag="XAC0441"
FT   CDS_pept        526420..526614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35332"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ87"
FT                   /protein_id="AAM35332.1"
FT                   /translation="MRFGVDEASAVALPPAELIRSINALTSEGGDQFFVEILRKPGKRV
FT                   PRAESDHVYGDGELDFEQD"
FT   gene            complement(527052..528344)
FT                   /gene="rhlE"
FT                   /locus_tag="XAC0442"
FT   CDS_pept        complement(527052..528344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="XAC0442"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35333"
FT                   /db_xref="GOA:Q8PQ86"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ86"
FT                   /protein_id="AAM35333.1"
FT                   /translation="MSFSDLSLSPQLQPFFDTALAKAGLRTPTPIQQQAIPPMLDGRDL
FT                   IAMAQTGSGKTLAYALPLLQQRCLAPDTAPRVLGALVLVPTRELAAQVEDALRQLAAHL
FT                   PRRLKSVVATGGSSINPQLLALRGGADLVVATPGRLLDLVEHNALRLNGVTTLVLDEAD
FT                   RLLELGFGAELDRILALLPAQRQTVLFSATFPPAIASLAKRRLRDPLRVTIDATPEQAP
FT                   AIAQCAIAVDAGQRTQLLRHLLQEHAWPQLLVFVASRHSADKVAEKLSKTGIAALPLHG
FT                   ELSQGRRERTLRAFKQADVQVLVATDLAGRGIDIDALPAVLNYDLPRSTVDYTHRIGRT
FT                   ARAGASGVAISFVTADSAQQWRLIEKRQGLRVPTSVIEGFEPTPVEAPASDNAPGTAMR
FT                   APNDNGGIKGKRPSKKDKLRAAAQAQTGKPG"
FT   gene            complement(528796..530313)
FT                   /gene="pdhB"
FT                   /locus_tag="XAC0443"
FT   CDS_pept        complement(528796..530313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="XAC0443"
FT                   /product="dihydrolipoamide acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35334"
FT                   /db_xref="GOA:Q8PQ85"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ85"
FT                   /protein_id="AAM35334.1"
FT                   /translation="MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAK
FT                   AVVEVPSPFSGTVVKLAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPAPTHS
FT                   PTPSTGDSAAGPTARVVASDNGGEIADADAGDEGSGDRDDAGTVVGAMQSSNAVQSEQA
FT                   IAVGGVRAMPVVRALARKLRVELAQVRATGPDGTVTLADVKQAAAAGTAQPSPGVQGAP
FT                   SSPANGKRGLIGDGGRAAGIAADGRDRPATAALLPSAGEGARRADVGGAAARSPLSASG
FT                   KPMRTQSPGISAKGQPEQLKGVRRNMARVMADAHTKVVPTTLNDDADLHAWQPGNDVTV
FT                   RLVRGIVRACQAVPALNAWFDGDALSRTLHHQVDIGIAVDTEEGLFVPALRNADMLDAH
FT                   GIREGVNRLRQQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRAR
FT                   YQLTPVMGGVETHKVMPLSLTFDHRAATGGEAARFLRALLDDLALAN"
FT   gene            complement(530310..530693)
FT                   /locus_tag="XAC0444"
FT   CDS_pept        complement(530310..530693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35335"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR014593"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ84"
FT                   /protein_id="AAM35335.1"
FT                   /translation="MRARLLCDHRAAYANPVRFQAGQQVGLGVRDEEWPAFAWVTTDSG
FT                   RAGWAPLAWLRPLGDGRAEALRDYDARELDAQTGEDVLLHHEHGGWWWSERADGTQGWL
FT                   PAADLELLDDTTPQLPAAQENLP"
FT   gene            complement(530695..531678)
FT                   /gene="pdhB"
FT                   /locus_tag="XAC0445"
FT   CDS_pept        complement(530695..531678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="XAC0445"
FT                   /product="pyruvate dehydrogenase E1 beta subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35336"
FT                   /db_xref="GOA:Q8PQ83"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ83"
FT                   /protein_id="AAM35336.1"
FT                   /translation="MSSPITLIEAITQALAWELEHDPAVLVLGEDVGVNGGVFRATAGL
FT                   QQRFGSDRVLDTPLDETTIAGLSVGLAAQGMKPVAEAQFDGFVYPMVDHLICHAARLRN
FT                   RTRGRLHCPMVLRVPWGGGIRAPEHHSEANEAIFTNVPGLRVVLPSSPQRAYGLLLAAI
FT                   RDPDPVIYMEPKRIYRQYKEVVANDGEALPLDVCFVLRDGTDVTLVTWGAQVKEALEAA
FT                   DKLAGEGISAEVIDVATLRPLDFDTIAESVAKTGRCVIVQEAPRTAGFGAEIAARLAEQ
FT                   SMYDLVAPVERVTGYDTHIPLFRLEMKFLPSVERIVSAARRAVAAG"
FT   gene            complement(531758..532846)
FT                   /gene="pdhA"
FT                   /locus_tag="XAC0446"
FT   CDS_pept        complement(531758..532846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="XAC0446"
FT                   /product="pyruvate dehydrogenase E1 alpha subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35337"
FT                   /db_xref="GOA:Q8PQ82"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ82"
FT                   /protein_id="AAM35337.1"
FT                   /translation="MSVAAQFQIDYLQYMDADGQWVRDDLPADAANPQHLLALFKRMLF
FT                   VRTFDTKSVALQRTGKLGTYAACIGHEATHVGIGASMRSGDVFAPSYREYGTMFERGVR
FT                   PRDVLLYWGGDERGSDYPRDADAAIDFPICVPISTQCLHAAGSALSFKLQGKQHVAVAC
FT                   CGDGGSSKTDFYAALNSAGAYKLPLILCVINNGWAISVPRSAQTGAQTLAQKGLAGGLH
FT                   CLQVDGNDLVAVLEAMRQARVRALAGEGGTVIEFLTYRLSDHTTADDARRYRGEEEVKQ
FT                   GWAREPLLRLRRYLTAQGLWDEAQEDAWKADCSARVDEEVNAYLNTPVQPVEAMFDYLY
FT                   GDPPAELLAQRAEVMALESRHG"
FT   gene            complement(533024..536419)
FT                   /gene="nucH"
FT                   /locus_tag="XAC0447"
FT   CDS_pept        complement(533024..536419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucH"
FT                   /locus_tag="XAC0447"
FT                   /product="nuclease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35338"
FT                   /db_xref="GOA:Q8PQ81"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ81"
FT                   /protein_id="AAM35338.1"
FT                   /translation="MQYASAAGSSWQVTPLAGTVPAGGYYLIKQADGSGGSVALPTPDA
FT                   TGTLAMSGTAGKVALSNRASALSGTCPPGNADLVGYGSTASCAEGNAPTPAPSNTLAVL
FT                   RGNDGCTDTDNNAADFATGAPAPRNAASPARLCSGGGQPVATLADVGQAEGNSGTRSFV
FT                   FTLSLSQPAGAGGVSFTAATVDGTATAGSDYIALPATTLRIAAGERSATISVDVLGDTT
FT                   PEPDESFRVQISGVTGALPATLSATGTILNDDFSLLPIHAIQGKGARSPLEGQVVATSG
FT                   IVTARRSAGFFLQAPDGEADADPSTSEGVYVYTGSAPPEAAAIGNRVRVQGTVIEYVPT
FT                   ADPTQPPLTEIGGSVTVLADSTGNPLPMPVALSANFPNPNGAYDQLEALEGMRVAAASL
FT                   TVNTPTGGSVNETNATATSNGVFHAVVTGVPRAYREPGVQLPDPLPAGSPAGVPRWNTN
FT                   PEVIAVGSAGVGAERLDLASGCQVLDVVGPLDYSFRRYTLYAERTPQVSCNGADQPRPA
FT                   PMPQADDVAVATYNMERFFDDQNDPAIGEPVLTPAAFQARLNKASLAIRNYLHTPDILG
FT                   TVEVENLGVLQTLAARVNADAVAAGQQDPKYVAYLQEGNDVGGIDVGFLVKTADIAGGV
FT                   PRVEVLSIAQEGKTTTWTEPGGGVSLLNDRPPLVLTANVHQAEGRTLPLTAIVVHQRSL
FT                   NGAETDDAAGTRIRAKRQAQAEYLARLLQTRQQLNPDEKVLVMGDFNAFEFNDGYVDAM
FT                   GTVTGKPAPDAQTVVGGDGADLVNPDYTDLTWFNTPDQSYSYAFDGNVQSLDHILANEA
FT                   LMRAPQIASLSVGHARINADFPGTARNDANTPTRLSDHDPTVVLLRMREQVNADLGVAV
FT                   TAARDQVVEGERIDFSVDVENRGPDSAAFAAVALAFDAAVSPRVTAAPGWVCQPPQTGT
FT                   QTVVTCTIASLAAGNAQNFSAQVEAGAALAGRTLTLAASVASQTPDPQSGNDTDAASVT
FT                   VQAQPRSDLAVRFDGPSALPSTAFNATYRVLLGNVGAAPAQGPSLVIEGNTVSALSQLV
FT                   PPQGWRCDKQTQSLRRARFVCSTAAVVLPGAQATFQLTVAARPIPAEGAVRVQATATSS
FT                   SPDANPADNTALIVTPIGGGDGRR"
FT   gene            537038..537934
FT                   /locus_tag="XAC0448"
FT   CDS_pept        537038..537934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0448"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35339"
FT                   /db_xref="GOA:Q8PQ80"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ80"
FT                   /protein_id="AAM35339.1"
FT                   /translation="MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAH
FT                   HDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSV
FT                   LETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPQGQARLREAL
FT                   EAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDSLRPVFERIYENTDRYWREYAL
FT                   CEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTS
FT                   VGVETRSSQGNAGTAGS"
FT   gene            538319..539908
FT                   /gene="yhiP"
FT                   /locus_tag="XAC0449"
FT   CDS_pept        538319..539908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiP"
FT                   /locus_tag="XAC0449"
FT                   /product="di-tripeptide transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35340"
FT                   /db_xref="GOA:Q8PQ79"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ79"
FT                   /protein_id="AAM35340.1"
FT                   /translation="MILARRPGSPRCTQPSLNTQGTSMSVDATAPTSASKPPQPPAPPE
FT                   FPTLLGHPRPLWLLFMTEFWERFAFYGIRWALVLYIVAQFFNGDATGQAPAGRTYGAYL
FT                   ALVYAAAIFGGYVADRVLGYQRSILVGAAVMATGLFLIAIPDPTMFEIGLATVVVGNGL
FT                   FKPNISTMVGKLYSVADPRRDSGFTIFYMGINLGAMISPVLTQLLAEKVFGTDVMPSYK
FT                   MVFMASGVGMLISLVWFWFGRVQLKGIGAPAPNAQGMGRVLMVLVGCLLAIPGVYFLLA
FT                   VGADVLQILLTVLFIGLSVMLLVEGIREGKVQRDKVIAMLIIFAFNVLFWMFFEQAGSS
FT                   FTFLADNIVNRNFGSWTFPTAWFQSVNSIAIIALAPVIAWIWVKSGRFNPSIPRKFGLG
FT                   LLFNGLAFLLLMFALSSLVNDAGKIPFWTLFMVYVIQSVGELCLSPIGLSMVTKLAPVR
FT                   LVGFGMGGWFLSTGIGNNLSGIFAGHVSGNEGMSVSSALGGYTFGFWALVGAGALLFLI
FT                   APLINKLMHGVK"
FT   gene            539920..540510
FT                   /locus_tag="XAC0450"
FT   CDS_pept        539920..540510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35341"
FT                   /db_xref="GOA:Q8PQ78"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ78"
FT                   /protein_id="AAM35341.1"
FT                   /translation="MPIKPLVCGLLLTGLLSACGQTSSPQDAPKPLDTSMQKPPSADPS
FT                   QPVSSGNTPTAADIAAAAALNAQYDPSRDPAADLETAKVEAKRGGKRIVLNVGNAACEP
FT                   CKALDELMGGDAELRSFRDAHFVVVKVNRDAANENAAFLSAFAQLNDAPSLLVLDSDGK
FT                   LLTTQSGPELRKGEGFDRKKLFDFLKQWAPPQA"
FT   gene            complement(540888..541376)
FT                   /locus_tag="XAC0451"
FT   CDS_pept        complement(540888..541376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0451"
FT                   /product="transcriptional regulator marR/emrR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35342"
FT                   /db_xref="GOA:Q8PQ77"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ77"
FT                   /protein_id="AAM35342.1"
FT                   /translation="MSDLDSSHPPQHPVLLNLEQFLPYRLSVLSNRISSNIAKVYGDRY
FT                   GMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRR
FT                   SMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQVLEKLIDRLAKDGLPRMVSKD"
FT   gene            541545..542615
FT                   /locus_tag="XAC0452"
FT   CDS_pept        541545..542615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0452"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35343"
FT                   /db_xref="GOA:Q8PQ76"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ76"
FT                   /protein_id="AAM35343.1"
FT                   /translation="MQVTTFDNPMGIDGFEFVEFAAPAGQGEQLHDYFRKMGFSAVLRH
FT                   RSRPITVYRQGGVNFLLNEDPDSFAADFAAAHGPCACGFAIRFRTPSETVLQTVLGNGG
FT                   EAVQNKPDTRAVPAPVVKGIGDCMLYLVDRYGEAGSIYDADFEPIDGADQHPAGFGLTF
FT                   IDHLTHNLYFGNMQRWSDYYERLFNFREIRYFDIKGAKTGLVSKAMTAPDGIVRIPLNE
FT                   SSDPKSQINEYLDAYQGEGIQHIACFTDDIYTSVEKMRAAGVSFLDTPDTYFDVVDLRI
FT                   PAHGEDVERLRRNKILIDADPDTKQRKLLQIFTTNCIGPIFFEIIQRKGNEGFGEGNFQ
FT                   ALFESIERDQMKRGVL"
FT   gene            542836..543165
FT                   /locus_tag="XAC0453"
FT   CDS_pept        542836..543165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35344"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ75"
FT                   /protein_id="AAM35344.1"
FT                   /translation="MTDAERAVWRCLRSKQLHGLKFRRQHPIPPYIADFCCIERRLIIE
FT                   LDGSQHDASSDQARSQWLQSQGWTVLRFWNNDVLLSLDAVVETICKMVATPYPHPNPSP
FT                   GGRGA"
FT   gene            543202..544578
FT                   /gene="hmgA"
FT                   /locus_tag="XAC0454"
FT   CDS_pept        543202..544578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="XAC0454"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35345"
FT                   /db_xref="GOA:Q8PQ74"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ74"
FT                   /protein_id="AAM35345.1"
FT                   /translation="MIQRDPNLLLSWRADQHPDAPMHNDQRYMTGFGNEFATEAVAGSL
FT                   PIGQNSPQRVAHGLYAEQLSGTAFTAPRGQNRRSWLYRIRPAAVHGSFSLVEQSHFHND
FT                   FGAGPVPPDQLRWSPLPLPSVPTDFVDGLYTMAGNGGPEAMSGVGVHVYAANASMQDRF
FT                   FYDADGELLLVPQQGRLRVHTELGVLALEPQQIGVIPRGMRFRVELLDAAARGYVCENF
FT                   GGLLRLPDLGPIGANGLANPRDFETPHAAFEQREGTFELVAKFQGHLWRADIGHSPLDV
FT                   VAWHGNYAPYRYDLRRFNTIGSISFDHPDPSIFTVLTSPSDTHGTANMDFAIFPPRWLV
FT                   AQHTFRPPWFHRNVASEFMGLVHGVYDAKAEGFAPGGASLHNCMSGHGPDAATFDKASQ
FT                   ADLTRPDVIADTMAFMFETRAVLRPTQQALSAAHRQADYQQCWSGLRAAFQPPITEDAT
FT                   "
FT   gene            complement(544909..545637)
FT                   /locus_tag="XAC0456"
FT   CDS_pept        complement(544909..545637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ73"
FT                   /protein_id="AAM35346.1"
FT                   /translation="MRSSGPTIWMSSVHSLDVRYSVHSCHRDHVESVRHTVAVMSSALH
FT                   WRASRCWLRRTAAMIPRKTELALTTLQSHRSPLTLLQRRALILADGQRDLATLAMLLGG
FT                   DGTALLHSLCAMGYLDLGTAAGGAAGQARSTAATAALPDVDQAGMPRPDAGPTDEELQR
FT                   LRRRAATNARLYLLDILQLQRNALAAALHRQLHAARDEDQISTTIAEALQALPQITSAS
FT                   YAERVRARIGELLPETLQAA"
FT   gene            545604..546242
FT                   /locus_tag="XAC0455"
FT   CDS_pept        545604..546242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ72"
FT                   /protein_id="AAM35347.1"
FT                   /translation="MTSRLLGLMSALLVLTACNRADQSPAPASADHAPVAAADDQPAAT
FT                   VPPATAPAGTFPPHTQPDPAALARMDGYGDLRFGMDASQARAAWGGDLRGEAATDDGCY
FT                   LLRPQWTSDARLFGFMFEGGQLVRFQTSEPKETAPGGGKVGMNLAQLRALYPDGLTEQP
FT                   HKYIPGALTLRLPGAATQTALVFETDADGKVASWRVGKPPQVDYVEGCG"
FT   gene            complement(546669..547088)
FT                   /locus_tag="XAC0457"
FT   CDS_pept        complement(546669..547088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35348"
FT                   /db_xref="GOA:Q8PQ71"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ71"
FT                   /protein_id="AAM35348.1"
FT                   /translation="MIAFTEYLLSALLLAGTFFILIGAFGLVKLSDFFKRLHAPTKAST
FT                   LGVGCVLLASVGYHLFLGVDPQPRELLITVFLFITAPISAHLMAKAALSLMMEDRPEVP
FT                   NHGDAQQEGLPQVKGDVGENEDTEKQHPGPASEGG"
FT   gene            complement(547085..547357)
FT                   /gene="phaF"
FT                   /locus_tag="XAC0458"
FT   CDS_pept        complement(547085..547357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="XAC0458"
FT                   /product="PhaF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35349"
FT                   /db_xref="GOA:Q8PQ70"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ70"
FT                   /protein_id="AAM35349.1"
FT                   /translation="MFIESTIVICMHAVGLAILMALWRLLRGPTVPDRILALDTLSVTA
FT                   IAELMLLGMYLDSPIYFEAALVIAMLGFGSTVVLSKYVLRRSIVE"
FT   gene            complement(547366..547872)
FT                   /gene="phaE"
FT                   /locus_tag="XAC0459"
FT   CDS_pept        complement(547366..547872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /locus_tag="XAC0459"
FT                   /product="PhaE protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35350"
FT                   /db_xref="GOA:Q8PQ69"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ69"
FT                   /protein_id="AAM35350.1"
FT                   /translation="MNTRLPLRRRVFPSPPLSVTVFVFWLLLSDSFGPQQWVLGMLLGV
FT                   VVPIFAARLDREFAQIGSLRSVPRMLLVAAGDIVRSNIKVAAQVLGPESHIHPGFIWVP
FT                   LDIANIHGIAALTSMITLTPGTVSAALSDDRKYLLVHVLHLDDPEALIAEIKTRYEKPL
FT                   MEIFP"
FT   gene            complement(547869..549413)
FT                   /gene="phaD"
FT                   /locus_tag="XAC0460"
FT   CDS_pept        complement(547869..549413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="XAC0460"
FT                   /product="PhaD protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35351"
FT                   /db_xref="GOA:Q8PQ68"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ68"
FT                   /protein_id="AAM35351.1"
FT                   /translation="MNHLLILPILIPMLGASASLFVEHRRYGPRVQRSVAWVSMALLAA
FT                   AVIALFARAADGEILVYLLGDWPARIGIALLGDRLSAWMLLTTLILGSACLLHACAGWD
FT                   RRAPHFHALFQFQLMGLNGAFLTGDIFNLFVFFEVMLIASYGLLLSGGRGLQMRVGLHY
FT                   VVFNVCASTLFLIALGLLFGVFGTLNMAELSQRIADLPAQDVPLAKATLGLLLLVFCSK
FT                   AALLPLYLWLPETYSRAPAAVAALFAIMTKVGLYATLRVSSLWFGAGAGALHGFGRHAL
FT                   LWLGIATLLMAAFGVMAASRLRVMVSYLVVFSAATLFIAFSLDDAGALGAGLYYLPHSS
FT                   FVAAALFMVSDLIRRRRGSASDRKEVVAPLPGRAIPGTMFMIAAVAVAGLPPLPGFLAK
FT                   AALLQHVPQGLVGPVWGAVLGSSLLVVIGLTRAGVRLFWRVPAAAENAPELQPPRRGRM
FT                   RPVETAATVLLLGGLVAMTGAAGPLMHYTDAAAAQLRDPGAYVDQIRATTPQRRQP"
FT   gene            complement(549410..549784)
FT                   /gene="phaC"
FT                   /locus_tag="XAC0461"
FT   CDS_pept        complement(549410..549784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="XAC0461"
FT                   /product="PhaC protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35352"
FT                   /db_xref="GOA:Q8PQ67"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ67"
FT                   /protein_id="AAM35352.1"
FT                   /translation="MELAVASAIGVLTALAIYLLLRARSFDVILGMTFLSYATNLLIFA
FT                   GGRLRSGQAPVLRDGVPAELMHHSDPLPQALVLTAIVIAFAMTAVSLVLAIRSRSDNGS
FT                   DHVDAHEDAATGTDPRQARR"
FT   gene            complement(549784..552612)
FT                   /gene="ndhF"
FT                   /locus_tag="XAC0462"
FT   CDS_pept        complement(549784..552612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="XAC0462"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35353"
FT                   /db_xref="GOA:Q8PQ66"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ66"
FT                   /protein_id="AAM35353.1"
FT                   /translation="MPFSLEILLALPFVMAAAAALRWRTSRSITAWLAAAAPLAGLVLL
FT                   ALLTPAVLRGEVIASDHAWLPQIGLMLLLRLDGLAWMFALLVLGIGALVVLYAHYYLSA
FT                   RDSASRFFAYLLLFMGAMLGMVLSGNLLLLMVFWELTSISSFLLIGFWSHRKDAREGAR
FT                   MAFVLTAGGGLALLGGVLMIGRIVGSFQLDAVLAAGDVIRASPLYPYALGLVLLGIFTK
FT                   SAQFPFHFWLPHAMAAPTPVSAYLHSATMVKAGVFLLARLHPALAGTDLFFYTVTSIGA
FT                   ITVLLGAWHAIFQHDLKGVLAYSTISHLGLITMLFGLSTPMAVVAGVFHLINHAVFKAS
FT                   LFMAAGIIDHETGTRDMRKLGNLRRLMPVTSALAIIASLAMAGIPLLNGFLSKEMFFAV
FT                   ALDTEAPQLMRILASTAALLAGLLGVAYSLRFVHDTFFGDGPRELDTTPHEPPRWMRIP
FT                   VEVLVLICVAVGIVPAWTVAPVLRAGATAILGDRLPDYSLALWHGVNLPLAMSVAGIVG
FT                   GALLYIALRRTLDLYAIQNRSPGKAMFQWNLRALFAATARMTDAVTNGNLQRMLMLLVL
FT                   SAVVVALVPFLQGGTLPQWPAPMPMPALGWMVWLLMIACALGSLFLYKQRLLAVLVLGG
FT                   TGLAVSLTFVFLSAPDLALTQLLVEMVTLVLMLLAMNYLPERSLPERARLRKIRDAAIA
FT                   IGGGAGLAALAYTLMTQPSHSVAGELLQRALPEAYGRNVVNVILVDFRGFDTFGEITVF
FT                   AIAGLVVHALLRRARMAPERTMPGPPIKLPVPADLAQIMFPLTLTVSLFLFLRGHNAPG
FT                   GGFIAGLVLAVPLLMQYVIQGAASVESRFGFDYIRLIGIGLLCALVSGAGSLVFGLPFL
FT                   SSGHLEIQLPLLGELELASALGFDIGVYLVVFGAAMLMLSMMGTIKPSRTRSSQRGEID
FT                   PTQRSTRTAEQH"
FT   gene            552780..553682
FT                   /locus_tag="XAC0463"
FT   CDS_pept        552780..553682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35354"
FT                   /db_xref="GOA:Q8PQ65"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ65"
FT                   /protein_id="AAM35354.1"
FT                   /translation="MTAANPAPSTAASAPRALVFGGSGQIGERLLTRLLSRGWQVTAWS
FT                   RQPRAARSGLVWRQGDLAVPAAAGEAFEVIFSCGPLDHFARWYAENPVVAPRIVAFGST
FT                   SVEVKEHSIDAAERDVAQRLANAEQALFSAALARGASATVLRPTLVYGAGRDKTLTQIA
FT                   GLAQRTGAFVLPANATGLRQPVHVDDLASAALAVVGQPATQQRSYAVGGGEVLAYTQMV
FT                   ERVLEALPRAARLYQVPPSLFGLALTAAQRLGRLRGLNAAALQRMREDLVFDLEPARRD
FT                   FGYAPRAFRPLPEELGIGE"
FT   gene            complement(553894..554379)
FT                   /locus_tag="XAC0464"
FT   CDS_pept        complement(553894..554379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35355"
FT                   /db_xref="GOA:Q8PQ64"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ64"
FT                   /protein_id="AAM35355.1"
FT                   /translation="MTQSTTTARPIERYFASYSDDHQNATNQQIHVLAVPAILWSVVAL
FT                   LWCIPVGGSWFSSGVWAALSMFAAWSYYNRLSRPLGLGMLGIFFFFGCLCRLIEGRTGL
FT                   GGLFTTALTVFVLAWIAQFVGHKIEGRKPSFLTDLTYLLIGPIWVLAKAYRQLGWRY"
FT   gene            complement(554478..556100)
FT                   /locus_tag="XAC0465"
FT   CDS_pept        complement(554478..556100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0465"
FT                   /product="metalloproteinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35356"
FT                   /db_xref="GOA:Q8PQ63"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ63"
FT                   /protein_id="AAM35356.1"
FT                   /translation="MHVFWRESSCNSMSWARQSAARSRFLLPQTLRICRPMPLCRARNR
FT                   YWGTTHRHWPIAPADAFIARDSIVDADGTEHVRFDRTYQGLPVIGGDVVVHSRRGVMRE
FT                   LSQTMDTTVRPSLLPGIDAATALRVAGSHFDVAQDAAPRASLALYARQGAPRLVYEVIY
FT                   SGVKPDQTPTEMHYIVDAVTQRILESWDTVHTACSGGTSAAGTGRSLYAGSVTVNTTRC
FT                   SSTSYELTDLSRGSGATYNMRNSTSGNGTLVTDADNAWGSGTTGDTVTAAVDAHYGVAL
FT                   TWDYYRTTHSRTGIANDGAGARSRVHYGSRYNNAFWQDSCFCMTFGDGDGSTFTPLVSV
FT                   DVAGHEMTHGVTSRTAALTYSGESGGLNEATSDIMGTMVEYSAANSAEPGNYLIGEKII
FT                   PNNSTGTLALRYMFKPSLDGKSPDCYSSSLGSLNVHYSSGVANHFYYLLAEGAVVPSGF
FT                   GSGTSYNLTATSLVCSGSTALTAIGRVAASRIWYRALTVYMTSSTNYAAARRATLSAAT
FT                   DLYGSTSTQYRAVAAAWSAVSVN"
FT   gene            complement(556504..558273)
FT                   /locus_tag="XAC0466"
FT   CDS_pept        complement(556504..558273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0466"
FT                   /product="lytic enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35357"
FT                   /db_xref="GOA:Q8PQ62"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ62"
FT                   /protein_id="AAM35357.1"
FT                   /translation="MRSYTMATDRETGLLQAAYAAGITRPNELANFMAQVGHESGGLNR
FT                   LEEGFRYTRGSSQVSSKVRSALREGPEALEEARLEALRGQPEKLAELMYGGRMGNNEPG
FT                   DGYLYRGRGYIQLTGKDQYREAGEALKLDLVAHPELAAQPENASRIATWYWQHNVPQAA
FT                   RQDAHAAGVAINGGDPPNGLADRESRFARWQRDLTPDVMHKLEHGQLGQTVAPAQHSAP
FT                   AQTPHAGSNAHSFQATMERMLPPQSGTAPHVTGHYGEHRSARDHGGTDFNYQGGQAGRN
FT                   LQHPTVHSPVAGTVTFAGGSYGTVKIRDAQGNSHEILHLDGVKVKEGQTLSAGDAIGTM
FT                   GGRGPNGASQYAQHVHYQLRDANGKLTSPENFWNQGHQHQAGARHTQAASASGTGAVRH
FT                   GDSSQDVGKLQQDLNRLGVRDAQGNRLAEDGRFGDNTREAVMAFQKQHGLQQDGVVGRD
FT                   TRAALSAQPVQTREAQVAAPKGPSLNDASHPDHALHNAIRSKLPSMISNETAAHVTLQA
FT                   KQNGIDSADKLQNVTVQDGKAFVMGTTPGFRAAVDLNQPAPTLEQTSAQLLAGQSQQQQ
FT                   AQQEQQKVAMGGR"
FT   gene            complement(558331..559128)
FT                   /locus_tag="XAC0467"
FT   CDS_pept        complement(558331..559128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0467"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ61"
FT                   /protein_id="AAM35358.1"
FT                   /translation="MLDLGQGRRPVAVTARATPRHAKTPNQETAVPPFRLLIPILAVAL
FT                   VACNGPQAADAPETPANAPAAAAQPPSPAASPPATPTQGTVPMATIDSFVPAGSKALDT
FT                   QRGDLTGAGHSDALVVISPPATGNEKLGEGQPRRVLLLTQNADGSLQKAAENGRIVPCA
FT                   RCGGLAGDPYAFSRVQPGQFTISISGGSRERWADDFTFKYSADKQTWLLDKVVRDLSDT
FT                   ETEQHNTLELTDKDFGAVTFQDFDPATLKKVAALDEAGAQEQH"
FT   gene            complement(559089..559607)
FT                   /locus_tag="XAC0468"
FT   CDS_pept        complement(559089..559607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ60"
FT                   /protein_id="AAM35359.1"
FT                   /translation="MALLRISLHALALSLALVACKPQAEPAGAAPAATAEAAGAAPAAS
FT                   TPATASATPAPATTCPTADFSAFLKSFSADIAAQEKATADPLTMIRIDPDAQPEPAPVT
FT                   REVALADVKWPVIPNLDVARSAGREVVVSEDAGGRQVLVRTPDSGDQQVYHFVQRPCWT
FT                   LVKVDDQSL"
FT   gene            559744..560478
FT                   /locus_tag="XAC0469"
FT   CDS_pept        559744..560478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35360"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ59"
FT                   /protein_id="AAM35360.1"
FT                   /translation="MTAVTVADCSNGSKARDCRQYRPGTSSRPIAEIVIRRCMGCLEIA
FT                   RWREQLNSVRKYIECVRTHPSLRAIADVLSWCCWVAALATCTLDLLDLPVAISFAQCVV
FT                   LAPCDGARWNCGDVVTPRVLSGAADRLGYAGEKSLIAAIGRKLHIVEITTVDSASCDPF
FT                   AVVASVQVTPVACISAASLALTCNAADALFFAGASGADVGTAWGADSPAVQAFSASARP
FT                   GMIALRKAGDARNKWPNWVIAT"
FT   gene            complement(560690..561622)
FT                   /gene="purC"
FT                   /locus_tag="XAC0470"
FT   CDS_pept        complement(560690..561622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="XAC0470"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35361"
FT                   /db_xref="GOA:Q8PQ58"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ58"
FT                   /protein_id="AAM35361.1"
FT                   /translation="MPVSTTLLQSDLPGLPLRHRGKVRDVFDIPRDRLPADAPPGDYLL
FT                   MVATDRLSAFDVVLPDPIPGKGEMLCQVSNFWFHKTEHLMPNHLVDIRVEQVLPEGVDP
FT                   ALYAKRAVVTRKLKPVPVEAIARGYVIGSGWKDYQRTGKISGIELPDGLRQAEKLPEPI
FT                   FTPSTKAAVGDHDENIDFDAMVKTVGAELAERVRDATLRIYRFAADFAAERGILLADTK
FT                   FEFGTDADGRLYIMDEMLTPDSSRYWPADQYEPGTSPPSYDKQFVRDYLETLDWGKTAP
FT                   GPRLPADVIDRTRAKYAEALQRLAGISVD"
FT   gene            561749..562153
FT                   /locus_tag="XAC0471"
FT   CDS_pept        561749..562153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35362"
FT                   /db_xref="GOA:Q8PQ57"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ57"
FT                   /protein_id="AAM35362.1"
FT                   /translation="MQESSARPGGRSGKIASPPPAPIAPMSWYGKLLGALAGALLFRGA
FT                   PVVGLMIGLAIGHAVDAGWFKRRAENPYEALGLEPDATTAEIDLAYRRLMSRYHPDKVA
FT                   NADPEARRQAEKKASQINAAYDRIQRLRKR"
FT   gene            complement(562293..563717)
FT                   /locus_tag="XAC0473"
FT   CDS_pept        complement(562293..563717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0473"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35363"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ56"
FT                   /protein_id="AAM35363.1"
FT                   /translation="MHVAAGFGVEADGGGTGVGEIRHDAVHRLDHQMHVDRRGDAVLAQ
FT                   RLAHHRADGEVGHVVVVHHVEVHPVGTSLEDVVHFLAQTGEIGGQDGRGDRRRLHGQLG
FT                   KMQERHCRNRGPARKAECRRALGARATGRPPISPQALGPATRSQCAIAHLPAASMALPL
FT                   CNSAPVSAKVHPERTRARTYLTGAPRQMQGDRMKPTPLASAALVLLVLAPSAWAQSGPA
FT                   DWSGLSIGANVGGADPAGVSGGRFGFDTNLDGRDGDQVGTATGADAFSPGFCGGAAAGR
FT                   TPASGCSKDKGGAEYGARLGYDWQAGNWVYGVVAEYTRNDVRDSVSAFSTTPAFYTFTR
FT                   QLNRTAALRGRIGYAFGTQGDYLAYITAGVARGEFDHSFASSNTANSFTSSGGDSADGY
FT                   QAGIGLQRRLSDKVSVGVEYLFTRLQDDDTRVRVGPGTAPATNPFLRVNPAGTDLRRTD
FT                   TDVSTNAVRLTATYRF"
FT   gene            563418..564089
FT                   /gene="rpe"
FT                   /gene_synonym="dod"
FT                   /locus_tag="XAC0472"
FT   CDS_pept        563418..564089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /gene_synonym="dod"
FT                   /locus_tag="XAC0472"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35364"
FT                   /db_xref="GOA:Q8PQ55"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ55"
FT                   /protein_id="AAM35364.1"
FT                   /translation="MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPN
FT                   LTIGPMVCQALRKHGITAPIDVHLMVEPVDRIVPDFANAGATTISFHPEASRHVHRTIQ
FT                   LIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRAIRS
FT                   KIDATGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAPDYAQVIAQMRAAVDAV
FT                   R"
FT   gene            564086..564577
FT                   /locus_tag="XAC0474"
FT   CDS_pept        564086..564577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0474"
FT                   /product="N-acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35365"
FT                   /db_xref="GOA:Q8PQ54"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ54"
FT                   /protein_id="AAM35365.1"
FT                   /translation="MSRPAPQIRSATPADVPLLHELITALAVYEREPDAVKASLEDVRA
FT                   SLFDDGATAHALICEQDGQALGFAVYFFNYSTWLGRNGLYLEDLFVRPEARGKGAGLAL
FT                   LRHLAQLAVQRGCGRFEWSVLDWNQPAIDFYKAVGARPMDGWTVYRLDGERLAAFAAGG
FT                   "
FT   gene            564812..565741
FT                   /locus_tag="XAC0475"
FT   CDS_pept        564812..565741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35366"
FT                   /db_xref="GOA:Q8PQ53"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR022433"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ53"
FT                   /protein_id="AAM35366.1"
FT                   /translation="MAPSHWRLILNGKSTDNLDLREAVGTLRKRGIQLDVRVTWEDGDA
FT                   ERYVGEAVADGVHTVVAAGGDGTLSEVAAALAHHEGDAATLPSLGLVPLGTANDFATAA
FT                   TLPIAPLEALTLIAERVAQPVDLLRIDADHGPHWCANVASGGFGTQVTVETDEGLKKML
FT                   GGLAYLITGMSRLGRIDPISARFSGPEFSWEGEFIALGLGNGRQAGGGQALCPEALIDD
FT                   GLLDVTIVPDLDGEVAATLGTLVTGGKQAALERVAVRARVPWLDIVSQQPLTLNLDGEP
FT                   ETSRHFRIECVPARLRMHLPGECPLLGG"
FT   gene            566310..567785
FT                   /gene="trpE"
FT                   /locus_tag="XAC0476"
FT   CDS_pept        566310..567785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="XAC0476"
FT                   /product="anthranilate synthase component I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35367"
FT                   /db_xref="GOA:Q8PQ52"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ52"
FT                   /protein_id="AAM35367.1"
FT                   /translation="MITAEQFQRQAAEGHTRIPVVREVLSDLDTPLSVYLKLADGAYTY
FT                   LFESVEGGERFGRYSIIGLPARRVYSFRGHTLEVSEHGEVVETREVADPLAEVDALRAE
FT                   HSVPQLDGLPGFTGGLVGWFGFECIQYIEPRLGSGDKPDELGTPDILLMLSEELAVFDN
FT                   LKGRLYLIVHADPRQPQAYVRANRRLDELAHRLRQGGAGYPQAQISDAIDEADFHSSFT
FT                   REEYHAVVRKAQEYVRAGDIFQVVPSQRLRVPFRARPVDVYRALRALNPSPYMYFLDVG
FT                   GTQVVGSSPEILARLRDGVVTVRPIAGTRPRGATPELDKALEAELLADPKERAEHVMLI
FT                   DLGRNDVGRVAEPGTVKVGEQFVIERYSHVMHIVSEVTGTLKAGLNYSDVLRATFPAGT
FT                   VSGAPKIRALEIIRELEPVKRNVYSGAVGYIGWHGDADTAIAIRTAVIQDGYLYVQAGG
FT                   GVVYDSDPDLEWQETMNKGRALFRAVAQAAKGL"
FT   gene            567782..568846
FT                   /locus_tag="XAC0477"
FT   CDS_pept        567782..568846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0477"
FT                   /product="threonine aldolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35368"
FT                   /db_xref="GOA:Q8PQ51"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ51"
FT                   /protein_id="AAM35368.1"
FT                   /translation="MMDGQGSATRISFRNDYSEGAHPRLLQALAQASAEQHAGYGTDRH
FT                   TARAVALIRTAVAQPQADVHLLVGGTQTNLIAISAFLRPHQAVIAVDAAHIATHETGAI
FT                   EATGHKVLTVPALHDKLTPALIQPVLAVHSNEHMVQPRLVYISNSTESGTIYTRAELDA
FT                   LSRFCRANDLLLYLDGARLGAALTADGNDLDLPAIATLTDAFYIGGTKNGALLGEALVI
FT                   VNPALQADLRYLIKQRGALLAKGMVVGAQFAALFEDSLFFELAAHANAMAQRLRAGLLA
FT                   AGAHFTSDSPTNQQFIAVSAQHAAQLVQRYDFERWEVRTDGSQVIRFVTSWATTAASVD
FT                   RLCADVAALHRGVS"
FT   gene            569044..569622
FT                   /gene="trpG"
FT                   /locus_tag="XAC0478"
FT   CDS_pept        569044..569622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="XAC0478"
FT                   /product="anthranilate synthase component II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35369"
FT                   /db_xref="GOA:Q8PQ50"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ50"
FT                   /protein_id="AAM35369.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYLQALGAEVTVVRNDAMSVDQIAALRPE
FT                   RIVISPGPCTPNEAGISLQLIEQLGQTTPILGVCLGHQSIGQVYGGDVIRAGNIMHGKT
FT                   SPIRHQGKGVFAGLPDSYEATRYHSLVVDKTTLPDALEVTAWTENPDGSMEEVMGLRHR
FT                   QFPVEGVQFHPESILTQHGHALLKNFLQR"
FT   gene            569774..570406
FT                   /locus_tag="XAC0479"
FT   CDS_pept        569774..570406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35370"
FT                   /db_xref="GOA:Q8PQ49"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ49"
FT                   /protein_id="AAM35370.1"
FT                   /translation="MSTPDDSIHFYEPRQGHGLPHDPFNAIVGPRPIGWIGSRSVEGIA
FT                   NLAPYSFFNAFNYIPPIVGFATIGRKDSVRNIEATGEFTWNLATRPLAEAMNASAAMVP
FT                   AEVDEFDLAGLQVAPSRLIGAPRVAASPVSFECRLSQLLPLQTAAGHAIETWLVLGEVV
FT                   GVHLVRSALHEGIYDPAAVQTILRAGGPADYYEVQPQARFRMTRPGQ"
FT   gene            570522..571559
FT                   /gene="trpD"
FT                   /locus_tag="XAC0480"
FT   CDS_pept        570522..571559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="XAC0480"
FT                   /product="anthranilate synthase component II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35371"
FT                   /db_xref="GOA:Q8PQ48"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ48"
FT                   /protein_id="AAM35371.1"
FT                   /translation="MPITPQEALQRTIEHREIFHDEMVELMRQIMRGEVSDMMVAAILT
FT                   GLRVKKETIGEIAGAATVMREFSRRVDVADRQHMVDIVGTGGDGSHTFNISTCAMFVAA
FT                   AGGAKVAKHGNRSVSSKSGSADALEALGAVIELQPEQVASALAHTGIGFMYAPVHHPAM
FT                   KVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVV
FT                   WGRDGMDELSLGAGTLVGELRDGQVREYEVHPEDFGIAMSASRNLKVADAAQSRAMLLQ
FT                   VLDNVPGPALDIVALNAGAALYVAGVADSIADGVLRARAVIADGSARARLDAYVVYTRQ
FT                   LAVQP"
FT   gene            571700..572497
FT                   /gene="trpC"
FT                   /locus_tag="XAC0481"
FT   CDS_pept        571700..572497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="XAC0481"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35372"
FT                   /db_xref="GOA:Q8PQ47"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ47"
FT                   /protein_id="AAM35372.1"
FT                   /translation="MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAM
FT                   QASIAAGDPAVIAEVKKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFFQGSD
FT                   AYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQL
FT                   GLDVLVEVHDIDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRSAVPRDRVLVTES
FT                   GIVTQADVQRMRSHDVNAFLVGETFMRAAEPGESLRQLFFAHD"
FT   gene            572490..573206
FT                   /locus_tag="XAC0482"
FT   CDS_pept        572490..573206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35373"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ46"
FT                   /protein_id="AAM35373.1"
FT                   /translation="MTESYPVPREDAPLVVFDFDHTLYDGDSGSHLFAWLIKRNPLRLL
FT                   VALLASPILGPMVAMLPTRRRGVSGYVWIATFGLHRAREFNRFIDAYVLKHEAQIRQRL
FT                   LPHALQVFTQHRAAGDRVVVATGAPPELARAILGFVAHQDVPVIGSLVGPRLGAVTARR
FT                   HCHNEEKMRMLRERGYADIAIAYSDSTADLPLLKAARAPVVVNPKANREALFRQVLPTG
FT                   TPILNWGCRDRGGKAL"
FT   gene            complement(573528..574220)
FT                   /gene="clp"
FT                   /locus_tag="XAC0483"
FT   CDS_pept        complement(573528..574220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clp"
FT                   /locus_tag="XAC0483"
FT                   /product="CAP-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35374"
FT                   /db_xref="GOA:Q8PQ45"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ45"
FT                   /protein_id="AAM35374.1"
FT                   /translation="MSPGNTTVVTTTVRNATPSLALDAGTIERFLAHSHRRRYPTRTDV
FT                   FRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRT
FT                   RTQCELAEISYERLQQLFQTSLSPDAPKILYAIGVQLSKRLLDTTRKASRLAFLDVTDR
FT                   IVRTLHDLAKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGK
FT                   TVVLYGTR"
FT   gene            574358..575152
FT                   /gene="speD"
FT                   /locus_tag="XAC0484"
FT   CDS_pept        574358..575152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="XAC0484"
FT                   /product="S-adenosyl methionine decarboxylase proenzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35375"
FT                   /db_xref="GOA:Q8PQ44"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ44"
FT                   /protein_id="AAM35375.1"
FT                   /translation="MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDE
FT                   QYDADRLTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVIDKKQAGKELISD
FT                   AVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPLKALNYLIESLESDIVI
FT                   MDYRVRGFTRDVKGKKHYIDHKINSIQQFLAKNVKSRYEMFDVNVYQENIFHTKMHLKD
FT                   FDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE"
FT   gene            575289..575603
FT                   /gene="sugE"
FT                   /locus_tag="XAC0485"
FT   CDS_pept        575289..575603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="XAC0485"
FT                   /product="SugE protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35376"
FT                   /db_xref="GOA:Q8PQ43"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ43"
FT                   /protein_id="AAM35376.1"
FT                   /translation="MPWIHLLLAGLFEIGFAMGLKYSDGFTRLWPTVLTIGLAGISLWF
FT                   LTQALKTIPVGTGYAIWTGIGALGVTIAGIALFGDSASWSRLACIGLIVAGVIGLKLVG
FT                   "
FT   gene            complement(575797..576450)
FT                   /locus_tag="XAC0486"
FT   CDS_pept        complement(575797..576450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0486"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35377"
FT                   /db_xref="GOA:Q8PQ42"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ42"
FT                   /protein_id="AAM35377.1"
FT                   /translation="MTQISPTRLHSPLDRLLVEAQRALDTVFGNPPAERPNPAADTPDV
FT                   VLDPEQRLHAAGLMRINHVGEVCAQGLYFGQAAVARDAHTRHHLLEAAQEETDHLAWCA
FT                   DRLHELDSRPSLFNPVWYAGSYALGALAGLRGDDWSLGFVVETERQVEAHLDEHLETLP
FT                   QSDQRSRAILRVMKIDEARHADQAEQAGARPLPAPIPSAMALASKLMKTVAYRL"
FT   gene            576634..577062
FT                   /gene="rplM"
FT                   /locus_tag="XAC0487"
FT   CDS_pept        576634..577062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="XAC0487"
FT                   /product="50S ribosomal protein L13"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35378"
FT                   /db_xref="GOA:Q8NL21"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NL21"
FT                   /protein_id="AAM35378.1"
FT                   /translation="MTTFTAKSETVQRDWYLVDAAGKTLGRLSTELARRLRGKHKPVYT
FT                   PHVDTGDYLVVINAEKIVVTGNKLKDKKYHRFTGYIGNLKTESLEQALQRHPERVIEIA
FT                   VKGMLPKGPLGRTMYRKLKVYSGAEHPHAAQQPQVLDI"
FT   gene            577065..577457
FT                   /gene="rpsI"
FT                   /locus_tag="XAC0488"
FT   CDS_pept        577065..577457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="XAC0488"
FT                   /product="30S ribosomal protein S9"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35379"
FT                   /db_xref="GOA:Q8PQ41"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ41"
FT                   /protein_id="AAM35379.1"
FT                   /translation="MAITQNYGTGRRKSSTARVFLRKGTGNITVNDRPLDEFFGRETAR
FT                   MIVRQPLELTKNTESFDIMVTASGGGTTGQAGAIRLGIARALVEYDETLKSELRKAGFM
FT                   TRDAREVERKKVGLHKARRATQFSKR"
FT   gene            complement(577683..577757)
FT                   /locus_tag="XAC0489"
FT   tRNA            complement(577683..577757)
FT                   /locus_tag="XAC0489"
FT                   /product="tRNA-Gln"
FT                   /note="Found by tRNAscan"
FT   gene            complement(577810..577886)
FT                   /locus_tag="XAC0490"
FT   tRNA            complement(577810..577886)
FT                   /locus_tag="XAC0490"
FT                   /product="tRNA-Met"
FT                   /note="Found by tRNAscan"
FT   gene            578005..578622
FT                   /gene="nudH"
FT                   /locus_tag="XAC0491"
FT   CDS_pept        578005..578622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="XAC0491"
FT                   /product="probable (di)nucleoside polyphosphate hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35380"
FT                   /db_xref="GOA:Q8PQ40"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ40"
FT                   /protein_id="AAM35380.1"
FT                   /translation="MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDET
FT                   PVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQF
FT                   TGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQSLAGPAA
FT                   VGAMPERALEAWLPGSSAAGHDSPRKRPRKRNGARAMRINND"
FT   gene            578703..578912
FT                   /locus_tag="XAC0492"
FT   CDS_pept        578703..578912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0492"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35381"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ39"
FT                   /protein_id="AAM35381.1"
FT                   /translation="MYVCICNGVTDHQIREAAENGCVSLAELTMRTGCGSNCGSCLEMA
FT                   GDLLSQAHANRALPLPLLGLASAA"
FT   gene            579235..579705
FT                   /gene="bfr"
FT                   /locus_tag="XAC0493"
FT   CDS_pept        579235..579705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="XAC0493"
FT                   /product="bacterioferritin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35382"
FT                   /db_xref="GOA:Q8PQ38"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ38"
FT                   /protein_id="AAM35382.1"
FT                   /translation="MKGDTKVIEYLNKVLYNELTAINQYFLHAKMLKNWGLKELAEHEY
FT                   KESIDEMKHADKLSDRILFLEGLPNFQALGKLRIGENPTEMFRCDLILEREAVVVLREA
FT                   VAYAETVKDYVSRQLLVDILESEEEHIDWLETQLDLVARIGEPNYLLTKLDD"
FT   gene            complement(580031..582340)
FT                   /locus_tag="XAC0494"
FT   CDS_pept        complement(580031..582340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0494"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35383"
FT                   /db_xref="GOA:Q8PQ37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ37"
FT                   /protein_id="AAM35383.1"
FT                   /translation="MRERAAGLRAWSILAVLAALAAALGAGLQWSSLQGPWRAVSAVSA
FT                   ALAVVCGLCAAFAAHRAAHAQHALAQRLEEADLARERLQQELRRHGELEQELLRAKQAA
FT                   EAATLAKGEFLATMSHEIRTPLNGIIPMLELISSGQLSLDQRDMLQTATGSSLQLLRIV
FT                   DDILDYSKLEANKLELEITTFNLRELLDGVIQLLQRTAEGRQLRLSLDIEPSVRLLVRG
FT                   DPIRLRQVLGNLIGNAIKFTERGSVDIQLRRLGETRAQHLLRFQVRDTGIGIAPDQQAR
FT                   LFRSFAQADASTTRLYGGTGLGLAICKRIIDLMGGRIGVESEPGRGSTFWFEIPLLKVI
FT                   GDLQQATGADAARVMVISSDARLSQRLKRLLDSWGVSHVLMETTQEALERVRRHSDGEG
FT                   FRCVIADHDTLRYSARAVHRALARPENASSARLIWLYGEEPVPAELQDHATLVPRLSPD
FT                   ETLRALVLPPEPKPAHATTLASAMIPEPLPPPMANAREVRILLVEDNPVNLLVAQKLLA
FT                   VLGFEADTATDGEAALARMESTRYDMVFMDCQMPVLDGYAATRRWRAMETESGGRPVPI
FT                   VAMTANAMAGDRERCLAAGMDDYLSKPVAREQLDACLQRWLPRQALLPGPSPAGQATHD
FT                   PESASAAAQARALPILDNSVIDELYEVAGADTITILQLFLEDAPLIIEQLEAAAANRDS
FT                   MQLRDLSHTLKSSSANVGAQAVSNAARRIELAARTGTIERPSVMVALVIAEYARARLAL
FT                   LGQVARLQADASTTNH"
FT   gene            complement(582341..584095)
FT                   /locus_tag="XAC0495"
FT   CDS_pept        complement(582341..584095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0495"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35384"
FT                   /db_xref="GOA:Q8PQ36"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ36"
FT                   /protein_id="AAM35384.1"
FT                   /translation="MAASSSARVAAATAPTASPTSAAPAAPHDGEDNVAADAPYRVLIV
FT                   EDDRSQALFAQSVLHGAGMHAQVEMTAASVPQAIQDYHPDLILMDLHMPELDGIRLTTL
FT                   IRQQPGQQLLPIVFLTGDPDPERQFEVLDSGADDFLTKPIRPRHLIAAVSNRIRRARQQ
FT                   ALQQAGEQVSVRSNPETGLPTRGHVMDLLADALERKQSGGLFFIEIASALGLRERYGYA
FT                   AYERLMTQAGHRLASAAQPYPLARLNDNSFLLLAVDMPEASLEQQALEIRQRLSANAFP
FT                   VREEESVHVRCAIGVAPLGLGFDDTGSALEAVERTALQARLRSDGVQTYLAPSQAEQQE
FT                   QLRLVEGQLELAYQPIVAVAGGDTAQYQVLLRLRQADGTLLSAGQVIPAAEAAGRIADL
FT                   DQQVMDHALGLLHLYQHASPPLRLFVSQSPRTLARDAFADWLLKALVERGVAGQSLIVD
FT                   LRLDDALIHAVTVQQFCAKLMPAGVQFCLSQFEPGDEANALLAQLPLSFVRMANRFADA
FT                   HGNAAVRDELRGVIDIAHQRGLLIIGQRIEDPQAAAAMWMSGVDFIQGNLVQTVGKELD
FT                   FDFTSAVL"
FT   gene            complement(584356..585003)
FT                   /locus_tag="XAC0496"
FT   CDS_pept        complement(584356..585003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35385"
FT                   /db_xref="GOA:Q8PQ35"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ35"
FT                   /protein_id="AAM35385.1"
FT                   /translation="MFAGNHAMSEAHLFVIGILLAWLAGIRVYLTVFGVGLAGLLGWID
FT                   LPPALHPAQSWWVLGTSGALAVAEFIADKIPGVDSGWDLLQTLARVPAGAFLAAATLSP
FT                   DGDLGAGALAAGAGVALTSHTLKAGTRALLNTSPEPASNWIASLAEDTIATTALALALA
FT                   HPWLALGLAVGSSLMAGLVVWWVWRLLWRGMRRLVAPIRPAATPTARSSPLP"
FT   gene            585276..585860
FT                   /locus_tag="XAC0497"
FT   CDS_pept        585276..585860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35386"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ34"
FT                   /protein_id="AAM35386.1"
FT                   /translation="MKAEAALQQAQRSQVQQRRQIEQLQQRQVNLAMSDKISRAANTEV
FT                   QASLAERDEQIAALRADVAFYERLVGSTAQRKGLNAHSVQFTAEAGGTWNYSVVLTQNL
FT                   NRGAISQGQLRFAVEGVRAGKLVTVSWNELHQKPDAAGQPYSFRYFQQLDGSVILPKDF
FT                   TPQRVKISLSGDGAPVSQTFDWKVAGNGAGE"
FT   gene            585864..586313
FT                   /locus_tag="XAC0498"
FT   CDS_pept        585864..586313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35387"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ33"
FT                   /protein_id="AAM35387.1"
FT                   /translation="MFGNKSNRGAQTVVDTLIGPQVVIRGDLTFSGGLYVEGRILGKVI
FT                   AEDGASATLTVAEQGSIEGEVRAPVVIINGQLTGDVHAAERVELAANARVQGNVHYQVV
FT                   EMSAGAQLTGRLIHATTAGATAALPAPEPSRAEPVTALQAETADA"
FT   gene            586397..586783
FT                   /locus_tag="XAC0499"
FT   CDS_pept        586397..586783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35388"
FT                   /db_xref="GOA:Q8PQ32"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ32"
FT                   /protein_id="AAM35388.1"
FT                   /translation="MSTLVSLPTAAPAPDYQSIDRPLNFSVAAAAKVRELIQEEGNADL
FT                   ALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDGVTLLVDPLSLQYLMGAEVDYTESL
FT                   TGAQFVIRNPNAKTTCGCGSSFSV"
FT   gene            complement(587135..587632)
FT                   /locus_tag="XAC0500"
FT   CDS_pept        complement(587135..587632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0500"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35389"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ31"
FT                   /protein_id="AAM35389.1"
FT                   /translation="MVTARRLGIDTRHGRRVSTVSHMTAVDQRGQAAVPGENAHIVAPA
FT                   EARTQYGHLDPCTIAHARSWRARRETCSAESVVARHARVQVAGLAGATQAIRCVPAHHR
FT                   QPATRCIPVVALKIAATPRAAQALSTRRVDRCLRVTTWRAAVTVLKDCRRIAQRGSTHT
FT                   PA"
FT   gene            587832..588989
FT                   /locus_tag="XAC0501"
FT   CDS_pept        587832..588989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35390"
FT                   /db_xref="GOA:Q8PQ30"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ30"
FT                   /protein_id="AAM35390.1"
FT                   /translation="MLTSNFLTSYTRDAIGAMLASEPQAEQPRCNVRVAEFTYATVGVE
FT                   GEPATASGVLLIPDGERCAGPYPLLGWGRPTGTVRAEEQAKDIRDAKGNDPLVTRLASQ
FT                   GYVVVSSDYLGFGPSNYPYHPYLHSATEASATIDAMRAARSVLQRLNTPLSGKVMLSGY
FT                   SQGGHTAMATQREIEAHLSKEFQLVASAPISGPYALQQTFLDSWSGSNAVGESSFGIIL
FT                   GSYAIVAMQHTYKNIYLEPGQVFQDPWAAKVEPLFPGKQSLTDLFLGDTLPGIDRLKAY
FT                   FQPGFYRDFASNPANPFRQDLARNDLLAWAPQTPTLLCGSSNDATIPLKNAQTAIASFK
FT                   RRGSNQVAVVDIGTGNSSDNSAFVHLLTNEPCIVAVRHQLLDKQR"
FT   gene            complement(589326..590540)
FT                   /locus_tag="XAC0502"
FT   CDS_pept        complement(589326..590540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0502"
FT                   /product="ISxac1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35391"
FT                   /db_xref="GOA:Q9Z3E5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z3E5"
FT                   /protein_id="AAM35391.1"
FT                   /translation="MRASEVLQKCLSNSLSGMHALRQRTLLGAVEALVHGGRLTLIDIA
FT                   RAWPGATRVRAPLKACDRLLCNRTLQAERSMIERDMAHWLLRGDQPVIVIDWSDLKPDK
FT                   SWCLLRAAVPIGGRTLTLLDMVVAGKQQGSPGAEKRFLQQLRRMIPDDVRPILVTDAGF
FT                   RTPWFRAVSAMGWDWVGRLRGRTQVKPQDVPDDAAQWIDSRRLHALASNRACELPPMQA
FT                   NRSDPLDCRLVLYAKTRLGRQQRNRRSPAKVSRASSSLKAAAREREPWLIVASPQLQAP
FT                   SAKHLVNLYARRMQIELAFRDLKSHRYGQAMEDSLTRRGERLQILLLLNTLATFASWLA
FT                   GLGCEATGIAQWLSPRSSTRKLYSTLRVGRQALARRWPMEPVSRWLERLRTLPEAVREQ
FT                   MTLVL"
FT   gene            590657..591547
FT                   /gene="nudC"
FT                   /locus_tag="XAC0503"
FT   CDS_pept        590657..591547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="XAC0503"
FT                   /product="NADH pyrophosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35392"
FT                   /db_xref="GOA:Q8PQ29"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ29"
FT                   /protein_id="AAM35392.1"
FT                   /translation="MSESLFSASGFAFTHAPLDRGDVLRDDPDALARLWPQGRVLLIDA
FT                   KGTALADADGQPLLLDGAELGDGPEAAIFLGLRDAVGWFCLPADIVAVQAPQRIDLRQA
FT                   AADWPAEIATAFAYARAMLHWQSRTRFCGVCGGAIAFRRAGFIAHCTQCQTEHYPRVDP
FT                   AIIVAVSDGARLLLGRQASWAPGRYSVIAGFVEPGESLEQTVVREVYEETRVHVQDCRY
FT                   LGAQPWPFPGALMLGFTARAAATEVPQVTGELEDARWVSHAQVSAALAGEGDIGLPPRI
FT                   SIARALIEHWHRAHG"
FT   gene            591621..592511
FT                   /gene="ampE"
FT                   /locus_tag="XAC0504"
FT   CDS_pept        591621..592511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="XAC0504"
FT                   /product="transmembrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35393"
FT                   /db_xref="GOA:Q8PQ28"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ28"
FT                   /protein_id="AAM35393.1"
FT                   /translation="MFTTLVAVVVALTLGHLVPAQVARLRNFAWFGQWLRRLDSYAAGR
FT                   GAWQGRYGVLLAVLPALLVLLVQWLLDDVWHGFLGLLFGVAVLAWTWGPRDLDRDVEAV
FT                   IDADEPRTRREAVSHLQAAGGSVHEDAPSLVEAVVVNGLRRWFAVLWWFLLLGPFGAVL
FT                   YRLTALAVESPLAVLLPPRNLAGARWLLAVLEWPVAQLMTMSMALVGNFDTVFRAWRQA
FT                   HGNRWSLEPHFLGAVARASVSAELREEAHDYTDSGLVPVWRRLPEVRDAMSLVWRVLLL
FT                   WLVVLALLVIAGWVR"
FT   gene            complement(592591..593001)
FT                   /locus_tag="XAC0505"
FT   CDS_pept        complement(592591..593001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35394"
FT                   /db_xref="GOA:Q8PQ27"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ27"
FT                   /protein_id="AAM35394.1"
FT                   /translation="MELRPRHWLGLGAATSVAALGVSLLYRFDPNASNSPFPPCVFRAV
FT                   TGCYCPGCGMTRALYALVHFDLPGAFAMNPAAVLGLFILPGLIAWKAGWRARWFSPVVA
FT                   VMSEPKFWLWALPAYWIARNLPWYPFTLLAPG"
FT   gene            complement(593001..593336)
FT                   /locus_tag="XAC0506"
FT   CDS_pept        complement(593001..593336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0506"
FT                   /product="transmembrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35395"
FT                   /db_xref="GOA:Q8PQ26"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ26"
FT                   /protein_id="AAM35395.1"
FT                   /translation="MPPPIHPSSSAAPGPVPNHLIWAIVSTVLGFCLCCPALISGIVAI
FT                   VFSSKVNGLLNQGDIDGARRASNTAKTWCIVTSVLAAIGLLINIGMVATGGMQGYMDYM
FT                   QQLQHMQ"
FT   gene            complement(593817..595739)
FT                   /gene="aas"
FT                   /locus_tag="XAC0507"
FT   CDS_pept        complement(593817..595739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="XAC0507"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35396"
FT                   /db_xref="GOA:Q8PQ25"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ25"
FT                   /protein_id="AAM35396.1"
FT                   /translation="MSGHSQFALLRQRRFLPFFAVQALGAFNDNVYRQAIIGLLFYLGI
FT                   DAAQRTLYTNLAPALFILPYFLFSALAGQIAEKLEKQKLIVITTTMEIAIMSLAAVGFI
FT                   TENMVILLIALFCTGLQSTLFGPVKYSILPSVLKPEELTGGNGLVEMGTSISILCGMIF
FT                   GGLIFQIAGSHGPEAAATAVIAIAVTGNLVARLVPRVDAGAPELKINWNPIPESRAIMR
FT                   LTRRTLAVRNAVLGVSWFWFIGTVLTAQLPTYAQLNLGGQQDLYVFALALFSIGTGAGS
FT                   LLCERLSGRTVEIGLVPLGAFGISAFLLDLYFARPGAAPVTGLSIGQFVQQPGSVRLII
FT                   DLVGIGLFTGLFVVPLFALIQSRTPKAELSRVIAGLNIQNALFIVAAAVIGIALQLPHV
FT                   VLFGARIPLPGLSIPQVFLALAIANTLVALWIFTLVPEFLMRFLSWVLVSVLYRLRARA
FT                   IDTHVPDEGAALLVCNHVSYMDALILSAVIPRPVRFVMYYKIFRIPVMRWIFRTAKAIP
FT                   IAGAREDPALMQQAFDRIDAALADGELVCIFPEGALTKDGDIAPFKSGVEKILQRRNVP
FT                   VIPMALRGMWSSMWSRRDTRLGRMRVPRRMRAQIDVVAGAAVVGDQASAALLEQQVRTL
FT                   RQDQP"
FT   gene            complement(595808..596710)
FT                   /locus_tag="XAC0508"
FT   CDS_pept        complement(595808..596710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0508"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35397"
FT                   /db_xref="GOA:Q8PQ24"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ24"
FT                   /protein_id="AAM35397.1"
FT                   /translation="MLTLRQLEFAVAVAEEGGFTAAARRCNTVQSALSHQVAKIEETFG
FT                   ARLFERGTRRVRPTAAGEVLLHNARQTLRAAERLHEEMAQALGTVRGRLALGQISSLTT
FT                   VQLPALLHQFRSAHARVDVHLRTAMSEALLHDLGEGRLDVALVGVGPQLAVPAQRLLLH
FT                   EEALALIVAPGHRLAARKRVALAELDDEPMAGLVPGAGVRGIIDAAFAQSGLRQRQQYE
FT                   VTHADLVRELVAANLGVGIVPQTMAGAMRGVITVALKERYRFLTYAVWRPDPSPAARAF
FT                   VALLRAQLAQRRPPAQRSR"
FT   gene            596808..597998
FT                   /locus_tag="XAC0509"
FT   CDS_pept        596808..597998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0509"
FT                   /product="MFS transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35398"
FT                   /db_xref="GOA:Q8PQ23"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ23"
FT                   /protein_id="AAM35398.1"
FT                   /translation="MQTEPTSHPPLPRRLVLLMAAATGLAVASNYYAQPLLETLAQAFG
FT                   IQVRSAGAVVTAAQLAYAAGLLLLVPLGDRLERRGLIVGLFVLSALGLLVSASSHSFAM
FT                   LLAGTIVTGASSVAAQILVPFAATLAAPHERGRVIGTVMSGLLLGILLARTAAGVLAGV
FT                   GGWHTVYWIASVALLLTAGLLWRGLPRHPGNAQLAYPRLVGSVLTLLRDDAVLRSRAVL
FT                   GGLIFAGFSMFWTTLAFLLSGPSYGYGTAVIGLFGLIGAAGALAANRSGHWSDHGHGDR
FT                   VSWGGLAMLLLSWGLLAFAPQSIVLLIVGVLLLDIAVQGVHIANQSVIYQRNPAARNRI
FT                   TSAYITCYFIGGAVGSTLGTAAYAQAGWMGVVIGGAVLAAAALGWVGLSVARKQWK"
FT   gene            complement(598191..600404)
FT                   /locus_tag="XAC0510"
FT   CDS_pept        complement(598191..600404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35399"
FT                   /db_xref="GOA:Q8PQ22"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ22"
FT                   /protein_id="AAM35399.1"
FT                   /translation="MATPSFETRLSRLWAHEKASYGLRVFIALAVAMGVCWHWQQLTAV
FT                   PALFLGAIASAIAETDDNWLGRIKSVLLSLLCFAAAAAAVVVLFPYPLPFVLGMALATF
FT                   SLTLLGALGERYASIAQATVALSIYAMIGMDQHGSRDPLIAWHGAALLLIGATWYGVLS
FT                   ILWTILFANRPVRERLSRLFFELGRYLKLKADLFEPVRQSDLHARRLALAEQNAKVVGA
FT                   LNAAKTAIMSRFGRSGRPGVQSGLYFRLYYMAQDFHERASSSHYPYEALTDAFFHSDVL
FT                   YRCQRLLALQGKACAALGEAIRLRHPFDYGDSSRLATEDLRQSLDYLHARADPALARLL
FT                   GALELLVTNLQSIERRLSEAAQSDSTSDNLDTRLRDSSPHTLREMGARLVQQLTPGSVL
FT                   FRHGLRMAIALLVGYAIMQSIHADNGYWILLTTAFVCRPNYGATRLRLVQRIAGTLIGL
FT                   VATWALMQLFPGTEVQLLLALAGALVFFITRTDRYMLATAGITVMALFCFNLLGDGFVL
FT                   IWPRLIDTLIGCAIAAAASFLILPDWQGRRLNQVMATVLASCARYLAQVLEQYASGKRD
FT                   DLPYRIARRDMHNADAALSVALSNMLREPGRYRRNLDAGFRFLALSNTLLGYLSALGAH
FT                   RAALEGEHDATIAQAGEYLQRALSEIASALGQRQPLPTHDESEELAIAEELEHHPVQLP
FT                   PKQRLVRDQLALTLRLLPKLRAAALAVTTAPAENAPRLATTKA"
FT   gene            complement(600921..602216)
FT                   /gene="purD"
FT                   /locus_tag="XAC0511"
FT   CDS_pept        complement(600921..602216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="XAC0511"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35400"
FT                   /db_xref="GOA:Q8PQ21"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ21"
FT                   /protein_id="AAM35400.1"
FT                   /translation="MKILVIGSGGREHALAWKIAQSARVSEVLVAPGNAGTATEAKCRN
FT                   VAIKVDDLDGLLALAQREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGS
FT                   KAFAKDFLARHGIPTAYYAVHTEVDAALAYVREKGTPIVVKADGLAAGKGVIVALTLAE
FT                   AEDAVRDMLSGNAFGDAGARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTPEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGA
FT                   PKVIEFNVRFGDPETQPVMLRLQSDLVDLLEAAIDGKLDGAHAQWDPRPSLGVVIAARP
FT                   YPDTPVTGEVIAGLDAVPASAKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVQDAQRT
FT                   AYAGLKPIHWSSAFQRSDIGWRAIARERQAQG"
FT   gene            complement(602250..603095)
FT                   /locus_tag="XAC0512"
FT   CDS_pept        complement(602250..603095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0512"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ20"
FT                   /protein_id="AAM35401.1"
FT                   /translation="MQRLRCFAACLATVVLLGACKQAPAPAAAPGAAAPAAPSDGPHLS
FT                   RTERLDGFLRTRYGAKAGLAAQWSGEADGFKADSEVCAEQPVVVGDQVQQLLAVCHSLS
FT                   DAGHGNPGLIDFFVLRGDGDGFKVVVERLADGYGSDGQPGSVDVLRLGSDFYGFAVHSF
FT                   WMGQGLMLESQDLVVPGPKGLVNAGSLRAHIDNSGALACDDDAREPDQTQAQCLADAFD
FT                   VDFALEVDNSAPQARTWPLRIHEHGSDCGVALDKTHVFALDTKTWTYPFPNALQREGCR
FT                   "
FT   gene            complement(603120..604703)
FT                   /gene="purH"
FT                   /locus_tag="XAC0513"
FT   CDS_pept        complement(603120..604703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="XAC0513"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35402"
FT                   /db_xref="GOA:Q8PQ19"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ19"
FT                   /protein_id="AAM35402.1"
FT                   /translation="MASDFLPVRRALLSVSDKTGLIDLARALVARNVELLSTGGTAKAI
FT                   REAGLPVKDVAELTGFPEMMDGRVKTLHPLVHGGLLGRAGVDEAVMAEHGIVPIDLLVL
FT                   NLYPFESVTVKADCTLADAVENIDIGGPAMLRSAAKNFARVAVAADPAQYADLLVELEA
FT                   NDGQLSAAKRFALSVAAFNRVAQYDAAISNYLSAVADSAEAVPTRSPFPAQINSNFVKV
FT                   MDLRYGENPHQSGAFYRDLYPVPGTLATFQQLQGKELSYNNLADADAAWECVRQFDAPA
FT                   CVIVKHANPCGVAVGAGCGDAYELAYATDPTSAFGGILAFNKTLDAATAKAILDRQFVE
FT                   VLIAPDYEAGALEYATKKANVRVLKIPHGNGLNNYDTKRIGSGLLMQSADNRGMSQGEL
FT                   SVVTQRAPNEAELGDLLFAWRVAKYVKSNAIVYAKDNRTIGVGAGQMSRVVSAKIAALK
FT                   AEEAKLTVAGSVMASDAFFPFRDGIDAAAAAGIKAVIQPGGSMRDGEVIAAADEHGIAM
FT                   VFTGVRHFRH"
FT   gene            604777..605394
FT                   /gene="pgsA"
FT                   /locus_tag="XAC0514"
FT   CDS_pept        604777..605394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="XAC0514"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35403"
FT                   /db_xref="GOA:Q8PQ18"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ18"
FT                   /protein_id="AAM35403.1"
FT                   /translation="MASIYALKGRFQALLRPMVGALYRGGITANQVTLIAAAVSLMVAA
FT                   VVLRGGPSRPLLYLLLPVWMLVRMALNAVDGMLAREFGQQSRLGAYLNELCDVVADAAL
FT                   YLSLLGVPGVSAPWLWIFALLAALTEYAGVLGLMVGASRRYDGPMGKSDRALVIGVLGV
FT                   GLACGLLGARGVTWVAIALSLACMATVWRRVRAGLAEAPAGT"
FT   gene            605480..607240
FT                   /locus_tag="XAC0515"
FT   CDS_pept        605480..607240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35404"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR022744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ17"
FT                   /protein_id="AAM35404.1"
FT                   /translation="MRTVLEREFVSFDGVPLFYRHWPLHDAVATGTPRAVVLLHRGHEH
FT                   SGRVMHLAEELDMPDAQFFAWDARGNGRSPGVRGDAPGFEALVRDLDSFIAHLRATHGI
FT                   AVQDIVVIAQSVGAVVAATWVHDYAPPLRALVLASPAFKVKLYVPFARAGLALLHALRG
FT                   NFFVNSYVKPQWLTHDPARVESYRTDPLITRPISVRVLLGLYAAADRVVDDAQAITVPT
FT                   QLLVSGADVVVHRGPQDRFYENLRSPIKQRHWLPGFFHDTLGERDRAIAIAHIRQFVQV
FT                   RFAQPPVRAALRNAHRAGPSFEEAERLAWPPQRNSLQDLRWRGVRAGLRLGGKLSEGIA
FT                   LGLQTGFDSGSTLDYIYRNQAHGRGPLGRMIDRTYLNAIGWRGIRIRGSHLGELLREAA
FT                   ARLRGAGKPVRVLDIAAGHGRYVLQALGSGAQRADAIVLRDFSPPNVTQGTALIQALGA
FT                   GDIARFEQGDAFDPAALASVQPAPTLAVVSGLYELFADNDQVARSLAGLAAAVQPGGYL
FT                   LYTGQPWHPQLEFIARALTSHRDGVAWVMRRRSQQEMDGLVEAAGFRKVAQRIDAFGIF
FT                   TVSMAQRVDA"
FT   gene            607237..608574
FT                   /locus_tag="XAC0516"
FT   CDS_pept        607237..608574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35405"
FT                   /db_xref="GOA:Q8PQ16"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ16"
FT                   /protein_id="AAM35405.1"
FT                   /translation="MSRAARPVGRAALWLALLGPFFFLSYGLANTLAGRATQVPSVVFG
FT                   WEHGMPFWPWTIVPYWSIDACYAVSFFVCRNRRELDTHALRLLSAQLICVACFLLWPLR
FT                   YSFVRPETGGVFGWLFAVLLGFDKPFNQAPSLHIVLLVVLWVRYAQHLCGVWRWLLHAW
FT                   FALIGVSVLTTYQHHFLDIPTGLAVGWLCVWMWPERIAAPFARARFARDLRRWRLAVMY
FT                   LAGALVSAALALWSGGAGLWLLWIALALLLVALNYALLGPGGFQKRSDGRLSLAARWLY
FT                   APYLMAAWCNSRLWTRRAPSPRAVCDGVWLGRIPLPGQRDERAAVVDVSAELSLYAAQA
FT                   QDRVVPMLDLVAPSPAQLREAAQAIAQARAHGPVLVCCALGYSRSAASMATWLVRSGRA
FT                   RDVDAAIAQLRAVRPSIVLGHAHRAAIVAACDGHDGGDDIPERRAQ"
FT   gene            608571..609017
FT                   /locus_tag="XAC0517"
FT   CDS_pept        608571..609017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35406"
FT                   /db_xref="GOA:Q8PQ15"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ15"
FT                   /protein_id="AAM35406.1"
FT                   /translation="MNTSPLTLPAMRAVLRQGAALDRFSLLLLAAAIGLLGVAEAPPLM
FT                   QLGYAISVLAGVVQRYWAFRVGLDADLLAASIAHLERCGGTEQEAAHQLDAAMHAIGLV
FT                   AKLPPARDWASRCAGMRRLLRWQLASVVVQLLLVAAALALGIFR"
FT   gene            609014..610510
FT                   /locus_tag="XAC0518"
FT   CDS_pept        609014..610510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35407"
FT                   /db_xref="GOA:Q8PQ14"
FT                   /db_xref="InterPro:IPR026467"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ14"
FT                   /protein_id="AAM35407.1"
FT                   /translation="MSNAPDSAQREPQHATPAQRALWQRLQGYRFGQDDAAFAAFVRRV
FT                   AKQAQCSTAQAQALVEEYRRFCFLACTDTHEVTPSPLVDQVWHTHLTDTREYWQQFCPH
FT                   VLQTTLHHQPGRGDAGEQARFQAQYRQTLERYRTQFGEPPAQWWPAARPQQSTLDPLHE
FT                   DTAEQTLQALRGAPQLSGPQRGVPYAVFAWAIIAVVVGMACRAANGGGLSPLHWRGVYF
FT                   LPLFIALIGLAWSMAAWLRRVLRRGRTAAALDASELAYLAGGADRVADLWFTELLVRNA
FT                   VYLERDATEPARHWVRCHRQIAVPPALEPALEAVRTTEDPVWALRALRALAAPLEQRLI
FT                   DKGLWLSQAQARAVRLACTVPVALVWGLGLCKLVIGVQGNHPVGYLLCLMVLTTLLVLG
FT                   FALVRVRRTLGGEARLATLRHTRRRDAARTGGDPGEAVALYGTAALIGTAWADYHSLRA
FT                   PHGHAGGSGSSCGGSGGDSGGDGDNSDGGGGCGGCGGGGD"
FT   gene            610510..611148
FT                   /gene="pgsA"
FT                   /locus_tag="XAC0519"
FT   CDS_pept        610510..611148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="XAC0519"
FT                   /product="CDP-diacylglycerol-glycerol-3-phosphate
FT                   3-phosphatidyltransferase-related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35408"
FT                   /db_xref="GOA:Q8PQ13"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ13"
FT                   /protein_id="AAM35408.1"
FT                   /translation="MQHGQQQRQLQWARVLRGRGATPNGVSWVSIAFAALAGLMFYIGL
FT                   SAPAREGAMPLLLAVLGLQGRLWCNRMDGVLARQARMVSRAGEVYNDAPDRLSDVLVCV
FT                   GLGYRLQAGLPWAAQLGWAAALCCVATAYVRMLGLACGTPEPRQGPMSRVQRMQWLSLA
FT                   GALALPLQWMGQPRLAAWLLIGALAVLIAGALLTVAVRLRTIVRTLEQK"
FT   gene            611145..611777
FT                   /locus_tag="XAC0520"
FT   CDS_pept        611145..611777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0520"
FT                   /product="acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35409"
FT                   /db_xref="GOA:Q8PQ12"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ12"
FT                   /protein_id="AAM35409.1"
FT                   /translation="MIARFIARGCSGAIRTLTGARALWRGCAPSNERRVYYGNHASHGD
FT                   FVLIWSSLPAGLRHEVRPVAAADYWQRTALRRYLIHAVFNGVLIERDPAQRTRDPIQCL
FT                   CDAVDAGDSLILFPEGTRNPDDGVLPFKSGLYHLARQRPELEFVPVWIDNLKRVMPKGK
FT                   WLPLPLLCTTTFGAPLRLDADETKDVFLTRARAALLALSPDHLEARA"
FT   gene            611816..612748
FT                   /gene="cdsA"
FT                   /locus_tag="XAC0521"
FT   CDS_pept        611816..612748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="XAC0521"
FT                   /product="phosphatidate cytidiltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35410"
FT                   /db_xref="GOA:Q8PQ11"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ11"
FT                   /protein_id="AAM35410.1"
FT                   /translation="MHQQTLWLFSGIALVLIIATLISETLRWRARERPSAVLDNLVARI
FT                   RAWWVMAAVVGLAFVFGRAGVIGLFALVSLFALREFITLTPTRRGDYYALLAAFYVVLP
FT                   WQYGLVWTGWYGLYTLLIPVYAFLVLPILATIGGDTTRYLERTAKVQWGLMICVFCISH
FT                   VPALLNLDIPGYAGRNLLLIAFLVIVVQSSDVLQYVWGKLAGRHLIAPKLSPSKTVEGF
FT                   IGGVVSASLLGMALWWITPFAPWHAFGLALVANLMGFFGGLVMSAIKRDRGIKDWGHMI
FT                   EGHGGVLDRLDSVCFAAPVFFHLIRYGWA"
FT   gene            complement(612956..613228)
FT                   /gene="fis"
FT                   /locus_tag="XAC0522"
FT   CDS_pept        complement(612956..613228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="XAC0522"
FT                   /product="DNA-binding protein"
FT                   /note="factor-for-inversion stimulation protein; identified
FT                   by sequence similarity; putative; ORF located using
FT                   Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35411"
FT                   /db_xref="GOA:Q8PQ10"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ10"
FT                   /protein_id="AAM35411.1"
FT                   /translation="MNAAPSRPDTSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEI
FT                   VLREMEIPLFVEVLNHCEGNQSRAAAMLGIHRATLRKKLKEYGLT"
FT   gene            complement(613334..614170)
FT                   /locus_tag="XAC0523"
FT   CDS_pept        complement(613334..614170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35412"
FT                   /db_xref="GOA:Q8PQ09"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ09"
FT                   /protein_id="AAM35412.1"
FT                   /translation="MNSAQQRAPRASADADLPSRNAPGTSKALTETTERQVPTAAAAAA
FT                   TQADTIGSERTASTPDGQSHPGRPSSHPDPATTEFGEDAQCDAGIAQSRPSPAQLQPLP
FT                   APALTAPAFARRGVTRPGLRASGRQWALLVGLVGVLGLQIVIADRAHLATSPRWRPLIS
FT                   AACTLARCSVPAWREPEALTLLNRDVRPLPGVAGVLQIQASFRNDARWAQAWPWLQLSL
FT                   SDADGRVIGTRILSPQDYLGQSPAAQDTLAPGQAVQVAFRVREPAASTAAFSFDFR"
FT   gene            complement(614976..615353)
FT                   /locus_tag="XAC0524"
FT   CDS_pept        complement(614976..615353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0524"
FT                   /product="transcriptional regulator pbsX family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35413"
FT                   /db_xref="GOA:Q8PQ08"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ08"
FT                   /protein_id="AAM35413.1"
FT                   /translation="MSKLYERVREARSLTKLTQEALAGELGVTRSAVAQWEMAEGTAPS
FT                   VENLIGLAKRSGMAFEYLATGRGDRVFGPPVSAIAEEPAQYRRLDDQQRVLLTRFDTLT
FT                   PRQRAGLLDLLLAEGKTRRRR"
FT   gene            615443..616006
FT                   /locus_tag="XAC0525"
FT   CDS_pept        615443..616006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35414"
FT                   /db_xref="GOA:Q8PQ07"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ07"
FT                   /protein_id="AAM35414.1"
FT                   /translation="MRYCRRIGDGHITANSRRMFMVEPAGRKPDPQRRTPHPSVAPADA
FT                   PWPAHSPVDPAVRRFRGAARYAIWRRGAEWTAVADGPQWSAALAPRIWALRQRQWPVLA
FT                   VSAPMLVVAGAVALAGVQGWSPVAWTALLVAEVLLRVWVARQAGPWRTAALQRTGWQLV
FT                   TRLRAISVADAVTTAQIRAGRPQR"
FT   gene            complement(616029..616949)
FT                   /gene="prmA"
FT                   /locus_tag="XAC0526"
FT   CDS_pept        complement(616029..616949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="XAC0526"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35415"
FT                   /db_xref="GOA:Q8PQ06"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PQ06"
FT                   /protein_id="AAM35415.1"
FT                   /translation="MPFLELTLSCSEVTLPRFQNALDDVGALAVTMLDADADTSNERAI
FT                   LEPGVGEMPLWDRLTMTALFDGDSDALVVLAALEAFDPGLDWSQVAFRMVEDSDWERAW
FT                   MDLFKPMQFGERTFIVPWNHALPEAADTPEAAVVRLDPGLAFGSGTHQTTALCLRWLDS
FT                   LAGSGELQGRSVLDFGCGSGILAVAALKLGATHAVGVDNDPQALLATADNAQRNGVDAQ
FT                   LAVYMPQDEPVQTYQVVVANILASALDALADTLAARVAPGGRIALSGILHGQEDDLLKR
FT                   YAPWFEQLRCERDEDWMRIDGVRRG"
FT   gene            617360..617854
FT                   /locus_tag="XAC0527"
FT   CDS_pept        617360..617854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0527"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35416"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ05"
FT                   /protein_id="AAM35416.1"
FT                   /translation="MLSCCRAPRCVRCVGPLTTRQRCNWATQRRRGDSATPDSGQAGAL
FT                   RHALLSDAQPAKIDAASGIRNRSTQQQAGKQLSNININIDTNTNTNTNTNTNTNTNTNT
FT                   QHSTAQHSTAKANIPQHCATERLQRATHLQSAQTVTACRPFLATSTGSVCLAAAVRVGG
FT                   C"
FT   gene            617904..618833
FT                   /locus_tag="XAC0528"
FT   CDS_pept        617904..618833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ04"
FT                   /protein_id="AAM35417.1"
FT                   /translation="MPLARARHLWLLLAPAALAAAAWWHVRAQPAGRDADRAVPVAAQV
FT                   IPVSAAPPQPHTATEHGAALQLPHRDAVEAQPDLYRYAQQLQQQVRAGDAQAGWRLSRV
FT                   YDYCAPYAASPSGYAADSAWIAAQHTPGVAAMHAARERLAQRCAGFAPTDGLSPRMVAQ
FT                   QRLVAARAGSLAAEAAMLALGEPLHASPGYKRALVQRVLASRDPEAYLALAPAMGARAS
FT                   GDDSLQGYVAGDQFAELAWQVAACRLGLDCSAGSTLVTSYCANAGICSRDSAQDFVSFV
FT                   FDAAVPRQGADRVDEMVDTLVSDPGAQS"
FT   gene            618830..619198
FT                   /locus_tag="XAC0529"
FT   CDS_pept        618830..619198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35418"
FT                   /db_xref="GOA:Q8PQ03"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ03"
FT                   /protein_id="AAM35418.1"
FT                   /translation="MNYRRLAHGAKFWLWVALFVAYSAAAVSIVMIDTADHRYQPLSVK
FT                   STSVTADEQQRRHGASQVAAVYRASSAMPFSTLPAGSTFQVVWPDGSTETMTVVDPSSA
FT                   SGIVPVPGSQQAPAPRIR"
FT   gene            complement(619441..620808)
FT                   /gene="accC"
FT                   /locus_tag="XAC0530"
FT   CDS_pept        complement(619441..620808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="XAC0530"
FT                   /product="biotin carboxylase subunit of acetyl CoA
FT                   carboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35419"
FT                   /db_xref="GOA:Q8PQ02"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ02"
FT                   /protein_id="AAM35419.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAASSDSYLNIPALIAAAEVTDAQAIHPGYGFLSENADFAERVEQSGFIFIG
FT                   PKADTIRLMGDKVEAIRAMKAAGVPCVPGSGGPLGDDIVANTKVAREIGYPVIIKAAGG
FT                   GGGRGMRVVHSEAALKAAIETTKSEAKAAFSNDQVYMEKFLENPRHVEIQVLADGQGGA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEELRNEIGKVCVDACIRIGYRGAGTFEFLFEN
FT                   GRFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGHKLSIKQSDIVLRGHAIECRIN
FT                   AEDPETFMPNPGLITAFHPPGGPGVRVDTHIYAGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMRVALSEMVVDGIKTNIPLQQRIMRDKGFQAGGQNIHYLEKRLAERKNKSIVLT"
FT   gene            complement(620798..621238)
FT                   /locus_tag="XAC0531"
FT   CDS_pept        complement(620798..621238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35420"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ01"
FT                   /protein_id="AAM35420.1"
FT                   /translation="MENGESAKRPHERLEAWRDSMELVEMIYRFTDVFPEQERYGLMAQ
FT                   LRRAAVSVPSNIAEGAARRSTSDYARFLSIARGSLSELDTQIQIAVRLGYSNPEDEDIE
FT                   PTGRPGLRQAHCIDECLTQTRSRAMKPASSHSPFSTPYSHAR"
FT   gene            complement(621256..621747)
FT                   /gene="bccP"
FT                   /locus_tag="XAC0532"
FT   CDS_pept        complement(621256..621747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bccP"
FT                   /locus_tag="XAC0532"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxilase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35421"
FT                   /db_xref="GOA:Q8PQ00"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PQ00"
FT                   /protein_id="AAM35421.1"
FT                   /translation="MDLRKIKKLIDLLEESNLAEIEIKEGEESVRLARVPKGAAMLSAP
FT                   VQQQYAPAPAAQAPAAAATMPMQSPTEASTGGAKQAAALPEGHVLRAPMVGTFYTSPSP
FT                   DKPAFVTVGQQVKVGDTLAIIEAMKMFNPIEADASGTIVAILGETGQPVEFDQPLFVIG
FT                   "
FT   gene            complement(621845..622291)
FT                   /gene="aroQ"
FT                   /locus_tag="XAC0533"
FT   CDS_pept        complement(621845..622291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="XAC0533"
FT                   /product="catabolic dehydroquinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35422"
FT                   /db_xref="GOA:Q8PPZ9"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPZ9"
FT                   /protein_id="AAM35422.1"
FT                   /translation="MAHLLLLHGPNLNLLGTREPEVYGRTTLAQIDAALVDRAQAAGHV
FT                   LHCLQSNAEHVLVERIHAAREDGTAYILINPAAFTHTSVALRDALLGVGLPFVEIHLSN
FT                   PHAREPFRHHSYLSDKADGVICGFGADSYRLALEAVIARLERDA"
FT   gene            complement(623135..625435)
FT                   /gene="dsbD"
FT                   /locus_tag="XAC0534"
FT   CDS_pept        complement(623135..625435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="XAC0534"
FT                   /product="C-type cytochrome biogenesis protein (copper
FT                   tolerance)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35423"
FT                   /db_xref="GOA:Q8PPZ8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ8"
FT                   /protein_id="AAM35423.1"
FT                   /translation="MRNRKPMTVLHRIAALCLLALAAFPALAISEKDLLPVDQAFALSA
FT                   TADSRDRIALNWKIAPGYYLYRHRISVKAGKGFAAGELALPEGESKHDEFFGQVQTYRK
FT                   QLQATLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRVDLPAADATGAQATAAPR
FT                   ENLGALVPRSAAGPRLFGAPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGY
FT                   YIYRDRTSLALEGASGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDHPDPA
FT                   HVTLVATFQGCQTDGICYPPMTRRVALDVPAGIVSPQNQAQASPLMISPLAAGQAPVEP
FT                   APAASTAGPVADASAGNPERTPPPHTDKGLLGMLVLALLGGLVLNLMPCVLPILSLKVL
FT                   GLAHSGESRGHARSHATWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAAL
FT                   AYLMFAVGLSLSGVFTLGTNLGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTA
FT                   LAYAFTAPALLAMLVFLALGLGLALPFLLIGFVPSLARRLPTPGAWMETLKQVLAFPMY
FT                   LTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATAMLVLAL
FT                   VPVVAVTRLSLPAATATEGVVAFSPQLLDRLRADNRVVFVNMTADWCVTCKANEKNVLS
FT                   SAEFRDALRRVDAVYMKGDWTNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLT
FT                   GAITEDALLRAAR"
FT   gene            complement(625422..625757)
FT                   /gene="cutA"
FT                   /gene_synonym="cutA1"
FT                   /gene_synonym="cycY"
FT                   /locus_tag="XAC0535"
FT   CDS_pept        complement(625422..625757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /gene_synonym="cutA1"
FT                   /gene_synonym="cycY"
FT                   /locus_tag="XAC0535"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35424"
FT                   /db_xref="GOA:Q8PPZ7"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ7"
FT                   /protein_id="AAM35424.1"
FT                   /translation="MSSPPPLRLLFSTCPDPASAARIAQVLVEERLAACVSRLPGVHAT
FT                   YRWQDVVEQAEEVLLLIKTAADRIPALQQRLCELHPFDLPELIELEVAGGLPAYLQWVY
FT                   AETREEP"
FT   gene            626028..627038
FT                   /gene="virS"
FT                   /locus_tag="XAC0536"
FT   CDS_pept        626028..627038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virS"
FT                   /locus_tag="XAC0536"
FT                   /product="virulence regulating protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35425"
FT                   /db_xref="GOA:Q8PPZ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ6"
FT                   /protein_id="AAM35425.1"
FT                   /translation="MARNLTFSLDIGWRTLLKDFGLKPEHVLRKAGLPEDLFARVGRGL
FT                   DTDEYFRFWRALELEAGDAMFPLHLLEMVSAEVFDPPLFAALCSANLMQAVQRLAKYKQ
FT                   LVAPMGLEVDVDRAGALTVSPRWLSVQTEVPYSLQVAEVAFFLRLARLATREPVQALRV
FT                   VLPRLPPGAYARRYERFFGVPVRHGEAPAITFGAADALRPFLTVNEGMWRVFEPDLRRR
FT                   LSELDAAATTVERVRAVLLELLPSNMATIEKAAERLGLSKRTLQRRLEDEGANFRALVN
FT                   ATRESLARHYLGSTTMTGGEIAFLLGFEDPNSFYRAFLEWTGQTPDTARNAMRLN"
FT   gene            627467..628081
FT                   /locus_tag="XAC0537"
FT   CDS_pept        627467..628081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35426"
FT                   /db_xref="GOA:Q8PPZ5"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="PDB:3QSZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ5"
FT                   /protein_id="AAM35426.1"
FT                   /translation="MNVRRFLLPIAMLVGLLVGQAAFAQDGWSLAKDAEGIKVYVRNVE
FT                   GSPLREFRGEVRLKAAADDVVKVLRDANAFRQWMPDVAASELLKATDTEQYHYLDNSAP
FT                   WPVSNRDGVYHFTYEKAGDGAITVRVEAVPDYLPLRKGKVRIPRAKGQWTLVPDADGVD
FT                   VTYQMHASPGGSIPSWLANQTVVETPFGTLKALRSHLRQAH"
FT   gene            628258..628854
FT                   /locus_tag="XAC0538"
FT   CDS_pept        628258..628854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0538"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35427"
FT                   /db_xref="GOA:Q8PPZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ4"
FT                   /protein_id="AAM35427.1"
FT                   /translation="MTPQDKHMPFIDAMHMYFRGEKIEAIYFIAVTGLLLVIFGVAALK
FT                   AERGGYAWSVAIPSILFGIVLVGVGAGVGLRTDKQVAAIESGLQESPSMLVQKELPRMQ
FT                   KVNANFRMTYYVLGLVAALGLILHYVAGPEWGRGLGSTLVLLGAIGLLIDGFAERRAVP
FT                   YTAALVRLDAEHRHADRAVVMPVPNPAASGRSSKH"
FT   gene            629109..629939
FT                   /locus_tag="XAC0539"
FT   CDS_pept        629109..629939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0539"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35428"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ3"
FT                   /protein_id="AAM35428.1"
FT                   /translation="MFVKGKKTALVTGASSGMGKAIAHRLIQDGYQVYVAARNVDRMAD
FT                   LALLGAHPLCMDVSRDDDIVAGVNTILAQTGGVDVLVNNAGFGLYGPIEEIGIHEARYQ
FT                   FEVNLFGAARLTQLLLPAMRSKRAGHIVNITSMGGKMYSILGAWYHATKHALEGWSDCL
FT                   RLEVAEFGIKVVIVEPGVIETGFGDAATDSIAKRSASGPYGRLVQMVTKSIDTTYGHGK
FT                   GSDPRVIADVVSRAVASNNPRTRYAAGKFARMLIRMRVWLGDRMFDRIILSQTR"
FT   gene            complement(630068..631102)
FT                   /locus_tag="XAC0540"
FT   CDS_pept        complement(630068..631102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0540"
FT                   /product="ribonuclease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35429"
FT                   /db_xref="GOA:Q8PPZ2"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ2"
FT                   /protein_id="AAM35429.1"
FT                   /translation="MALTYPTSGTRFSLSTNTALVGGERCTLAITASAIRDASGLSPAA
FT                   NQSIAFTVATASGGGTGYYARVNTTNASQLRCSLHATIKGHTVYPYSGSGTSTWTILEM
FT                   ADEDPNNSGRILDAYRNRSYAKVSDRAGTGSGLTYNREHTWPNSLGFGSATGDRGLPYA
FT                   PYTDTHMLYLTDTSFNADRGNKPYATCTSSCGERVTEVNDGSGGGSGRYPGNSNWVRTP
FT                   DGNSGTFEVWGRRKGDMARAVMYMAIRYEGGLDATTGQSEPDLELTDDRSKIVQTAASP
FT                   AYMGLLSTLLAWHQADPPDDAERARNEVIFSFQGNRNPFVDHPEWATASLFNSARPASC
FT                   QLLN"
FT   gene            632271..632558
FT                   /gene="groES"
FT                   /locus_tag="XAC0541"
FT   CDS_pept        632271..632558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="XAC0541"
FT                   /product="10kDa chaperonin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35430"
FT                   /db_xref="GOA:P0A0R5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0R5"
FT                   /protein_id="AAM35430.1"
FT                   /translation="MSIKPLHDRVVVKPIEADEVSAGGIVIPDSAKEKSTKGEVVAIGA
FT                   GKPLDNGSLRAPVVKVGDKVIYGQYAGSSYKSEGVEYKVLREDDILAVIG"
FT   gene            632705..634345
FT                   /gene="groEL"
FT                   /locus_tag="XAC0542"
FT   CDS_pept        632705..634345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="XAC0542"
FT                   /product="60 kDa chaperonin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35431"
FT                   /db_xref="GOA:Q8PPZ1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPZ1"
FT                   /protein_id="AAM35431.1"
FT                   /translation="MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFG
FT                   APTITKDGVSVAKEIELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGA
FT                   KAVAAGMNPMDLKRGIDQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIA
FT                   EAMKKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILL
FT                   HDKKISNVRDLLPVLEGVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGF
FT                   GDRRKAMLEDMAVLTGGTVISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDSA
FT                   AIESRVGQIKTQIEDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALVRALVAVGDLKGANEDQTHGIQIALRAMEAPLREIVANA
FT                   GEEPSVILNKVKEGTGNYGYNAANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITT
FT                   EAMVADAPKKDEPALPAGGGMGGMGGMDF"
FT   gene            complement(634459..636732)
FT                   /locus_tag="XAC0543"
FT   CDS_pept        complement(634459..636732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPZ0"
FT                   /protein_id="AAM35432.1"
FT                   /translation="MRGSNLSCDHKLPPSCLVGSFCNAVVRTALCRPGRLVRMMHVRQP
FT                   VRVGPSSSSRKPTMEIKQQQTAGPSSLAPLQDIHTDNAPVTDATSPTQTPIHPSLSALT
FT                   PRSRSHASTADSEHGASPVPSHDPEPQAHSPERAAGPATAATLAARANAALASGVQQAY
FT                   DAVSKGASNLWSLADLRTMLQIHADDPAFLQMVRHTDPEQSTPHSLAACRQQITQLRDA
FT                   IEAATGLEARFRQQVLGDIKAVEDALQPLEHGTPATGRVLKSLANLVNLWPLVVPSPLL
FT                   GNQAKTFAYSIAAATKGVMTLSASALRPTADGLPFPLMGGQLGRDANEMHFYAVLLNGL
FT                   FLTTELPKKFGNPSVRHQAETVENNLGFAAAASTACAAMVLTPFLWNSLNVLGNRLQHK
FT                   LSHLGAGIAENAGFQRQAQRLRARLTPGQISAQLRTQLNEITAALESGREAFQQARREF
FT                   TDPSQGHELTRTLNAQCTHLLETLDQCSKRLSTALQVDQDEPATIPRQVTNHDIAPKLA
FT                   LALLGAGVTGLTVYLIQPDRIGTVDLVADSILVTTVMMQSAVNAHATRQDAMERFKAMC
FT                   SSSLVMALALGVEKLSKTFADKSLIEASSSSPYYAGAIMSLMAMTMPGPMARGAELAMN
FT                   WGGGQIMRVFRGPDGTALATRMPSSPEELIQNVQDTARYVQSLSPEQAQEYAQRVGDIA
FT                   LQVIEDAGAQAQTTPSSSVTITEITEANDEAELAAGNASPEQRSPARTHPSPDQAAAST
FT                   APSS"
FT   gene            637059..639872
FT                   /locus_tag="XAC0544"
FT   CDS_pept        637059..639872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35433"
FT                   /db_xref="GOA:Q8PPY9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY9"
FT                   /protein_id="AAM35433.1"
FT                   /translation="MAQQTEPDATRATSTLDAVSVTGSRIKRAQVEGAQPVVTISAQQI
FT                   QQEGFATVYDVLNSMNQQGSVEADTQWGSHTPNASPINLRDLGPGRTLLLVNGHRVADY
FT                   PLPYGGESNFSNYSNIPSAAVERIDILTGGASAIYGSDAVAGVINVILKRDYQGDQVRL
FT                   RGGTATEGGRDSFDVSWAGGRTGENWSLTYALQATKRDPLSGRDRPEMDDSDDMSYSNW
FT                   TGQNRLYGFNPFTGLSLIDANTNERLAPPAGTCARFGGEFIDGQRLSYNQNTGALTNAG
FT                   SYCGVARDYGDWGLVTGSEDYSAYLYGTWKFGEHTEAWATLSANRSIGRWTYDPPYAYL
FT                   GPFQDAATGRSLNLIRQLTRREAGGWDRLANYNKEQSWDLSAGLRGVWAGRFDWELSVG
FT                   RSRYTVDEYIRTVDTARATDYFLGSSLGTAADGTSIYAINQARLYTPLSMDQYDALVAK
FT                   SHNSAYSWVNQASFSVSGDVVQGWAGPIRFATVAEVAKQGYQLSPDPCANECYPVDVVD
FT                   SGGGERMRSSAGLEFQIPLLSTLSANVAGRYDRYGNYRSSAAIPTDVGTQSDTTWSAGL
FT                   EWRPVESLLVRSTVATSFRAPDMHYVLGEPSSTNQTVIDQYRCISSGAYLTGGCNDENN
FT                   NIFYTVDVNRRGTPDLRSETGRSFTGGIVWDIAQGLSLSVDYYRIQLEEMIKDLDRDEI
FT                   LSAEAGCRTGTTISGGTWNNPGGAGYCDTITSRVMRNADGTIASIERGPINLAQMETSG
FT                   IDAALKYRLATAGWGNFQLSLDYNNLIAYREQIYRTDSDENRRDERVRSRVRGSVHWDN
FT                   GGAWDWTVYFRRIGSMRAVNWGTCERFDDGYQPSASDACLVTDTANVHLGETSKRYFGR
FT                   IGPAIYWNLSTGYKITDHAKVNFYVNNLFNEVGYDHKERFYGYGFYNTTLFNPIGREVA
FT                   AEYVFTF"
FT   gene            640401..641474
FT                   /gene="aroG"
FT                   /locus_tag="XAC0545"
FT   CDS_pept        640401..641474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="XAC0545"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   phe-sensitive"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35434"
FT                   /db_xref="GOA:Q8PPY8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY8"
FT                   /protein_id="AAM35434.1"
FT                   /translation="MPPVTDDLRIRKIEALAPPAQLLSLLPCDERASETVTNARAALHD
FT                   ILHGRDDRLAVVIGPCSIHDPVAAMEYAQRLRPLRDQFGDALEIVMRVYFEKPRTTIGW
FT                   KGLINDPDLDGSFQINKGLRVARGLLRDINNLGLPAGVEFLDIISPQYIADLVAWGAIG
FT                   ARTTESQVHREMASGLSCPVGFKNGTGGDVKIAVDAVGAASHPHHFLAVTKDGHTAVAA
FT                   TAGNPDCHVILRGGKQPNFDAANVEAASQVLNASGLPARLMIDASHANSSKNPENQPKV
FT                   VEDIANQLEGGETRIVGVMVESHLVGGRQDLLPGCELTYGQSITDGCIGWDSSVQVLER
FT                   LATAVRARRMRRIAEAA"
FT   gene            642263..644470
FT                   /locus_tag="XAC0546"
FT   CDS_pept        642263..644470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35435"
FT                   /db_xref="GOA:Q8PPY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY7"
FT                   /protein_id="AAM35435.1"
FT                   /translation="MAADSFLPAPMPSLRDRFQRWPRPWRRAVGIVLALYALYLLAGNL
FT                   YLNTPLFDASTNRQPHKFTMQTGPAVTLFPGEVIAWNVRMRGQANRTVYVFHADRAHAR
FT                   IALLALFRREVRLPWLHATGVSAEVETSDTPIPPPPRGNQGWTLRFDAITSNSIRSARL
FT                   GKLLIAGKGHGKVGFLKQLKGGPSELFPSEAGFTDAVVSYDGVQVFNGAQLDAQFQFPR
FT                   HYRDQAPGLRKLGITAARLQLKANSVALKIDTGAPHVDIGSGPSAARVEADIRLASGAL
FT                   QPGSRAVWRLPLLAGVGATDRGMLALQLDVAQDIRVQARLPRDEKTGSELHADLRIAGR
FT                   SVPFEQPAQLLPRLSGQVRGRWKFESLNWIAELFVRKPWFQLEGGGLVEADLRLAQGRL
FT                   SAGSTLDIPRVEAVAQVFDTRLAGVAKAHGRIDDAATAQAHLDVSIPTFKAAPRDAPRQ
FT                   LLLDGRDLQLAMHGDAELARLSDTLKAQLRFSDARVPDLTAYNRYLPGNNVRLLGGSGS
FT                   LTGDVALNASGEVGNGHANLRGQGAHLALAGVQMRGDAELQATLQRADFKNKFFDLGGT
FT                   RIRLRNMRVGDEVSDANWWGDLQVGAGTIQAEAPFQVDADAALRMRDIAPLLSVFAQRA
FT                   DYPRWVLGLLDSGELDATGRVRWRKQRVLIDDLHAENARLSLRARLALNDAQRRGDLYL
FT                   RWGVLGAGIELDGKQRQWHLAGAREWYDARPALLPAVSKTK"
FT   gene            644564..647005
FT                   /locus_tag="XAC0547"
FT   CDS_pept        644564..647005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35436"
FT                   /db_xref="GOA:Q8PPY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY6"
FT                   /protein_id="AAM35436.1"
FT                   /translation="MTMPVRARWRALPRVLRWPLVALIALYASYVLLGNLLLNTPLGPA
FT                   ALNRSPDKFTMHWGPALTWWPGRVVLWDVDLRGHWTRTNWNVSAQRMSGQIRLLPLLHR
FT                   QLLVPELHARGVRGGLQAAVVTPGTATKPSPAATQAARVAVVPMKGVADTPAASANEEA
FT                   PTVAPDVEKTATTQPPAQHLRVTTATNAKPTTPTTSTPQSAKRADAHASAPIPPAAWTL
FT                   QFDRIVAEQVQAVSLRQLHIEGQGQLQLGLFKRLRGGPMEIFPSRAVFESTRVRWGQDE
FT                   VMRNGQLRIEASIARHAPEQASGQAVLQFTDALIAVHGDTAALDVARDAQGRHTLATRP
FT                   GKGRADGELRWIRGALQPGSQLQWRAPLHDGTRAQAALLGELTAQLQVDQNMRLTVSMP
FT                   EPADAGLTLDADVRVQGRQLPVQSMRSLLPRTSGHARLHWQLSSLSWIAALFPDVDWLT
FT                   LEGEGLVDADLRIDRGQLGAGSRLQVPHVQAQVGVMGHAITGQASADLRVDADANGQLL
FT                   PALALQMQQFSIAHTDAPTRPFVQGRDLRLDLKTRADARNLASLRDATRAHLVFANARV
FT                   PDLRAYNRYLPQQQLRFDGGNGVLSGDLQIEPGGRIGKGGVRIGARAARLQFAGLALRG
FT                   DVDADLRLQRGDLRAEQFSLDASSIQLRNVGFTGPDGQHRDGWWAHVVLDDARMQWRQP
FT                   VGVDGRVRIQVRDLAFLVALYARDRSIPNWMLRLVDAGQAQLTARAHWQGETVIVDRLQ
FT                   ARNERFQVDARLRLQGNQRSGSLLARWGMLSAAVGLRGDTPEWHLLRAPEWYRAQPELL
FT                   R"
FT   gene            complement(647422..648342)
FT                   /gene="GNL"
FT                   /locus_tag="XAC0548"
FT   CDS_pept        complement(647422..648342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GNL"
FT                   /locus_tag="XAC0548"
FT                   /product="gluconolactonase precursor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35437"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY5"
FT                   /protein_id="AAM35437.1"
FT                   /translation="MDRHCRLRAPGAAQPAECPPPTTHHAALAARLGNARLQTLYDQAT
FT                   WSEGPAWWEAQRTLVWSDVVGRRVLGWREDGAVDALLDATAFTNGNAVDAQQRLVHCEH
FT                   GRRAITRSDVDGRAHLLVGRFEGKRLNSPNDLIVAHDGAIWFTDPPFGLLKPSQGCPGP
FT                   QELDHHGVYRLPPDGSALQCMVSLDHPNGLAFSPDERVLYVSQTPEGGPTTPEITAFDW
FT                   RDGALHNRRRFAVVPDGLPDGFCVDRQGWLWSSSGAGVCIFDNDGHWLGLVPTPETASN
FT                   CTFDLEQRRLFITGGSTLWLLELQK"
FT   gene            complement(648342..648860)
FT                   /locus_tag="XAC0549"
FT   CDS_pept        complement(648342..648860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35438"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY4"
FT                   /protein_id="AAM35438.1"
FT                   /translation="MSPTTLPAHLLPSQIPLETDGNDPALPPSLPFLHLWTGPDGNSRL
FT                   NLSQLPGFGSKSVGGGAAPQWLRPFPGEVLGIQFAVLPVGWVGDWHESPHPQWVIPLRG
FT                   RWFIETGDGTRVEMGPGDIHFGQDQGTTDRRGHRSGQLGETPCLQMMVQFAQSPGAATA
FT                   HPFGHPAPR"
FT   gene            649023..651848
FT                   /gene="glnE"
FT                   /locus_tag="XAC0550"
FT   CDS_pept        649023..651848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="XAC0550"
FT                   /product="glutamine synthetase adenylyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35439"
FT                   /db_xref="GOA:Q8PPY3"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPY3"
FT                   /protein_id="AAM35439.1"
FT                   /translation="MPMPTVSMSPALTALIERAVARVRQSLPVEQAWPGGEFDRQLAQV
FT                   ALASEFALDTLARQPALLQHLAQPDPPPLPLPQFDPAQPQLWPAQLRRYRSAESTRLVW
FT                   RDVLGLDSVEATLAGATQLAEHCLQCGLQALEQQFHTRHGKVVAADGSVQRLVVFGLGK
FT                   LGGGELNFSSDVDLVYAYPQGGQSDGARPLAAEEYFARLGQQLARLLDETTADGFSHRV
FT                   DLRLRPFGTAGRVALSFAGMDQYFQREGRDWERYAWLKARAVAGDIDAGEAWLETLRPF
FT                   VYRRYLDFTALDGLREMKAAITAEVARHDRLDDIKRGPGGIREIEFLAQSLQLIRGGRE
FT                   PSLRERRLLPALQALVAAGQIDQENGQALSTAYRFLRRLENRLQMLRDAQTHALPQAPL
FT                   DRERIALGLGYAQWSALLDALAPQRARVAAEFAELLAPRVRATAPDALADYWRALPDGD
FT                   AAPLAGIGLNDPDGAHRALADFAQSSGVRALSDSARARLDRVMPALLHAATRASQPDAA
FT                   VRRMLGLLQATLRRTSYLALLDEQPSALARLVDVLSRSALLAERLAAYPLLLDELLDTR
FT                   ISGPLPDRAALHAACAHTLHIDDTEAALRELNERRLALSFRIALATLDGRQQAVESTRQ
FT                   LAWLAEAVVQTVLHLARSDMLAAHGHVPGGSFAIVGYGSLGGLELGFGSDLDLVFLYDH
FT                   PREVDASDGKRPLDAGRWFARLAQKVMALLAAETGAGRLYDIDVRLRPDGGKGALVSSL
FT                   ASYREYQRDRAWTWEHQALVRARAVAGDAALCDAFAQVRRDTLMRVRDTAQLHEDVRKM
FT                   RARMRAELDRSDAGRLDLKQGAGGLVDLEFVLQAGVLGLAAQQPQLLDACDTPALIDAL
FT                   ARTHWLPDESAAPLHQAHATLVDAGLSCTLDRRPRLIAPTPAIQQARGIIFNAARGQGL
FT                   TFPLGKDETAL"
FT   gene            complement(651950..652501)
FT                   /locus_tag="XAC0551"
FT   CDS_pept        complement(651950..652501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35440"
FT                   /db_xref="GOA:Q8PPY2"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY2"
FT                   /protein_id="AAM35440.1"
FT                   /translation="MRLASPPVLAPLTARALIWAVLAMGAVVLLSNILVQYPINDWLTW
FT                   GAFSYPLAFLVSNLINRRFGPRAARHVAWCGFALAVLLSIWLATPRIAVASCSAFIAAQ
FT                   LLDISVFDRLRDGSWWRAPIVATTCSATLDTTIFWSIAFAGASLPWVSWAAGDLAVKLG
FT                   MGVFLLGPFRALLWRTAPRR"
FT   gene            652985..654946
FT                   /locus_tag="XAC0552"
FT   CDS_pept        652985..654946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0552"
FT                   /product="proteinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35441"
FT                   /db_xref="GOA:Q8PPY1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY1"
FT                   /protein_id="AAM35441.1"
FT                   /translation="MIAPLVASGRARPCDAIRPRSLLCPPERSMLTRIRCRPLLAAVLS
FT                   ASLFAFGSANAATTVPDARIDAMTASLRAAPVSFDVHLPSRDQVALDALLADIQDPLSP
FT                   QYHKWLSAADFQRRFGPAPAQLAQVRAALQAAHMTVVQQGPTLHVSANADSVERLFAAP
FT                   LVADLKAGQQVRLTAAAPLQLPAALRAKGVTVTGLTRGLPPAHMNSRLVASDPSNRYGD
FT                   GTTSYWYNDLKQAYGYPSYQTMVGAPGQQRRLDGSGSTIAILIGSDVLDSDIATMFDHE
FT                   HFSRYAGNHANPTLYARRYVAGAKPGVQDGNRAAAREATLDVDMALGGAPGAHVLLYVI
FT                   PDLSIDSILAGYRQIVQDNEADVVSSSFGLCEQVFTAAYNGNDATSILGLFDSVFKQGN
FT                   AQGISFVASSGDNAGLECPDTQYLVEGKSGRYIPSVEWPAADAHVTAVGGGNLLTAYKK
FT                   GSLDSTYLSESAFADPLQAEDPYGVGALLSGGYWGAGGGVSTLFQRPAYQLRALGGTRT
FT                   SMRALPDVGMLVGGCPGIAVHPCQQGTSSVSIYVAGAITKVIGTSVAAPEFASVAALLV
FT                   QKQGRQGNLNDYLYRLAANGPEAYHRGIPGNNGVVSNDVPIAGKYNYTTGLGTPIVRLM
FT                   IGALDAAPAGIPRSPSNP"
FT   gene            complement(655182..656129)
FT                   /locus_tag="XAC0553"
FT   CDS_pept        complement(655182..656129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35442"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPY0"
FT                   /protein_id="AAM35442.1"
FT                   /translation="MGLTWALSDGRAGNARQAEALARALQPDAYQPLHLEPNAPWRWAA
FT                   PWRLPGARRAFGAAFAGQLTQPPALAIGCGRQAALATRLLRAHGSRSVQILDPRLDPRH
FT                   WDLLVVPEHDARRGSNVLTLLGSLHPVDDAWLAAGRAAFPALGGLPGPRLALLVGGPTD
FT                   QVPWTPQALAALCTRLSAQLRALGGSLLVTTSRRTPGDAIATLRAACVGLPHLLWCDER
FT                   DGPNPYAGLLGWADAIVASADSVNLLSEACATRVAVTAAFGEQAGGRVGAYLQALRQRQ
FT                   RLHPVDEVLAGAVDIVAVRETERIAMQVRARLLA"
FT   gene            656257..656853
FT                   /locus_tag="XAC0554"
FT   CDS_pept        656257..656853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0554"
FT                   /product="nitroreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35443"
FT                   /db_xref="GOA:Q8PPX9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPX9"
FT                   /protein_id="AAM35443.1"
FT                   /translation="MLMSDSLNAAALDQLFRTARTQNAFADTPVSHEVLRELYELVKWG
FT                   PTAANSCPARFVFVTSAEGKAKLKPALSEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFP
FT                   HADAKSWFDGPREGRTESAFRNGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG
FT                   TPIKSNFLVNLGYGDPAGLFPRSPRLSFDEAARFE"
FT   gene            657004..657828
FT                   /locus_tag="XAC0555"
FT   CDS_pept        657004..657828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35444"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX8"
FT                   /protein_id="AAM35444.1"
FT                   /translation="MRFLQSSSVCICPTRVVPTRLSSHGVPMKTTHKLLLPLALTLAIA
FT                   ACSKPAENTAAPAAETPAAATAPADAAAAPAPAPAAAASTAPAVEVASGTYTLDPSHTD
FT                   VLAQWSHFGFSNPSAHFGNVDGTLVYDAADVTKSTVQVTLPLSGLNSFTAKFDEHLKSG
FT                   DFFDAAKFPTATFKSTKVEAAGTNKLTVTGDLTIKGQTKPVVLDVTLNGAGEHPMKKVP
FT                   AAGFDATTTIKRSDFGLGQYAPNVSDEVKIRITTEALQAKAGDAAAKDAAAK"
FT   gene            657873..658370
FT                   /locus_tag="XAC0556"
FT   CDS_pept        657873..658370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0556"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX7"
FT                   /protein_id="AAM35445.1"
FT                   /translation="MSLRGMATCDPVGCGEVMLGPPACWVRVLGNAAAHGIADSVDHGD
FT                   RGMGKQVAAATFGNLTPRRCLAGRAVAIAESTARRTARQRSWRLSSTRHPARAGWAHFS
FT                   GPVMSVVHFVRSLPLFLQWQAWHHRDVRPRGTRTLGARSINAPRYVGQLGRGVVLALSA
FT                   TF"
FT   gene            658406..659650
FT                   /gene="appA"
FT                   /locus_tag="XAC0557"
FT   CDS_pept        658406..659650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appA"
FT                   /locus_tag="XAC0557"
FT                   /product="phosphoanhydride phosphorylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark; 6-phytase"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35446"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX6"
FT                   /protein_id="AAM35446.1"
FT                   /translation="MRHALLGLALCLPMAKPVCAKQTAATTAHLRLTIVLVRHGIRAPT
FT                   QPGSELDRYSAQPWPHWPVAAGQLTPHGRAGMQALGARYRLRLAPPLGLAASGCAGTEQ
FT                   IVTIADSAARNHASAQALLQGMAPGCAMRYQALPEGERNALFDGGKAPAPPVRLEAETR
FT                   AQLAHLQAVLSACQHGRCATAPPTRLLYEPATRDGSPAAASTLKLAGGLAENLMLEDVE
FT                   GFDAAQLGWGRVDRAAVAQLLALHNTSFAQSKRPLPVATAAASNLLAHLLATVQAAVGQ
FT                   TPSVAALAPPSTRLLVLVGHDTNLATLGGLLGVQWHRSDRPDDYPPGGALVLDLLERDG
FT                   APLLRVRTLMPSLSALRSGRLDDEALASSTLVLPGCHGEALCPLPVASAWLRTRIDPAQ
FT                   VQVALPAMQSWPVPP"
FT   gene            complement(659733..660527)
FT                   /gene="mxcB"
FT                   /locus_tag="XAC0558"
FT   CDS_pept        complement(659733..660527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mxcB"
FT                   /locus_tag="XAC0558"
FT                   /product="iron utilization protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35447"
FT                   /db_xref="GOA:Q8PPX5"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX5"
FT                   /protein_id="AAM35447.1"
FT                   /translation="MAAHTNTQLRRDPRLRSVQVRRCEAITPHMRRIVFGGSDLAGFQS
FT                   DAPDDHIKLFFPNADGAFVLPTMTPDGPRYEEGALPSPARDYTPRYFDPQSGELSIDFV
FT                   LHGDGVASSWAAHAQPGDPLKLGGPRGSFLAADDYDHYVLIGDETALPAIGRWLEAMPA
FT                   DMHAQVFIEIADAAERQELLSAAEVRVNWLERNGFDAASSTLLEDSLRDYEPEDGDTFY
FT                   WIGAESMRARAMRKFLEDHLGVDKEWVRAKGYWKARGEHGEE"
FT   gene            complement(660837..661301)
FT                   /locus_tag="XAC0559"
FT   CDS_pept        complement(660837..661301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35448"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX4"
FT                   /protein_id="AAM35448.1"
FT                   /translation="MRGRPLEHGDLRLLLLVLIAERPRHGYELMRQIAALFKGLYTPSA
FT                   GAIYPALAQLEAAGWVHTDLDAGRKRYQVTAAGSDHVAQQRDALDAALARTHRRARELI
FT                   KSQTPAPIREAIHRIKHGLFARHGQWSETETARIAALLNAAADGMERDDD"
FT   gene            661561..663207
FT                   /gene="mdcA"
FT                   /locus_tag="XAC0560"
FT   CDS_pept        661561..663207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="XAC0560"
FT                   /product="alpha subunit of malonate decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35449"
FT                   /db_xref="GOA:Q8PPX3"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX3"
FT                   /protein_id="AAM35449.1"
FT                   /translation="MSRQWDTQADSRRQRLQRAAALAPQGRVVAADDVVALLEAVIEPG
FT                   DRVCLEGNNQKQADFLARCLTEVDPARVHDLHMVQSVLSLAAHLDVFERGIAKRLDFSF
FT                   SGPQAARLAGLVSEGRIEIGAIHTYLELFGRYFIDLTPRIALVTAQAADRHGNLYTGPN
FT                   TEDTPVIVEATAFKGGIVIAQVNEILDTLPRVDIPADWVDFVTQAPKPNYIEPLFTRDP
FT                   AQISEIQVLMAMMAIKGIYAEYGVDRLNHGIGFDTAAIELLLPTYAQSLGLKGKICRHW
FT                   ALNPHPALIPAIESGFVQSVHSFGSELGMENYIAARPDIFFTGADGSMRSNRALSQTAG
FT                   LYACDMFIGSTLQIDLQGNSSTATRDRIAGFGGAPNMGSDARGRRHASAAWLKAGREAA
FT                   TPGEMPRGRKLVVQMVETFREHMAPAFVDKLDAWELAERANMPLPPVMIYGDDVSHVLT
FT                   EEGIANLLLCRTPEEREQAIRGVSGYTAVGLGRDRRMVENLRDRGVIKRPDDLGIRPRD
FT                   ATRDLLAARTVKDLVRWSGGLYDPPKRFRNW"
FT   gene            663217..663534
FT                   /gene="mdcD"
FT                   /locus_tag="XAC0561"
FT   CDS_pept        663217..663534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="XAC0561"
FT                   /product="delta subunit of malonate decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35450"
FT                   /db_xref="GOA:Q8PPX2"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPX2"
FT                   /protein_id="AAM35450.1"
FT                   /translation="METLRYRFDGQRGARAGLEHALVGVVASGNLEVLVERVPLEGAME
FT                   IDILTAARGFGAIWQAVLDDFAARHPLRDVRISINDVGATPAVVSLRLEQALDVLQGAD
FT                   A"
FT   gene            663641..664561
FT                   /gene="mdcB"
FT                   /locus_tag="XAC0562"
FT   CDS_pept        663641..664561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="XAC0562"
FT                   /product="beta subunit of malonate decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35451"
FT                   /db_xref="GOA:Q8PPX1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX1"
FT                   /protein_id="AAM35451.1"
FT                   /translation="MSTTVPMAQRSYYEADARERIDGLLDVGSLREFVGPRRRLISPHL
FT                   AQLETPGAFDDGIVVGEGTLRGRNVLIAAQQGAFMGGGVGEVHGAKLTGLLERAATTQP
FT                   AAVLLLLDTGGVRLHEANAGLIAISEIMRATLSARAAGVPVLALIGSGNGAFGGMGIVA
FT                   RCCSAVIMSEEGRLSLSGPDVIETVRGVEEFDARDRALVWRVTGGKHRYLLGEAQTLVA
FT                   DRIDAFADAALATLDALTEATGEAALQALERAQQQLAARIDAYGDCRDGLEIWTRQGIV
FT                   DAQRLPLLDTEAFLAATADRSLPWT"
FT   gene            664552..665256
FT                   /gene="mdcC"
FT                   /locus_tag="XAC0563"
FT   CDS_pept        664552..665256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="XAC0563"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35452"
FT                   /db_xref="GOA:Q8PPX0"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPX0"
FT                   /protein_id="AAM35452.1"
FT                   /translation="MDLSRLLDQLFPLGHAIARNDDVLTGSATTAAGDVTVIGTANKLE
FT                   VGVDHALALAATVLASTRAHPQRPIVMLADTAGQRLARRDELLGINGYFAHLARALELA
FT                   RRRGARLITLVYGESVSGGFLSFGLMADHIHALPDAQIRVMDLRAMARVTKQSVDTLQA
FT                   LSKSSPVFAPGVENYVRMGAVESLWEGDLAQALLDALAAPVDGDQRRARGAQRGGRTLA
FT                   RDVASAVVAGEA"
FT   gene            665259..665900
FT                   /gene="mdcE"
FT                   /locus_tag="XAC0564"
FT   CDS_pept        665259..665900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="XAC0564"
FT                   /product="malonate decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35453"
FT                   /db_xref="GOA:Q8PPW9"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPW9"
FT                   /protein_id="AAM35453.1"
FT                   /translation="MAGRHALVWLREDAQWQAVTSGAQPRLQQWFAAGLPAVVARGDGS
FT                   QAPGTLRLGVPLPPSEGKQRLALQAHVAGIARCTAPLTLDAVMPHAPLAVQPALQALLA
FT                   QAHAHALHPHVFGSFAWQALTGLTYVHAQSDLDLLWSIQTPEQACAVLTLVQRWEQQHG
FT                   LRADGELRLPDDNAVNWREYAGNAQQVLVKSNQDCRLLPRAALFPARSAA"
FT   gene            665897..666766
FT                   /gene="citG"
FT                   /locus_tag="XAC0565"
FT   CDS_pept        665897..666766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="XAC0565"
FT                   /product="CitG protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35454"
FT                   /db_xref="GOA:Q8PPW8"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW8"
FT                   /protein_id="AAM35454.1"
FT                   /translation="MSAQLQQHCVASALAPPRDAAYRLGRLAVGALYAELACAPKPGLV
FT                   TPFDSGSHTDMDAATFVRSLFALRGYFVAIAQAGIDHAPFERLRELGIAAESAMLRATC
FT                   GVNTHRGAIFSLGLLTAQAARLRGEQRRRPTAEQVCDGVRAWRDALQAAPLDPHSHGQR
FT                   VRAQYRISGVREQAAAGYPVLREIALPALRTALAGGATREAALVQTLMQLIAQVDDLNL
FT                   LHRGGPEGLAFAKAQATAFLADGGIAHPQWRAQLHAIGQQFVARRLSPGGSADLLACAW
FT                   FLHRQELA"
FT   gene            666996..667916
FT                   /gene="mdcH"
FT                   /locus_tag="XAC0566"
FT   CDS_pept        666996..667916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="XAC0566"
FT                   /product="malonyl CoA-ACP transacylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35455"
FT                   /db_xref="GOA:Q8PPW7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW7"
FT                   /protein_id="AAM35455.1"
FT                   /translation="MSLALLCPGQGGQHAEMFARVADAPAAAAVFASAQRVLGVAPQAL
FT                   AADPGRYANAIAQPLVCAGTLAHWQALCAQLPTPLLVLGYSVGELAAHAVAGSMSIDTC
FT                   LQLAATRARLMDAASPQQAGLMAVIGVPLRALETLCQTHGAALAIINGDDHAVLGGPRA
FT                   ALQALGEAASAQGARVTLLPVGVPAHTPWLSAAAEGFAIELATAQLAAPRLRVLAGIDA
FT                   RAVGTQALVVDTLSRQIAQTVRWYDVLVQAAERGARVFLELGPGSALARMAREVLPACE
FT                   ARSVDEFHSTDGVLEWVMAACERAA"
FT   gene            668004..669359
FT                   /gene="matC"
FT                   /locus_tag="XAC0567"
FT   CDS_pept        668004..669359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matC"
FT                   /locus_tag="XAC0567"
FT                   /product="dicarboxylate carrier protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35456"
FT                   /db_xref="GOA:Q8PPW6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW6"
FT                   /protein_id="AAM35456.1"
FT                   /translation="MTPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLEG
FT                   KEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLVHWAVRAVRGRIVAIPWVMFVITGL
FT                   LTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGGFSPISVYGGITNKV
FT                   VEKAGLDVSEMAVFLTSLGFNLMMAIICFCAFGGLKLMRRQELSLADAQYVAVAGDQAS
FT                   HRGFAIEGHGALVAPGGGTLSTDPLALEAVSITRDRVITLIGLLGLGVAALIYNLNVGL
FT                   VSITVAVALALISPNAQKGAVDGISWSTVLLISGVVTYIAVLEKSGAVDYIGTGVSHIG
FT                   MPLLGALLVCYVGGIVSAFASSAAVLGATIPLAVPFLMQGQLGAAGVICALAVSSTIVD
FT                   VSPFSTNGALVVASAAKEERDGLFRRFLIYSGLVVLLGPLAAWLVFVVPGWL"
FT   gene            669438..670157
FT                   /gene="mdcY"
FT                   /locus_tag="XAC0568"
FT   CDS_pept        669438..670157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcY"
FT                   /locus_tag="XAC0568"
FT                   /product="transcriptional regulator mdcY family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35457"
FT                   /db_xref="GOA:Q8PPW5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW5"
FT                   /protein_id="AAM35457.1"
FT                   /translation="MTLAPDSRASKKRVPLYEEVAERLRQKIYEYALPPGEWIDEPALA
FT                   EELGISRTPLRESLKLLAAEGLVQLDAGRGSRVTRLTLEDLNQLFPVMAMLEGRCAHDA
FT                   VKRIDAAGVQRLEELHAAMEAASAAGDVAEYYRNNYLIHETVQQYAGNPWLIRVTHDLH
FT                   RILKMHRGRQLLTPGRMAQSLAEHRQLMDCVRRGDAEGAERTMHGHLLSQGQALAAYVA
FT                   AGGMLNVPAPLPRVGGV"
FT   gene            complement(670306..670929)
FT                   /gene="virP"
FT                   /locus_tag="XAC0569"
FT   CDS_pept        complement(670306..670929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virP"
FT                   /locus_tag="XAC0569"
FT                   /product="VirP protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35458"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW4"
FT                   /protein_id="AAM35458.1"
FT                   /translation="MPALIIFDFDGTLADSFGFFLSTQRLLAERHGFRAAQAHEVDDAR
FT                   RLSTRELLKASGLSTWRVPWVAADFIRLMRAAPPVALFPGIAHTVSALHARGTRLAVVS
FT                   SNSVENVRRALGAELSATFAVIEGGAHLLGKQRALRRVLRATGHTASQAVYVGDQVADW
FT                   EAAQVVGLPFAAVAWGYAHPDVFAGLAGTQLIERVEDLLALSGE"
FT   gene            complement(671116..671535)
FT                   /gene="spoIIAA"
FT                   /locus_tag="XAC0570"
FT   CDS_pept        complement(671116..671535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAA"
FT                   /locus_tag="XAC0570"
FT                   /product="anti-sigma F factor antagonist"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35459"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW3"
FT                   /protein_id="AAM35459.1"
FT                   /translation="MTTLAIQIDPPQDTRQRVILTGRLDTHTYQDLDAALSPLLGTLIT
FT                   TLVLDLSALEYISSAGIRCIFKARKALATRQGKVLVSNPQPQIRKVFDMVKAVPLSDVF
FT                   ASTEELDAYLAAMQRKVIEQSAQSDAPIVPHFAEA"
FT   gene            complement(671532..671963)
FT                   /locus_tag="XAC0571"
FT   CDS_pept        complement(671532..671963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35460"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW2"
FT                   /protein_id="AAM35460.1"
FT                   /translation="MKLELAIAPSLAQLAGANDALERSLTLEGLHAERIGQVRLIVEEL
FT                   GCNALTHGQCAAQPLRLQLQLDAQALVLEMHDAGSAFDPCAAPLPEVTDELDDRAIGGL
FT                   GLFLVHQFADHIDYRRDGAYNVVRVTLLHPYAPVPEALS"
FT   gene            complement(671960..674041)
FT                   /gene="icfG"
FT                   /locus_tag="XAC0572"
FT   CDS_pept        complement(671960..674041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icfG"
FT                   /locus_tag="XAC0572"
FT                   /product="IcfG protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35461"
FT                   /db_xref="GOA:Q8PPW1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW1"
FT                   /protein_id="AAM35461.1"
FT                   /translation="MHGSKAAMIQRSCCHEECAMRNRPRSLPPRTSVAARMPWRRSLRM
FT                   RVLLAATAVLVALLTVLGTVFYLGARAELVDAARTEVDGLTEQTARSLAAMLDSVQVSG
FT                   RTLAASSGGVGLQPFNLRALLLATLTGDPDIGAARLIIERRTQKAGDSGFVWYVHRNGT
FT                   RVAEKSALELGYDYRAMPWYLRTQREGRAWWSEPYMDANGGGLYTSYNLPLRRPGDAPD
FT                   AAPVGMVSVDLPLQHLREIIDQLPRDIGIQTMLLSPEGLLVFSPDPALNLRHSLAAYVA
FT                   RSRPDLRPLQRAVAAGQPISFSHTAPDGERFLTHSAAVGRSGWTFVLSASEGYVLAGLN
FT                   WLAAWVALAALLGAMVWWWLMRRITRKLTRPIEELTDTAEHFRRGEFEYPLPHIERDDE
FT                   VGVMARAFDSARDAIRHHIAEIGEMTAARERMHSELQIAREIQQAMLPSGRTFDRASSH
FT                   LETCAWLEPAKAVGGDFYHFVETEPGLLWFVVGDVSDKGVPAALFMARAVSVLEIAARR
FT                   YTRPDAILIAASTRLAENNETCMFATVLCGLINVVSGDYWLASAGHEPPLLIDIDGTAR
FT                   PLPLETGAPLGIEQQESYPVLQGRMSAGQTLLGYTDGVTEAMDERGASYGMERLLAALH
FT                   PRRSAAAQCKAVIANIARFTGTADPYDDITLLAIRLRQEHAGRVAHAGRDAPGKATTA"
FT   gene            674105..674803
FT                   /locus_tag="XAC0573"
FT   CDS_pept        674105..674803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPW0"
FT                   /protein_id="AAM35462.1"
FT                   /translation="MAAHLPRRPALRQMLTPSLLALLLTACHSPETSMTQTHSSATEAT
FT                   AAADVQAGGRGLARLNPSPRKAYEVTLTLDKAPGAFGLVEAAAQYDVSNEQECGRIQPE
FT                   TGTAGRITSQETVALKKISETEYRGTLYLDLMQDEDYYGRGVCHWEFSGASVLLKATGA
FT                   EEETRFLSFIEAKTVTAQQALTKYYWKDGYPRSESKSFPDTGELSPETFKPEIRDNLFT
FT                   ITLAAKEVAS"
FT   gene            674800..676122
FT                   /locus_tag="XAC0574"
FT   CDS_pept        674800..676122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35463"
FT                   /db_xref="GOA:Q8PPV9"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV9"
FT                   /protein_id="AAM35463.1"
FT                   /translation="MSIPSPQYAGLSEDAYKDRAVGRRAPGHEEIVTIEGERYAVLDHV
FT                   NNQSNGYQGTVYRRESSGEIVVAHRGTEGAVNDVLTDATMVTSRTNPQAADALALTKNA
FT                   MDIAKDVGKRTGHQLEVTVTGHSLGGALAQVSAHHYDLKGETFNAYGASSLSYRIPEGG
FT                   NSVINHVMASDPVSAASPHFGQVRMYAKPYEIATLSGAGYSNSKANFLIPDYPLVAAGG
FT                   SLGAHKLGNFLGEHSALRDPNARPLAEQNKRMIEEYRSDIDGLRTGTTILTRSARGLGQ
FT                   DAIDAIRGPLAPGEPAKRDPREHGNGHTSLRIDQPGHVGNGLFQDAQRGVHAQDARAGR
FT                   TPDQHSAQLSGSLASEMHAAGGRRIDAVMMSPDAARTFAVQGRVDDPAQLRVSVDTMTA
FT                   MNTPLEQSSQRVAENAARQSAVLEQQQSQTQQQQQGARALG"
FT   gene            676549..677550
FT                   /locus_tag="XAC0575"
FT   CDS_pept        676549..677550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0575"
FT                   /product="arabinogalactan endo-1,4-beta-galactosidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35464"
FT                   /db_xref="GOA:Q8PPV8"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV8"
FT                   /protein_id="AAM35464.1"
FT                   /translation="MTIFCRHYHRVWLILLLSLCSAGVSAQGIAKGADVSWLNQQAANN
FT                   PPQVFRDAAGNTTDFIKLFKDVGGNAIRLRVWVNPSGGWNDGRDTLDKAKRAAAQGMRI
FT                   MIDFHYSDSWADPGKQTKPAAWAGHSVAQLNTDVYSHTQGILKYLKDNGITVSWVQVGN
FT                   EINSGMLWNEGKTPNFATLGQFINSGYNATKAVYPNAKVVVHLANGYDNANFRWFFDNL
FT                   RSAGGKWDVIGMSHYPPVGSWQDYNSRLDTNMRDMIARYGSDVVISEVGMDWQQAATTR
FT                   AMLSNLLSRSSSIGARVLGVFYWEPNAYPGWQGYTMGAVNNNGQLTEALQAF"
FT   gene            678352..681039
FT                   /gene="aceE"
FT                   /locus_tag="XAC0576"
FT   CDS_pept        678352..681039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="XAC0576"
FT                   /product="pyruvate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35465"
FT                   /db_xref="GOA:Q8PPV7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV7"
FT                   /protein_id="AAM35465.1"
FT                   /translation="MNWLNEVLHNDPNPLETQEWLESIKAVIDVEGPERAHQLLEGMVE
FT                   QTRRAGAYLPFSPTTEYVNTISPANEAKHPGDSALEWKIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASSATLYDVGFNHFWRAPSDNHPGDLLFIQGHSAPGIYARAFLEGRISQS
FT                   QLDNFRMEVDGQGISSYPHPWLMPEFWQTPTVSMGLGPLAAIYQAQFMRYLENRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWNVIKLLWGGYWDALLAKDSDGVLRKLMMETVDGEYQNCKAFGGAYTRANF
FT                   FGKYPETAAMVAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTTGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDAAVKHFRDRFNIPVTDAQLEDGQVPFYHPGEDSPEVQYLKE
FT                   RRSVLGGFLPSRRPKASKSFVAPTLDKFERLLKDSGERSYSTTMSFVQSLNIALRDKEL
FT                   GPRIVPIVADEARTFGMEGMFRQIGIYAPFGQKYKPVDADQLMYYREDQTGQVLQQGIS
FT                   EPGAIASWMAAGTSYSVSDVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAG
FT                   RTTLNGEGLQHEDGFSQVIAGSIPNVRSYDPTFGFEVTVIMQHGMKAMMEDQVDEYYYI
FT                   TLMNENYAHPGMPDGAAEGIIKGMYLLKDAGKPKKGELRVQLLGSGTILREAIAAAELL
FT                   DKDFGVTADIWSCPSLNEVRRDGYAVERWNRLHPEAEQRKPYVTQLLEGRQGPAVAATD
FT                   YVRAFADQIRAFVPMTYTVLGTDGFGRSDTRANLRRFFEVDRYYIAHAAIAALAKDGKM
FT                   TGKDVARAIKQYKIDPEKANPVGV"
FT   gene            681205..681525
FT                   /gene="dcm"
FT                   /gene_synonym="mec"
FT                   /locus_tag="XAC0577"
FT   CDS_pept        681205..681525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /gene_synonym="mec"
FT                   /locus_tag="XAC0577"
FT                   /product="cytosine methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35466"
FT                   /db_xref="GOA:Q8PPV6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV6"
FT                   /protein_id="AAM35466.1"
FT                   /translation="MKKKIGEPKIKIAGPSVISLFSGCGGMDFGIKAAGGRIVFSNDIL
FT                   ADACKTLEKYFPDSTVSCGDIAALHEFPEADVVVGGYPCQSFSMAGNRDPKKDASDTPR
FT                   VP"
FT   gene            complement(681530..682348)
FT                   /locus_tag="XAC0578"
FT   CDS_pept        complement(681530..682348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0578"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35467"
FT                   /db_xref="GOA:Q8NL47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NL47"
FT                   /protein_id="AAM35467.1"
FT                   /translation="MCRVLRVNRAGYYAWLKSPDSERAKEDERLLGLIKHHWLASGSVY
FT                   GHRKIAKDLRDLGERCSRHRVHRLMRTEGLRAQVGYGRKPRFHGGTPCKAAANLLDRQF
FT                   DVTEPDTAWASDFTFIRTHEGWMYLAVVIDLFSRQVVGWAMRDRADTELVVQALLSAVW
FT                   RRKPSAGCLVHSDQGSVYTSDDWRSFLASHGLVCSMSRRGNCHDNAPVESFFGLLKRER
FT                   IRRRIYPTKDAARAEVFDYIEMFYNPQRRHGSTGDLSPVEFERRYAQRGS"
FT   gene            complement(682402..682674)
FT                   /locus_tag="XAC0579"
FT   CDS_pept        complement(682402..682674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0579"
FT                   /product="ISxac3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35468"
FT                   /db_xref="GOA:Q8NKZ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NKZ0"
FT                   /protein_id="AAM35468.1"
FT                   /translation="MSSKRYTDEFKIEAVRQVTDRGFKVAEVAERLGVTTHSLYAWLRK
FT                   FGKPGVVQRAEADQSAEVRRLKIELRRVTEERDILKKAAAYFAKG"
FT   gene            complement(682814..683548)
FT                   /locus_tag="XAC0580"
FT   CDS_pept        complement(682814..683548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0580"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35469"
FT                   /db_xref="GOA:Q8PPV5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV5"
FT                   /protein_id="AAM35469.1"
FT                   /translation="MTIENKVVVIIGAGSGTGRATALHLGALGAKVVLGARREARIAEV
FT                   AMEIVQSGGQAVYRPTDVTVHKQVLALVDLACSQFGRLDVMVNNAGISPLSRFDALQVD
FT                   AWNAMIDVNLRGVLHGIAAALPVFDRQQSGHVINVVSTAGLRIVPTMGVYAATKNAVRT
FT                   ISEALRQESGPHIRVTELSPGMVQSELLHTVSDPTLRQTLQAQSEASGIPAEAIAHAIA
FT                   YAIDQPDDVEVGSLVIRPTSQA"
FT   gene            683619..684542
FT                   /locus_tag="XAC0581"
FT   CDS_pept        683619..684542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0581"
FT                   /product="transcriptional regulator araC family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35470"
FT                   /db_xref="GOA:Q8PPV4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV4"
FT                   /protein_id="AAM35470.1"
FT                   /translation="MVSSQSSKDDPLSQVLAALGARSAGLNRLEARGDWALSLPEKHRL
FT                   KLVALIRGECWIRLPRRAPKRVVEGDVLLIGNTPYVIASDPQRAPVDGVSRYAGQQSLR
FT                   LGDGDDTVLLGAGIVFSGENSGFLIDALPRLMKIQSVSPSAFAVRTTLDLLDAEMGRHR
FT                   MGSARVASCLSEVLVVEAIRAYMHAHTQAHTSWIGALGDRHIGAALALMHGDVAHAWTV
FT                   AELASRVGMSRSAFSSRFSQKVGQAPLHYLTQWRMLLAHRLLAETGLDIARVAERVGYQ
FT                   SPSAFGHAFKRMFGAAPKRLVRPSET"
FT   gene            684791..685102
FT                   /locus_tag="XAC0582"
FT   CDS_pept        684791..685102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0582"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV3"
FT                   /protein_id="AAM35471.1"
FT                   /translation="MTIGNQITARTVTVTAGDTGRASSKVSVELSGRPDPRWQSCFHFV
FT                   VQGRDGFYMEGRPIFDQSNVEGVVPAGQVDAFRHQLPEVLALTNTPARAQANKDADRR"
FT   gene            complement(685191..686756)
FT                   /locus_tag="XAC0583"
FT   CDS_pept        complement(685191..686756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0583"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35472"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV2"
FT                   /protein_id="AAM35472.1"
FT                   /translation="MPNDELPLTDRLRAALDVLEAIDADRSVLDTLPEADRVRLHQVVA
FT                   KVYHPEPKARRQLLKQRERERHQEKVRKAEALLEQRGIRALRRKPVFSTPNYFPPHAAG
FT                   LHDAHNGENATAAPEPTHSPELRHCYVCKQKFTELHHFYDQMCPTCAELNFFKRTETAD
FT                   LRGRVALLTGGRVKIGYQAGLKLLRAGAELIVTTRFPRDSAARYAQEPDFAQWGHRLQV
FT                   FGLDLRHTPSVEAFCNELLATRERLDFIINNACQTVRRPPQFYAHMMAGETAALHELPE
FT                   TVRNLVGHYEGLRTPELLRDASATALPAVHGRGLDSADGLTRAAELSQIALLDDELVGQ
FT                   QHLFPDGRLDQDLQQVDLRGRNSWRLLMAEVPSVELLETQLVNAIAPFIINARLKPLML
FT                   RTPERDKHIVNVSAMEGQFYRNFKTTRHPHTNMAKAALNMMTRTSAADYQNDGIHMNSV
FT                   DTGWVTDEDPAEIAALKVQQERFHPPLDIVDGAARIVDPIIHGFNTGEHVWGQFLKDYA
FT                   PTDW"
FT   gene            687126..687917
FT                   /locus_tag="XAC0584"
FT   CDS_pept        687126..687917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0584"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35473"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV1"
FT                   /protein_id="AAM35473.1"
FT                   /translation="MKTSMLAIGLAGLLCACTVVSPDPGQQAVLVDKPLFFGKGGIRLD
FT                   DVRDPGRTYTWLTTSATYVDVTPQTVQVAFDDFSSSDNILLDFSTQIQYRITAPALLLS
FT                   RFGQDWFKNNVASQYASIVRDQVKRYDMTKMMSDPDTARKIDDSVTQNVSALVKEQGLP
FT                   IQIQNITLGRARPNPDVLQQMNLTAAQQQRVKTLVEATTAERQREQEQEAKADADNAYR
FT                   NRMGLTPEQYLASQIAELNAEACKKAQACYMVPSGTSVIAR"
FT   gene            688055..689029
FT                   /locus_tag="XAC0585"
FT   CDS_pept        688055..689029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35474"
FT                   /db_xref="GOA:Q8PPV0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPV0"
FT                   /protein_id="AAM35474.1"
FT                   /translation="MGLLVDGKWQDRWYDTSKSEGRFERSQSQFRNWVTRDGSAGPHGQ
FT                   GGFQAASGRYHLYVSLACPWAHRTLIFRRLKGLESMIDVSIVHWLMRENGWTFADGPGV
FT                   VGDTEHHAQYLYEVYLKADPHYSGRVTVPVLWDRERKTVVSNESADIIRMFNSAFDEIG
FT                   AADGDFYPQPLREQIDAVNARVYDTVNNGVYKAGFATTQAAYEEAVVPLFESLDWLEAR
FT                   LSAQRYLCGDRLTEADWRLFTTLVRFDAVYVGHFKCNLRRIADYPQLSGFLRELYQMPG
FT                   IADTVNFQHIKRHYYQSHDTINPTGIVPMGPLLDLDAPHGRGG"
FT   gene            689004..689498
FT                   /locus_tag="XAC0586"
FT   CDS_pept        689004..689498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35475"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU9"
FT                   /protein_id="AAM35475.1"
FT                   /translation="MRLMGVAADAHGRYGAAGAVAYAAHPRDQQDDVMLNHVMVGTNDI
FT                   ARARAFYDAVLGGVFSAPAPFVNQAVSGHTRLFYRHAGSTFCVSEPINDEPASPGNGAT
FT                   IGFKCDSPEQVQHFHDIAVAAGGISIEKPPGLRESSMGPTWLAYVRDPDGNKLCAIYRP
FT                   A"
FT   gene            complement(689656..690123)
FT                   /locus_tag="XAC0587"
FT   CDS_pept        complement(689656..690123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35476"
FT                   /db_xref="GOA:Q8PPU8"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU8"
FT                   /protein_id="AAM35476.1"
FT                   /translation="MHMALIHSILMGAVAGMRSMTPLAAVANAARTGKLPADNGAPALL
FT                   ANPLASAGMLALAGGELAGDKMKTAPDRIVLPGMIARIATGVIVGTALAPREQRGIAAL
FT                   LGATTAVAAAYLTFNARMRAIERYGQTSTGVVEDAISVGAATLIVRDAAKR"
FT   gene            complement(690192..690569)
FT                   /locus_tag="XAC0588"
FT   CDS_pept        complement(690192..690569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0588"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU7"
FT                   /protein_id="AAM35477.1"
FT                   /translation="MKTVLLAGLGMALLVGCAKAPAPAPAEAATPQPAVAAHTPAHAPG
FT                   SQRGEGHPYELADTQVWDVPDTVSGRRYIEVPKAMACTAVVNHEHPPLLRSVLHTADTG
FT                   MRAQPMRGVHNVLPTPTHATP"
FT   gene            complement(690624..691244)
FT                   /locus_tag="XAC0589"
FT   CDS_pept        complement(690624..691244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35478"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU6"
FT                   /protein_id="AAM35478.1"
FT                   /translation="MRIAPLLLLLIALLPATALALKVHDGDLLFVTAAHTGLSGAIDDA
FT                   TGVRGQASFDHVALVAHAGDAAVVLHADEHGSREQPLQAFIDEATAKQRQIVVYRLGRA
FT                   HRPAISDAIAQARRMLGKPYNETYVQDDNSYYCSDFIERAFRAHHVFALQPMNFRNLQT
FT                   GKISPYWTDFYRSKGMPVPQDMPGTNPNDMAKTPGLSAIGRLN"
FT   gene            691489..691806
FT                   /locus_tag="XAC0590"
FT   CDS_pept        691489..691806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0590"
FT                   /product="inner membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35479"
FT                   /db_xref="GOA:Q8PPU5"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU5"
FT                   /protein_id="AAM35479.1"
FT                   /translation="MSPIGRLFALAAFFEGLTWAGLLVGMFLKYGPQSTELVVWVFGRL
FT                   HGAAFLFYVAVSMIAALRLRWPWWAWAVSLLAALPPLVTVPLEMWFRRLGLLGQRRPVA
FT                   H"
FT   gene            complement(692208..694691)
FT                   /locus_tag="XAC0591"
FT   CDS_pept        complement(692208..694691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0591"
FT                   /product="dipeptidyl peptidase IV"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35480"
FT                   /db_xref="GOA:Q8PPU4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU4"
FT                   /protein_id="AAM35480.1"
FT                   /translation="MTDLRPLKQLSGHRASPSARHDFWQRHPARVAGSIGRSRRPHCAL
FT                   LSSRRVFMPTIPLPLRHLCIVVALAALPALASAQAPAVTEADYARAERLINYAAQPLVD
FT                   HAVTRIDWLDATHVAYVDHDAKGNRLLQLDTSTGKTAPLFKQAALVASLNTLLKTGDKP
FT                   LKADTFAPMVKVTADGRYRLNVRDTAVVCDARARCSKLYAKDKPEPGVLSPDKRSEAFI
FT                   RDWNLWVRDLAGGQETQLTRDGVENFGYATDNAGWQHTDNAIVAWSPDSRKIATFQQDQ
FT                   RKTGDMYLVSTKLGHPELQAWKYPLAGDKDVTMIERVIIDVPTRSVLRLKTPPDQHRST
FT                   LCDDVSCSPGLWDDEKWAPDSKTLAFASTSRFHKQTWLRIADASTGAVRTAFDETVKTY
FT                   YESGQVAANWAYLPASNEAVWFSERSDWGQLYLYDLATGKPKRAITTGQGNVTELLRVD
FT                   PVTRTAWFVGVGRSAGVDPYYQQLWKVSLDGGEPVLLTPEPANHSIALSPDGARFVDTY
FT                   STSVTPPVTLLREAGDGRTVSTMATADITRLKAAGWVPPEPITVKARDGKTTLYGLMFK
FT                   PTNFDPARKYPVIDYVYPGPQTGSVRGRSFLAGHGDNQSLAELGFIVIAIDGMGTPWRS
FT                   KSFHDTWYADMGDNTLPDQVAGLKELGQRYPWIDLGRVGIWGHSGGGNASTGAMLRYPD
FT                   FFKVAWSESGNHDNRGYEDDWAEKYHGEHIVNKDGTSNYDDQANANHASKLKGRLMLVH
FT                   GTLDDNVPPYLTLLVADALIKANKNFDMLMLPNAKHGYGDLTPYVTRRRWDYFVQYLLG
FT                   ATPPAQYQMQPMPAN"
FT   gene            complement(694897..695988)
FT                   /locus_tag="XAC0592"
FT   CDS_pept        complement(694897..695988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35481"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU3"
FT                   /protein_id="AAM35481.1"
FT                   /translation="MISHLPRALTVLAIALLSACATQAPRAPQRSPEAVKTDIARRLPA
FT                   TLPDRAGWASDVYVALSSQALDTSAEHICAVLAVTEQESSYQANPVVPNLGKISRAEID
FT                   RRAGAHHIPGFMVDAALRLPSPDGRSYATRIAAARTEEELSRIFEDFTGSVPLGARLFD
FT                   GFNPVHTAGPMQVSIAFAEQHAQRYPYPPGDSIRHEVFSRRGGLWFGTQHLLGYPVSYD
FT                   ALLYRFADFNAGWYASRNAAFQAALSKASGIALALDGDLLTPGASLDAPGGTERAARSL
FT                   GSQLAMSDRQLRRALEDGNTADFANSDLYRQVFALAERSAGKPLPRAVLPGITLESPKI
FT                   TRTLTTAWFAQRVNERWKRCMSK"
FT   gene            696440..698368
FT                   /locus_tag="XAC0593"
FT   CDS_pept        696440..698368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35482"
FT                   /db_xref="GOA:Q8PPU2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU2"
FT                   /protein_id="AAM35482.1"
FT                   /translation="MASAWRAHAAARRRRDDAMSMFVVRWRQGLAAFALLLGSGMVSAQ
FT                   PQPWKTIEAATIDDPVVALQIAQGALQRASGDHDVDAEFWALLAQARVLISLEDSERRQ
FT                   VALTQARGRLDQLHGNASQAQLWLDIVQALSDVRENPNRVMVARLEALRQRASALGPND
FT                   LLCEVEAIDMWSMLASGSSDESWNAAQASYQCAAREKLLGLELDALTQLGSLASRVGGR
FT                   AAEDNETEDYLQRALARLHDQPARFQRSLIEYEFGTALATRQPEAALLHFRRALALSRE
FT                   LRDQAGVAAALTSASEALIETGDAASALTMAREALPLMQQQGNIGRVAACHAVLLRALI
FT                   ALKAEGLDAEIVAAKAADDPNLTLHRRAQLVDAIAQALASQGRHAEAYQELQRANALRA
FT                   HSLDRQRDTVMLRLQARYEDARRGAETAELRRRSETAQLALQAREAGQRALWIALCAAC
FT                   LLLLGALVVLAFGARHRRQLSRLAMRDELTGLPNRRAIRTEAQQQIEQALRSHTPGMLA
FT                   LIDLDHFKQINDVYGHATGDTVLKALASASRLALRGQDRLGRLGGEEFLLVLPGCGEEE
FT                   IPTVFTRLRSAVAAIDIAGLPAEEPVRFCMGAVRIVADTGLDALLSQADLALYAAKTAG
FT                   RDQWAVC"
FT   gene            698591..698908
FT                   /locus_tag="XAC0594"
FT   CDS_pept        698591..698908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35483"
FT                   /db_xref="GOA:Q8PPU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU1"
FT                   /protein_id="AAM35483.1"
FT                   /translation="MKTPRPSPLPASERKAARLTDWLVRGVAVVAVIACCGRLWLLREA
FT                   ILAGRYVNVIRGRPARVFLVDSDPHRFWIAVGWDALLSCVPLAIVGGFAYASWNARRQL
FT                   R"
FT   gene            complement(699137..699571)
FT                   /locus_tag="XAC0595"
FT   CDS_pept        complement(699137..699571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35484"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPU0"
FT                   /protein_id="AAM35484.1"
FT                   /translation="MTTRYPVTTATVGGRVIHPGEYQGKCAVLRDGDVMVLSIGAPCCF
FT                   SIDPRHAAQVHRFHGSDVVLVQHAHPTSRPDWDVAVYGPICAFQAQAVRDIGGVLEPGA
FT                   VAGSWHCDPTAGADQKQFVYRYDTWPRHGARRPARTRKAH"
FT   gene            complement(699924..700805)
FT                   /locus_tag="XAC0596"
FT   CDS_pept        complement(699924..700805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35485"
FT                   /db_xref="GOA:Q8PPT9"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT9"
FT                   /protein_id="AAM35485.1"
FT                   /translation="MFRTPHTEPSAVPHYSGPLLLLADAQALLAARGSGLAHWTGSLDL
FT                   GRSTDTAQLGVQTWQWRGQGYPYPGKLKERTLYFWDEDFVPISRYSGALIKLVPTEWGA
FT                   PTFEIDGIKMLPSAQLSPFEDARRKVALVDPRGKIVLDTCGGLGYFAACCLEAGAAQLL
FT                   SFEKNADVLWLRTLNPWSPDPESAAAGGRLQLTHADIAQHIATLADDSVDAILHDPPRF
FT                   GIAGELYSQVFYDQLARVLRRGGRLFHYTGAPNRLTSGRDVPNEVSKRLAKAGFTTQLA
FT                   LDGVLASLPARR"
FT   gene            700994..701878
FT                   /locus_tag="XAC0597"
FT   CDS_pept        700994..701878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35486"
FT                   /db_xref="GOA:Q8PPT8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT8"
FT                   /protein_id="AAM35486.1"
FT                   /translation="MWAMLKGVLLGFACYAAYSISDAFVKLLEGTLPVYEVLFLGALLM
FT                   LLAVPFLKKPDDQLRELVMAKQPALWLLRALTGAIGNLTSVIAFTTLPMAEAFALIFLM
FT                   PIFVTVLSVIFLKEEVHWRRWSAVIVGFIGVLIVLRPGFRHLTHGHVAAIVCGLVGAIS
FT                   VIALRMAGHSEKRLTLYGAGVIGPLVMGGIMMLPSFVWPTLSQWGLLAGYGLLAGLAAI
FT                   CMMYATRMAPVSVVAPTQYSQMLWAIAFGYLLFHDHLDWPMAVGIALILGAGLFTLVRE
FT                   EQVSRWWRRTKIV"
FT   gene            complement(701967..702773)
FT                   /gene="pheC"
FT                   /locus_tag="XAC0598"
FT   CDS_pept        complement(701967..702773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="XAC0598"
FT                   /product="cyclohexadienyl dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35487"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT7"
FT                   /protein_id="AAM35487.1"
FT                   /translation="MPRPRRDHAMRYRICLALLLSCGTTHAATPASRLDAVLQSGVLRV
FT                   CTTGDYRPYSLLRDDGQFEGSDIDLVQSLAASLDARVRLVRTSWPHLLPDLLADRCDIA
FT                   VGGISVTLQRQRQASFSAVLDVDGKIPLVRCVDQARYRTLEQLNRPEVRLIEPPGGTNE
FT                   AFAHRQLPQAALRLFADNTTIFQELLAHRADVMITDASEALYQQARLPGLCAIAPEQPL
FT                   QYSEKAFLLPRDDHAWKAYVDQWLHLTKASGEYRRIVEGWRQPRTE"
FT   gene            complement(702983..703486)
FT                   /locus_tag="XAC0599"
FT   CDS_pept        complement(702983..703486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0599"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35488"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT6"
FT                   /protein_id="AAM35488.1"
FT                   /translation="MASGSLQSSFRHESTPPGEQSWPKRVAQAASAKRKGPRQARHGRA
FT                   GLEARADVGRARCRDDGQRLAPLSLHGQYSTTSEPAAYPPWQRSVILLPQIAHFIIQAT
FT                   ALRRLFLKRRVLLVGIGIGRAMCQNSCVGAGHGGRRAWIQMHEQLRWNSHGSVNARLHR
FT                   ATAP"
FT   gene            703661..705043
FT                   /gene="cycA"
FT                   /locus_tag="XAC0600"
FT   CDS_pept        703661..705043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="XAC0600"
FT                   /product="D-serine/D-alanine/glycine transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35489"
FT                   /db_xref="GOA:Q8PPT5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT5"
FT                   /protein_id="AAM35489.1"
FT                   /translation="MPMSDPSAPDHLQRSLSNRHLQLIAIGGAIGTGLFMGSGKTISLA
FT                   GPSILFVYLIIGAMLFFVMRAMGELLLSNLEYKSFIDFSTDLLGPWAGFFCGWTYWFCW
FT                   IITAIADVIAIAAYAQFWFPGLAPWIPAILCVLLLLGLNLVTVKLFGEMEFWFALIKII
FT                   AIAALIVTGAGLVVWGFRSPSGNVASLSNLWNDGGMFPMGIGGFFAGFQIAVFAFVGIE
FT                   LVGTTAAETADPRRNLPKAINSIPVRILIFYVLALIAIMAVTPWRQVVADKSPFVELFV
FT                   LAGVPAAASLINFVVLTSATSSANSGIFSTSRMLYGLAEEQHAPKGFAKLSRAAIPARG
FT                   LLFSCLCLLLGAMLVYLIPNLVTAFTLVTTLSAVLFMFVWSLILCAYIAYRRKRPEQHA
FT                   ASAFKMPGGVLMCYVCLAFFAFVIVLLTLQDDTRQALLASPVWFLLLAIGYAVKRRGNR
FT                   QR"
FT   gene            complement(705130..706125)
FT                   /locus_tag="XAC0601"
FT   CDS_pept        complement(705130..706125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0601"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT4"
FT                   /protein_id="AAM35490.1"
FT                   /translation="MRISGSASRQRHEHIDPVDPRHAPSVCDDIQIGVHSQLHGLPRMR
FT                   RSASAKERSPAFVADGSHLDALFGSTQPARGKQLKDGSHRTPIQTQEIETPAGGHAHVK
FT                   INPTRLFVSTAPALEMPRRLDPAKLSKDLGLSEDAIDRIRSTPTFHEQTETGAPSVAPL
FT                   ARRLRLDDLRDKKVEYKWNIASNGSLVIGEGHPGVVLDEPMTSKDARKKKQPYAQGHVT
FT                   LVGGQPWNKTPWQENRLIPEARLSGTLYYNTGGELCIDNDSGRFSEYADRTPQHLENVA
FT                   KLFQQYGLPVTPQWKAKKQIPLQRLPAGATVAPPIPAEEGEVAHSDPNGE"
FT   gene            706323..707273
FT                   /gene="corA"
FT                   /locus_tag="XAC0602"
FT   CDS_pept        706323..707273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="XAC0602"
FT                   /product="magnesium and cobalt transport protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35491"
FT                   /db_xref="GOA:Q8PPT3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT3"
FT                   /protein_id="AAM35491.1"
FT                   /translation="MVDAEDAWALSSHSRCMITIHPIARTQHCWVDLCQPSPQELAQAA
FT                   EKVGFALPDRAAIGEIEFSSRVRRQGDVLFLNVPRFQDDDGPTAPLGFALSPSMLVTLR
FT                   EQRIGSLEDFPARLEHAPCHSSDDLLLRMFDQLVGRLADRLEALEAAVTETTRQVFDSP
FT                   HKTKDLERMLHQVGDMGRQLGGLHSAGQGMLRLVTYLDGTAPDWFGADAAKRIASLHKD
FT                   LTTLSEFHQHMDDRIEFLLDSVLGMINIDQNNVMKVMAVASVVGIPPTVLVGIWGMNFA
FT                   YMPELKGHDNYFWALGIIALSVVVPLAWFRKRGWV"
FT   gene            complement(707611..708336)
FT                   /locus_tag="XAC0603"
FT   CDS_pept        complement(707611..708336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35492"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT2"
FT                   /protein_id="AAM35492.1"
FT                   /translation="MRTLSLQDGPMAVRTLNEFLAHSREKDVSPDPFELENPHLLEVRL
FT                   NGMVWSKAGAMVARTGNVKFTREGLLEQGLGNLLKKAVSGEGMQLMKAEGQGRVYLADL
FT                   GKLVTLLRLNGESIFVNGNDVLAFESGVEHKITMMRKVAGMLSGGLFNVRLSGHGIVAI
FT                   TSHYEPLTLPVTATSGPVFTDPNATVAWSGTLTPELVTDVSIGTLFGRGSGESLQMRFS
FT                   GEGWVVVQPYEEASFQAKG"
FT   gene            complement(708731..710437)
FT                   /gene="treA"
FT                   /locus_tag="XAC0604"
FT   CDS_pept        complement(708731..710437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="XAC0604"
FT                   /product="trehalase, periplasmic"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35493"
FT                   /db_xref="GOA:Q8PPT1"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPT1"
FT                   /protein_id="AAM35493.1"
FT                   /translation="MPYATARSGDVMSSAAPPCCTSLLGLSLSMFVAPGTLTAAPLDAP
FT                   VVNAPAPTPPTPDLAYPELFQAVQRGELFDDQKHFVDFLPLRDPALINADYLAQHDHPG
FT                   FDLRKFVDANFEESPPVQTDAIRQDTALREHIDLLWPKLVRSQNHVPPHSSLLALPHPY
FT                   VVPGGRFREVYYWDSYFTMLGLVKSGETTLSRQMLDNFAYLIDTYGHIPNGNRTYYLSR
FT                   SQPPFFSYMVELQAGVEGEAVYQRYLPQLQKEYAYWMQGSDDLQPGQAARHVVRLADGS
FT                   VLNRYWDERDTPRPEAWLHDTRTAAEVTDRPAAEVYRDLRAGAESGWDYTSRWLADGQN
FT                   LRTIRTTAILPIDLNSLLYHLERTLALACAQPGAECTRDYAALAQQRKQAIDAHLWNTA
FT                   GYYADYDWQTRTLSNQVTAAALYPLFAGLASDDHAKRTASTVRKTLLRPGGLATTAVKT
FT                   GQQWDEPNGWAPLQWVAVDGLRRYGEDALARTIGERFLAQVQALFAREHKLVEKYGLET
FT                   DAAGGGGGEYALQDGFGWTNGVTLMLLNLYPGKDTKAAPAKRVRKPEAAAR"
FT   gene            complement(710677..711447)
FT                   /locus_tag="XAC0605"
FT   CDS_pept        complement(710677..711447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35494"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPT0"
FT                   /protein_id="AAM35494.1"
FT                   /translation="MPARPSGAIARVRCGCAGWSIPAADRAQFDEGASVLQRYATRLDA
FT                   VEINSSFYRPHRASTYARWADSVPEDFRFSVKLPRSISHDARLHGTGPLLDAFLAQAGA
FT                   LGTRLGCLLLQLPPSAAFDAAVAARFFAMLRRRWDGGVVCEPRHASWFAAPAQALLARH
FT                   RIARCAADPAPVPAASLPSPAAAPLYWRWHGAPRRYYSSYAHTALQALAATVRASHPGS
FT                   TQPPAERWVIFDNTAAGCATSNALELQRLLRNER"
FT   gene            711552..712304
FT                   /locus_tag="XAC0606"
FT   CDS_pept        711552..712304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0606"
FT                   /product="endonuclease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35495"
FT                   /db_xref="GOA:Q8PPS9"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS9"
FT                   /protein_id="AAM35495.1"
FT                   /translation="MPEGPSLVILREDTQAFVGRKIVRVSGNSKQDIARLDQQKVLALR
FT                   SWGKHFLIEFAHFSVRIHFLLFGSYRINEDKPNAVPRLCLEFSKGQRLNFYACSVQFIE
FT                   RPLDEIYDWTADVMNPLWDAAQARRKLRAAPALLAADALLDQTIFAGVGNIIKNEVLHR
FT                   IRVHPESTVGALPARKLGELVTQARDYSFDFYTWKKAFVLKKHYQVHTKTRCPRDGAPL
FT                   QYRKHLGKAGRRAFFCEVCQRLYRADEA"
FT   gene            712820..713812
FT                   /locus_tag="XAC0607"
FT   CDS_pept        712820..713812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35496"
FT                   /db_xref="GOA:Q8PPS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS8"
FT                   /protein_id="AAM35496.1"
FT                   /translation="MITRRKEALVPHVAAVACTGAILFFLACLLLYMPPPRQTLQHDDT
FT                   LQVYFVPRPQETPPTPQQPPQEPERKPRVASAARAAPPATRTPPPPRQLAAATAPASDS
FT                   MSAQLYTRDGRLRMAQVDPMAQTGSAVPPGMTDERAQAKARKIMERVNPVQYQETRFAK
FT                   DWKSDGTLGDVAVQEMNRGMKKFNDMLNGPQTQVAKARPPPEVRFNPALAGNQAEMGSE
FT                   ATGDAYKSAPIAHETLPDLKGEASRRIREALAALEQRSARCDASRRTSLLSPVRTHLSD
FT                   LERAEHALNNGADPVVAAQMLPRQADSAYDLARRALWYADRQLKQCALG"
FT   gene            complement(714320..715327)
FT                   /gene="phS"
FT                   /locus_tag="XAC0608"
FT   CDS_pept        complement(714320..715327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phS"
FT                   /locus_tag="XAC0608"
FT                   /product="histidine kinase-response regulator hybrid
FT                   protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35497"
FT                   /db_xref="GOA:Q8PPS7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS7"
FT                   /protein_id="AAM35497.1"
FT                   /translation="MAASTPRCRRCRYPCGFRVRACLAYSMKDMPVADEASRQHVLDGY
FT                   RIVDSLPEDTYQDVVQVAASLCDTPIALMSLVDRDRQWFKAQLGLGVQQTDRSQAVCDH
FT                   AIRSPEQLMEVPDLREDSRFADISVVTGDTGARFYAGMPLVTSDGVALGTVCVLDTEPR
FT                   TLTELQRTGLQALARVAMRLLDERKRELQLERDAILQPVAPVASQAVADTGYHLVILEV
FT                   QELAALAERQSERLLGRNLQQLDQALAALVQGPGNSIDRVTDSAEFIAVLRGPDAERTL
FT                   QSLREIAQQQHALGLTVLLGQAQSTGPDEPIGQVFLRAEVALSAEKDRYRQRLA"
FT   gene            complement(715790..718669)
FT                   /locus_tag="XAC0609"
FT   CDS_pept        complement(715790..718669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0609"
FT                   /product="zinc protease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35498"
FT                   /db_xref="GOA:Q8PPS6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS6"
FT                   /protein_id="AAM35498.1"
FT                   /translation="MLRPLPLLIAGVLGVAAGSVAPAVAAAPASLSKSAASSAIPDIAY
FT                   TRLTLPNGLTVVVHEDHKAPVVAVSIWYHIGSGDEPAGKTGFAHLFEHLMFSGSENNKG
FT                   SFFAPLEKVGTTDMNGTTWFDRTNYFETVPTTALDTALWLESDRMGHLLGAIGQQELDT
FT                   QRGVVQNEKRQGENRPYGRVDQNILSNLFPANHPYQHDTIGSMEDLDAASLADVKQWFN
FT                   DNYGAANTTLVLAGDITVAQARAKALQYFGDIPSGKPVARQQPWVTPLATQKRGVQHDH
FT                   VSQPRIYRTWAAPQLGTDDLIQLDLATTVLGGGKTSRLYQRLVYQDNLVDDVSASVQPF
FT                   ALSSQVQIQADVKDGVDPAKVEAIIDEELKKFIAQGPTADELQRAQVAYRAGFVRGLEK
FT                   VGGFTGKAVILAEGQVYRGDPGAYKKDLQRAQAATADSVKQASATWFGRGDYLLTVLPA
FT                   GKDFDPAAEDKAVVARGEEPGKPAPKLPAAGTFKVTASTLDRSKGVPQTDRFPDLSFPK
FT                   LQRGKLKNGIEVILAERHTIPVTQVELLFDAGYAADQGGKLGTASFSAALMNESTTALD
FT                   SVDVAQRRQRLGAITAVGCDLDSCSASLDALNDQLQPSLQLFSDIVRNPAFKAADIERV
FT                   RGQWLSGIAQEKTQPNSLALRALPPLLFGNQHPYGIPLTGSGTEAAVKSLNAQDLQNFH
FT                   SQWLRPDNLRILVAGDTTLAQIIPQLDATFGDWKTPTTALPKKNLANVAAQPKPRVYLI
FT                   NRPDAPQSVILAGLLAPSTKAPDNLAIGVANGAFGGTFTSRLNMNLRENKRWAYGAGTR
FT                   MMDAQGQRPYLFSAPVQTDKTAESANEILKEATAIIGDKPLTADEIEKIKNQRIRALPG
FT                   SFETTGAVLGAIEGIVQFDRPDDYVQTLKPRLEAIDQPAAQKAIKEIIAPNAMTWVIVG
FT                   DLKKIEAPVRALKLGEVQVLDVDGKPVKR"
FT   gene            718872..721514
FT                   /locus_tag="XAC0610"
FT   CDS_pept        718872..721514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0610"
FT                   /product="histidine kinase-response regulator hybrid
FT                   protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35499"
FT                   /db_xref="GOA:Q8PPS5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS5"
FT                   /protein_id="AAM35499.1"
FT                   /translation="MLVASPLPGATYSDQTPPVDHVMTVLLPPVPIPVDDALRVDAVRR
FT                   LGVLDTEAEVEFDDIAWLAAHVSGAPMAMVSLLDADRQWFKARCGTDLEGTPRSVSFCS
FT                   HAVMGTELMEVPDAEADPRFVNNPLVVAAPGVRSYVGVPLIGREGYAYGTLCTLSTTPR
FT                   VLDENRKQALIRLARQAVNKLEARRDRLDAQAQRQTLSMLLEAMPDGVVACGTDGLLRE
FT                   FNHAARQWHGTDPRLLPPEQWALHFDLYTADGNSLLPTEEIPLLRAWRGEHVRNAELVI
FT                   RATNQPPRSVLCNADPVVGEQGTALGAVCVMHDITQLKDASAALAGERARLQALVDASQ
FT                   DVAIMAFDPHGRLELFNPGAERLLGYRADEVLGTCPVRFHLPAELERHMATLALSPPSY
FT                   VKLAAAAAGDVLAEELWTLVRKDGDLRRVRLCFNIIHDAQQGLAGYLAMAIDVTAELQA
FT                   QAAAQLAAERFAGAFETAPQGMAIVSLEGDWRDVNPALCGILGYPREQLLRTTFQQITH
FT                   PDDLEMDLQLVHDLIDGKRDSYSLAKRYISQHGAVIWAQLSVSLVRDSSGAPVHFVSQI
FT                   QDVTERHVAAERLAESEARLRAISDATPTLVAQFDAVQRYLFANEAHRHWLGVEPAGLV
FT                   GRHITEVLGEDLSTAARAALAQVVAGQRASFEHVLGGSAPRDVEVTLVPETQTATPTQG
FT                   FFLMAHDVTAHKTLHRLMHERATRDALTGLPNRHAWSEALQVAVAQAQQQQRSVAVMFL
FT                   DLDGFKRINDVYGHRAGDAVLVAFGSCLQRAAGERYLVARLAGDEFVVLLDGLQDAQAE
FT                   CAAVAERIRTLAAEGATFGDQHLPIQPSIGMAWQYGAQAEASSLMHAADEAMYAAKRAR
FT                   QPDGHAPRS"
FT   gene            complement(722047..724059)
FT                   /gene="tsr"
FT                   /locus_tag="XAC0611"
FT   CDS_pept        complement(722047..724059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /locus_tag="XAC0611"
FT                   /product="chemotaxis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35500"
FT                   /db_xref="GOA:Q8PPS4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS4"
FT                   /protein_id="AAM35500.1"
FT                   /translation="MQHYADKVKAGELSLEQAKEAARTTLADMRTNDGVDYFFIVDPQM
FT                   RILMHPKRPVGTDMTDYKSDAGQYVYRDIKTAIDSGDGFSYYDAPKPGKKEQLPKISYA
FT                   KTFPAWNWVLVMGVYAEDIQVQAWGFTRTLTLIGGALVALVIGLCWLIASAMAAPLRAA
FT                   SRTAEAIASGRFDNDIRVESRDETGQLMHSMQQMQNQLQRFNGEMQTMIRLQQGENIAH
FT                   RIPEDFPGDYGTLAHGVNTVVFEHLDAINEAMDVMSDYGRGDLRRDMRRLPGQRAALHQ
FT                   ALDTVKENLSAINSDIARLADAAARGDFSARGDQSHYQFAFAEMVQALNRLMQQADAGL
FT                   DDVGRIMAAIADGDLSQRVESHYEGAFGRLADAANRTAIQLTGIVQGIQHSAEMINTAA
FT                   GEIASGNADLSTRTEHQAANLEETAASMEELTSTVRQNADNARQANQLVKGTGDVAESG
FT                   GRVVQEVVSTMQAITQSSARISDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ATEVRALAQRSAGAAKEIKQLISDSVEKVAQGSELVQQAGSTMTEVVSSVKRVTDIMAE
FT                   ITAASTEQSAGIEQVSTTVMQLDEMTQQNAALVEEATAAARSMEDQAADLTRAVAVFRL
FT                   TSDAGQQQARSAANAPATTKPAAARQAAHDHRLRA"
FT   gene            complement(724505..725929)
FT                   /gene="engXCA"
FT                   /locus_tag="XAC0612"
FT   CDS_pept        complement(724505..725929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engXCA"
FT                   /locus_tag="XAC0612"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35501"
FT                   /db_xref="GOA:Q8PPS3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS3"
FT                   /protein_id="AAM35501.1"
FT                   /translation="MSIFRAASTLALATMLALTSAPAFSYSVSNNKIVDDNGNVVQLKG
FT                   VNVFGFETGNHVMHGLWARNWKEMINQMQGLGFNAVRLPFCPATLRSGQMPSSIDYSRN
FT                   ADLQGLTSLQILDKVINEFNARGMYVLLDHHTPDCGAISELWYTSSYSEAQWLDDLRFV
FT                   ANRYKNVPSVIGVDLKNEPHGAATWGTGNAATDWNTAAERGSAAVLAVAPKWIIAVEGI
FT                   TDNPVCSTNGGIFWGGNLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNM
FT                   PAIWDRHFGQFAGSHALLLGEFGGKYGEGDARDKVWQDALVKYLRSKGINEGFYWSWNP
FT                   NSGDTGGILRDDWTSVREDKMTLLRTLWGTVSNSTPTPTPTPTPTPTPTPSAGFGTKVI
FT                   PDSTWNGGYCNRVQVTNTGTASGNWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDYNR
FT                   TLAPGATAEFGFCAAG"
FT   gene            726142..727629
FT                   /gene="ybaR"
FT                   /locus_tag="XAC0613"
FT   CDS_pept        726142..727629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="XAC0613"
FT                   /product="sulfate permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35502"
FT                   /db_xref="GOA:Q8PPS2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS2"
FT                   /protein_id="AAM35502.1"
FT                   /translation="MSLLRAELAQWRASPARELMAGAVATFALIPEVIAFAFVAGVDPQ
FT                   VGLFASFVIGIVIAFCGGRPAMISAAAGSVALVAAPLVAAHGLPYLLAAGWLAGVVQIL
FT                   FGVLRLGVLMRFVSSSVRTGFVNALAVLIFAAQLPHLLGANPTTWVMLGAGLAIIYGLP
FT                   RLRLPGLSAIPSPLLCILLLSVAGTALHLPLKTVADLGKLPNALPFLQWPAVPLTLETL
FT                   RIIALPALAIAMVGLLESMMTARVVDELTDTPSNKNRECTGLGIANAAASLFGGIAGCG
FT                   MIGQTVGNVKYGGRGRLSTLFAGVFLLILMVLLKPWVSQVPVVALVAIMVMVSAETFDW
FT                   RSLRTVVTHPRTSSVVMLATVAVTLFTHNLAAGVAVGVLLSGVFFTFKVAGLLQIAHHD
FT                   GADGVRTYSVRGQVFFASADVFIDAFDAREVPGRAVVIDVGRAHFWDITAVAALDKVVQ
FT                   RLRHHGLDVQVKGLNAGSRRLMQRHALGEDALESALP"
FT   gene            728125..729105
FT                   /locus_tag="XAC0614"
FT   CDS_pept        728125..729105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0614"
FT                   /product="GGDEF family protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35503"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS1"
FT                   /protein_id="AAM35503.1"
FT                   /translation="MTNAPLLERMVDLTAIRDADLLDLSLLRTVREVCAAEELSLLRIA
FT                   PDSNSIAETRLRDDGRLALTVAEIHDARTRTQLAEVHGPGDVVQLQEDGRALLVYPMME
FT                   ARGIRTCLRVGGTRIPGLAEQAMLQGFARFFQNYRSLLDDAQRNALTGLRNRKTFDDVI
FT                   LRLFAGGADSAAEQGVWLGIVDIDHFKRVNDTFGHLYGDEVLLLVAQLMQRAFRQDDLL
FT                   FRFGGEEFVIVLRGVDRDTAVSLFERFRLAVAEHLFPQVGQVTLSTGIVELTHGRLISE
FT                   MLDEADKALYWAKQNGRNRAAVYAELIAGGQLQQVAQPVGSVDLF"
FT   gene            729469..731118
FT                   /locus_tag="XAC0615"
FT   CDS_pept        729469..731118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0615"
FT                   /product="aminopeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35504"
FT                   /db_xref="GOA:Q8PPS0"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPS0"
FT                   /protein_id="AAM35504.1"
FT                   /translation="MKRVAVGLLAMAVSTALMAATPSFDGARISRDVKELASDAYEGRG
FT                   PATAGEEKTIAYLSKQFAEAGLQPGGDLANGKRAWTQAVPLRRADIVGTPTIAVQSAGQ
FT                   PQTLTQGKQIAIRAALDGSSTVEIANAPLVFVGYGVKAPERNWDDFKGVDLKGKIAVVL
FT                   INDPDFETGKGDFDGAGMTYYGRWTYKYEEGARQGALGVLVVHETAPASYGWDTVASSN
FT                   TNTMFDVVRDNPRSAHPTLEGWIQRDLATELFKHAGLDFETLKKQAQTRGFKPVELKGQ
FT                   RLSASYQVKSDVITSHNVVARLEGSKHPDETVIYSAHWDHIGVGKPDARGDTIFNGALD
FT                   NASGTAALLELARGFAKGPTPERSVVFLAVTAEEKGLLGSEFYASKPLYPLDTTVAVIN
FT                   MDGMNPFVPSRDFGIYGTAKLELLDQLKSVAAQSKLRYTPDPKPQAGYFFRSDHFSFAK
FT                   RGVPALSYAAGQDWEVGGVAAGKAAADDYTAKRYHQQGDEWKPDWTFAGAARDLGVLYA
FT                   LGQQLADSRQWPNWSQDSQFRATRDASAAARK"
FT   gene            complement(731246..731842)
FT                   /locus_tag="XAC0616"
FT   CDS_pept        complement(731246..731842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0616"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR9"
FT                   /protein_id="AAM35505.1"
FT                   /translation="MRWSDVLKACGNSVIGRVCGVLTLQAVDRWPGRRLVAHGLRLLMQ
FT                   QLDQGIDERRFRTFGWSEQAVRLKPDMYCLPMPYAPTTTTGPCPPTVARPGRHGCRHGA
FT                   DRDVLVACPAVVGGQGPCSNAQARLVTTSLLAPSSHLQMRSVRVRERSAIFKPGVSRAQ
FT                   CPRRLQDTPRLHPWGSRAASVPQAARRLQDVRRLL"
FT   gene            complement(731800..732270)
FT                   /locus_tag="XAC0617"
FT   CDS_pept        complement(731800..732270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0617"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35506"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR8"
FT                   /protein_id="AAM35506.1"
FT                   /translation="MQCDVAWHTAERASPTLYDQDALKPLRCTSSPGCNLTSQLILKNR
FT                   PLKERTPRTVFALPHEDRAADYAAPTERNPNRLQPSADAVTGRWPGHPAGELQLVCHDV
FT                   QSVAATGLWRCVVPMRSKAWGKRSVGRSKSLEALWSSSHCGGRTFSRPAATA"
FT   gene            732370..734268
FT                   /gene="hrpM"
FT                   /gene_synonym="mdoH"
FT                   /locus_tag="XAC0618"
FT   CDS_pept        732370..734268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpM"
FT                   /gene_synonym="mdoH"
FT                   /locus_tag="XAC0618"
FT                   /product="periplasmic glucan biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35507"
FT                   /db_xref="GOA:Q8PPR7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPR7"
FT                   /protein_id="AAM35507.1"
FT                   /translation="MPPVSALDAGTPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIG
FT                   VRRFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFAWIAMSFASAVAGF
FT                   VTVVARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEH
FT                   FDFFVLSDTTREHIGRAEELVYNALCDRVGGHGRIFYRRRADNAARKAGNVADWVRRFG
FT                   GSYPQMLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRV
FT                   YGPIIAFGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAA
FT                   LMRRGGWAMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVGAKGLHWISRMH
FT                   MLIGIGHYFTAPMWGLLMLIGIGIPLAGGDIDLAGDLPFSPARYWHGSSQGNAIWIFVC
FT                   TMFVLLAPKLLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVF
FT                   EVLAGKDSGWDAQVRDDGKLSWPALLRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIV
FT                   GMALSIPVVALTSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI"
FT   gene            734423..735091
FT                   /locus_tag="XAC0619"
FT   CDS_pept        734423..735091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0619"
FT                   /product="carboxylesterase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35508"
FT                   /db_xref="GOA:Q8PPR6"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR6"
FT                   /protein_id="AAM35508.1"
FT                   /translation="MMLEVIERETGPNPQWSVLWLHGLGADGSDFAPMVPELVRPQWPA
FT                   LRFVFPHAPIRPITINNGVRMRGWYDIVGMDFAQRADKAGIAESVAQVEALIAREQGRG
FT                   IAPERILLAGFSQGGAVTLAVGLQRSVPLAGLIAMSTYLPDPAAAASQLQPAALRQPLF
FT                   MAHGTADPVVPLAAGQASMQTLRTLGFALDWHTYPMGHQVCLEEIEALRDWLQARFTAA
FT                   "
FT   gene            735096..736148
FT                   /gene="algZ"
FT                   /locus_tag="XAC0620"
FT   CDS_pept        735096..736148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algZ"
FT                   /locus_tag="XAC0620"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35509"
FT                   /db_xref="GOA:Q8PPR5"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR5"
FT                   /protein_id="AAM35509.1"
FT                   /translation="MAQRAPQIAWMPDLCRLPRLGAMLGLAELVVLVVTLVPDAGAARS
FT                   ITLSRFLSASGLALWLALAVTVLLCVLRPTLSRLPPRLGGLSALLIAAVVAMFGAGIVH
FT                   GLYAVLGQVPLGAQVGFWRFTLGSAATVVLITALALRYFYVSDRWEAQVQANARAEADA
FT                   LQARIRPHFLFNSMNLIASLLRRDPVVAEQAVLDLSDLFRAALGAGEGVSTLRAECELA
FT                   ERYLAIESLRLGERLQVRWHRQEPLPWDLPMPRLVLQPLVENAVLHGVSRMPEGGTLYL
FT                   SLRQRGNQLQIRIVNPAPQPGTQLPLLAGAGHAQASISHRLAFQFGAGARMAASWAEGY
FT                   YACEITLPLP"
FT   gene            736179..736916
FT                   /gene="algR"
FT                   /locus_tag="XAC0621"
FT   CDS_pept        736179..736916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="XAC0621"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35510"
FT                   /db_xref="GOA:Q8PPR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR4"
FT                   /protein_id="AAM35510.1"
FT                   /translation="MTATQVRVLIADDEPLARERLRMLLGEHPQVEVIGEAENGQQVLQ
FT                   QCEHLHPDLVLLDIAMPGVDGLETARLLRQSQPPPAVVFCTAYDQHALSAFDAAALDYL
FT                   MKPVRPERLASALEKVATFLAGRVPGTAPRPLRTHLCARLRGSLRLIAIGDIRYLQAEE
FT                   KYVIVHHTRGEDLIEESLKSLEDEFADRLVRIHRNCLVARDELVELRRSGDGQVHAVLR
FT                   NVPQTLEVSRRCVASLRDQLRQL"
FT   gene            736947..737861
FT                   /gene="hemC"
FT                   /locus_tag="XAC0622"
FT   CDS_pept        736947..737861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="XAC0622"
FT                   /product="porphobilinogen deaminase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35511"
FT                   /db_xref="GOA:Q8PPR3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8PPR3"
FT                   /protein_id="AAM35511.1"
FT                   /translation="MTTLRIATRKSPLALWQSEHVADALRQHHPGLEVVLVPMSTRGDE
FT                   VLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELDEPFVLPAILERGDPAD
FT                   ALVSNLYASLQALPLGARVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYD
FT                   AIVLACAGLQRLGLEARISARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRT
FT                   RVCVEAERAMNRALHGSCHVPVAAFARWEGQDLFLQGMVGSASDGRLIHADAHGSADDT
FT                   EALGRRVAQGLFDKGAAQLLAEL"
FT   gene            complement(737991..738791)
FT                   /locus_tag="XAC0623"
FT   CDS_pept        complement(737991..738791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35512"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q8PPR2"
FT                   /protein_id="AAM35512.1"
FT                   /translation="MSRRVPLPALLPLLLITPSVWAQAVAPAPADPAAVVLPSPWSGSS
FT                   GELGYAAAHGNSTTDSLNGRVRLRYTDGDWIHSLDATALRSSSEYTNTNDDGSTTRERQ
FT                   TTAERYTGSVGSALQLGEHRQLTATGRYEHDDFATYDRLATFGIGYGTRLIDADRFYLD
FT                   AQVGPGVRRAHNSDEDRNETGLIGRGLFDLKYTVTDNTDLINTLLVESGEYNTYAQNDF
FT                   GVQVSMNSHFALKAAWQMRHNSDVSDGDKKTDTLTTVNLVYTFK"
FT   gene            738804..739340
FT                   /locus_tag="XAC0624"
FT   CDS_pept        738804..739340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XAC0624"
FT                   /product="hypothetical protein"
FT                   /note="putative; ORF located using Glimmer/Genemark"
FT                   /db_xref="EnsemblGenomes-Gn:XAC0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAM35513"
FT                   /db_xref="UniProtKB/TrEMBL: