(data stored in SCRATCH zone)

EMBL: AE009440

ID   AE009440; SV 1; circular; genomic DNA; STD; PRO; 1225935 BP.
XX
AC   AE009440; AE017157-AE017160;
XX
PR   Project:PRJNA420;
XX
DT   29-JUL-2003 (Rel. 76, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Chlamydophila pneumoniae TW-183, complete genome.
XX
KW   .
XX
OS   Chlamydia pneumoniae TW-183
OC   Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae;
OC   Chlamydia/Chlamydophila group; Chlamydia.
XX
RN   [1]
RP   1-1225935
RA   Geng M.M., Schuhmacher A., Muehldorfer I., Bensch K.W., Schaefer K.P.,
RA   Schneider S., Pohl T., Essig A., Marre R., Melchers K.;
RT   "The genome sequence of Chlamydia pneumoniae TW183 and comparison with
RT   other Chlamydia strains based on whole genome sequence analysis";
RL   Unpublished.
XX
RN   [2]
RP   1-1225935
RA   Geng M.M., Schuhmacher A., Muehldorfer I., Bensch K.W., Schaefer K.P.,
RA   Schneider S., Pohl T., Melchers K.;
RT   ;
RL   Submitted (28-MAY-2002) to the INSDC.
RL   RDR/IT, RDR/FG, RDR/BT, ALTANA Pharma, Byk-Gulden-Str. 2, Konstanz 78467,
RL   Germany
XX
DR   MD5; e99497a8765420a132d96b0d2d407176.
DR   BioSample; SAMN02602979.
DR   EnsemblGenomes-Gn; CpBr01.
DR   EnsemblGenomes-Gn; CpBr02.
DR   EnsemblGenomes-Gn; CpBr03.
DR   EnsemblGenomes-Gn; CpBt01.
DR   EnsemblGenomes-Gn; CpBt02.
DR   EnsemblGenomes-Gn; CpBt03.
DR   EnsemblGenomes-Gn; CpBt04.
DR   EnsemblGenomes-Gn; CpBt05.
DR   EnsemblGenomes-Gn; CpBt06.
DR   EnsemblGenomes-Gn; CpBt07.
DR   EnsemblGenomes-Gn; CpBt08.
DR   EnsemblGenomes-Gn; CpBt09.
DR   EnsemblGenomes-Gn; CpBt10.
DR   EnsemblGenomes-Gn; CpBt11.
DR   EnsemblGenomes-Gn; CpBt12.
DR   EnsemblGenomes-Gn; CpBt13.
DR   EnsemblGenomes-Gn; CpBt14.
DR   EnsemblGenomes-Gn; CpBt15.
DR   EnsemblGenomes-Gn; CpBt16.
DR   EnsemblGenomes-Gn; CpBt17.
DR   EnsemblGenomes-Gn; CpBt18.
DR   EnsemblGenomes-Gn; CpBt19.
DR   EnsemblGenomes-Gn; CpBt20.
DR   EnsemblGenomes-Gn; CpBt21.
DR   EnsemblGenomes-Gn; CpBt22.
DR   EnsemblGenomes-Gn; CpBt23.
DR   EnsemblGenomes-Gn; CpBt24.
DR   EnsemblGenomes-Gn; CpBt25.
DR   EnsemblGenomes-Gn; CpBt26.
DR   EnsemblGenomes-Gn; CpBt27.
DR   EnsemblGenomes-Gn; CpBt28.
DR   EnsemblGenomes-Gn; CpBt29.
DR   EnsemblGenomes-Gn; CpBt30.
DR   EnsemblGenomes-Gn; CpBt31.
DR   EnsemblGenomes-Gn; CpBt32.
DR   EnsemblGenomes-Gn; CpBt33.
DR   EnsemblGenomes-Gn; CpBt34.
DR   EnsemblGenomes-Gn; CpBt35.
DR   EnsemblGenomes-Gn; CpBt36.
DR   EnsemblGenomes-Gn; CpBt37.
DR   EnsemblGenomes-Gn; CpBt38.
DR   EnsemblGenomes-Gn; EBG00001068299.
DR   EnsemblGenomes-Gn; EBG00001068300.
DR   EnsemblGenomes-Gn; EBG00001068301.
DR   EnsemblGenomes-Gn; EBG00001068302.
DR   EnsemblGenomes-Gn; EBG00001068303.
DR   EnsemblGenomes-Gn; EBG00001068304.
DR   EnsemblGenomes-Gn; EBG00001068305.
DR   EnsemblGenomes-Gn; EBG00001068306.
DR   EnsemblGenomes-Gn; EBG00001068307.
DR   EnsemblGenomes-Gn; EBG00001068308.
DR   EnsemblGenomes-Gn; EBG00001068309.
DR   EnsemblGenomes-Gn; EBG00001068310.
DR   EnsemblGenomes-Gn; EBG00001068311.
DR   EnsemblGenomes-Gn; EBG00001068312.
DR   EnsemblGenomes-Gn; EBG00001068313.
DR   EnsemblGenomes-Gn; EBG00001068314.
DR   EnsemblGenomes-Gn; EBG00001068315.
DR   EnsemblGenomes-Gn; EBG00001068316.
DR   EnsemblGenomes-Gn; EBG00001068317.
DR   EnsemblGenomes-Gn; EBG00001068318.
DR   EnsemblGenomes-Gn; EBG00001068319.
DR   EnsemblGenomes-Gn; EBG00001068320.
DR   EnsemblGenomes-Gn; EBG00001068321.
DR   EnsemblGenomes-Gn; EBG00001068322.
DR   EnsemblGenomes-Gn; EBG00001068323.
DR   EnsemblGenomes-Gn; EBG00001068324.
DR   EnsemblGenomes-Gn; EBG00001068325.
DR   EnsemblGenomes-Gn; EBG00001068326.
DR   EnsemblGenomes-Gn; EBG00001068327.
DR   EnsemblGenomes-Gn; EBG00001068328.
DR   EnsemblGenomes-Gn; EBG00001068329.
DR   EnsemblGenomes-Gn; EBG00001068330.
DR   EnsemblGenomes-Gn; EBG00001068331.
DR   EnsemblGenomes-Gn; EBG00001068332.
DR   EnsemblGenomes-Gn; EBG00001068333.
DR   EnsemblGenomes-Gn; EBG00001068334.
DR   EnsemblGenomes-Gn; EBG00001068335.
DR   EnsemblGenomes-Gn; EBG00001068336.
DR   EnsemblGenomes-Gn; EBG00001068337.
DR   EnsemblGenomes-Gn; EBG00001068338.
DR   EnsemblGenomes-Gn; EBG00001068339.
DR   EnsemblGenomes-Gn; EBG00001068340.
DR   EnsemblGenomes-Gn; EBG00001068341.
DR   EnsemblGenomes-Gn; EBG00001068342.
DR   EnsemblGenomes-Gn; EBG00001068343.
DR   EnsemblGenomes-Tr; CpBr01-1.
DR   EnsemblGenomes-Tr; CpBr02-1.
DR   EnsemblGenomes-Tr; CpBr03-1.
DR   EnsemblGenomes-Tr; CpBt01-1.
DR   EnsemblGenomes-Tr; CpBt02-1.
DR   EnsemblGenomes-Tr; CpBt03-1.
DR   EnsemblGenomes-Tr; CpBt04-1.
DR   EnsemblGenomes-Tr; CpBt05-1.
DR   EnsemblGenomes-Tr; CpBt06-1.
DR   EnsemblGenomes-Tr; CpBt07-1.
DR   EnsemblGenomes-Tr; CpBt08-1.
DR   EnsemblGenomes-Tr; CpBt09-1.
DR   EnsemblGenomes-Tr; CpBt10-1.
DR   EnsemblGenomes-Tr; CpBt11-1.
DR   EnsemblGenomes-Tr; CpBt12-1.
DR   EnsemblGenomes-Tr; CpBt13-1.
DR   EnsemblGenomes-Tr; CpBt14-1.
DR   EnsemblGenomes-Tr; CpBt15-1.
DR   EnsemblGenomes-Tr; CpBt16-1.
DR   EnsemblGenomes-Tr; CpBt17-1.
DR   EnsemblGenomes-Tr; CpBt18-1.
DR   EnsemblGenomes-Tr; CpBt19-1.
DR   EnsemblGenomes-Tr; CpBt20-1.
DR   EnsemblGenomes-Tr; CpBt21-1.
DR   EnsemblGenomes-Tr; CpBt22-1.
DR   EnsemblGenomes-Tr; CpBt23-1.
DR   EnsemblGenomes-Tr; CpBt24-1.
DR   EnsemblGenomes-Tr; CpBt25-1.
DR   EnsemblGenomes-Tr; CpBt26-1.
DR   EnsemblGenomes-Tr; CpBt27-1.
DR   EnsemblGenomes-Tr; CpBt28-1.
DR   EnsemblGenomes-Tr; CpBt29-1.
DR   EnsemblGenomes-Tr; CpBt30-1.
DR   EnsemblGenomes-Tr; CpBt31-1.
DR   EnsemblGenomes-Tr; CpBt32-1.
DR   EnsemblGenomes-Tr; CpBt33-1.
DR   EnsemblGenomes-Tr; CpBt34-1.
DR   EnsemblGenomes-Tr; CpBt35-1.
DR   EnsemblGenomes-Tr; CpBt36-1.
DR   EnsemblGenomes-Tr; CpBt37-1.
DR   EnsemblGenomes-Tr; CpBt38-1.
DR   EnsemblGenomes-Tr; EBT00001671314.
DR   EnsemblGenomes-Tr; EBT00001671315.
DR   EnsemblGenomes-Tr; EBT00001671316.
DR   EnsemblGenomes-Tr; EBT00001671317.
DR   EnsemblGenomes-Tr; EBT00001671318.
DR   EnsemblGenomes-Tr; EBT00001671319.
DR   EnsemblGenomes-Tr; EBT00001671320.
DR   EnsemblGenomes-Tr; EBT00001671321.
DR   EnsemblGenomes-Tr; EBT00001671322.
DR   EnsemblGenomes-Tr; EBT00001671323.
DR   EnsemblGenomes-Tr; EBT00001671324.
DR   EnsemblGenomes-Tr; EBT00001671325.
DR   EnsemblGenomes-Tr; EBT00001671326.
DR   EnsemblGenomes-Tr; EBT00001671327.
DR   EnsemblGenomes-Tr; EBT00001671328.
DR   EnsemblGenomes-Tr; EBT00001671329.
DR   EnsemblGenomes-Tr; EBT00001671330.
DR   EnsemblGenomes-Tr; EBT00001671331.
DR   EnsemblGenomes-Tr; EBT00001671332.
DR   EnsemblGenomes-Tr; EBT00001671333.
DR   EnsemblGenomes-Tr; EBT00001671334.
DR   EnsemblGenomes-Tr; EBT00001671335.
DR   EnsemblGenomes-Tr; EBT00001671336.
DR   EnsemblGenomes-Tr; EBT00001671337.
DR   EnsemblGenomes-Tr; EBT00001671338.
DR   EnsemblGenomes-Tr; EBT00001671339.
DR   EnsemblGenomes-Tr; EBT00001671340.
DR   EnsemblGenomes-Tr; EBT00001671341.
DR   EnsemblGenomes-Tr; EBT00001671342.
DR   EnsemblGenomes-Tr; EBT00001671343.
DR   EnsemblGenomes-Tr; EBT00001671344.
DR   EnsemblGenomes-Tr; EBT00001671345.
DR   EnsemblGenomes-Tr; EBT00001671346.
DR   EnsemblGenomes-Tr; EBT00001671347.
DR   EnsemblGenomes-Tr; EBT00001671348.
DR   EnsemblGenomes-Tr; EBT00001671349.
DR   EnsemblGenomes-Tr; EBT00001671350.
DR   EnsemblGenomes-Tr; EBT00001671351.
DR   EnsemblGenomes-Tr; EBT00001671352.
DR   EnsemblGenomes-Tr; EBT00001671353.
DR   EnsemblGenomes-Tr; EBT00001671354.
DR   EnsemblGenomes-Tr; EBT00001671355.
DR   EnsemblGenomes-Tr; EBT00001671356.
DR   EnsemblGenomes-Tr; EBT00001671357.
DR   EnsemblGenomes-Tr; EBT00001671358.
DR   EuropePMC; PMC2786552; 19749045.
DR   EuropePMC; PMC3091639; 20646324.
DR   EuropePMC; PMC3187304; 21849688.
DR   EuropePMC; PMC3323650; 22506068.
DR   EuropePMC; PMC3852251; 24099147.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE009440.
DR   SILVA-SSU; AE009440.
DR   StrainInfo; 302230; 1.
XX
CC   On or before Feb 27, 2009 this sequence version replaced
CC   gi:33235843, gi:33236121, gi:33236383, gi:33236669.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1225935
FT                   /organism="Chlamydia pneumoniae TW-183"
FT                   /strain="TW-183"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Chlamydophila pneumoniae; biovar:
FT                   TWAR"
FT                   /db_xref="taxon:182082"
FT   gene            complement(1..282)
FT                   /locus_tag="CpB0001"
FT   CDS_pept        complement(1..282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0001"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT001 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97934"
FT                   /protein_id="AAP97934.1"
FT                   /translation="MLGKIIRGLSSLIVILCALNVGLIGITHNKLNIIAKLCGGVSTPA
FT                   TQITYIIIGIAGVICLLSFCPFCSKKSRHSHGDSCSSGGCHSHHSDKN"
FT   gene            417..569
FT                   /locus_tag="CpB0002"
FT   CDS_pept        417..569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97935"
FT                   /protein_id="AAP97935.1"
FT                   /translation="MFKKFLNCKQLPVFMIRETVQNKNFNFLSLDNLSLLALRKEHIFI
FT                   SRNLG"
FT   gene            573..878
FT                   /locus_tag="CpB0003"
FT   CDS_pept        573..878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0003"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit C"
FT                   /note="similar to glutamyl-tRNA (Gln) amidotransferase
FT                   subunit C - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97936"
FT                   /db_xref="GOA:Q9Z9G8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G8"
FT                   /protein_id="AAP97936.1"
FT                   /translation="MEQFHLDREEILLLAKASALQLSEELIQEYQTSLSAVITSMKEAL
FT                   AIEIDDADSCESLFMHVVNVEDLREDSVTSDFNREEFLRNVPESLGGLVKVPAVIK"
FT   gene            895..2373
FT                   /locus_tag="CpB0004"
FT   CDS_pept        895..2373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0004"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit A"
FT                   /note="similar to glutamyl-tRNA (Gln) amidotransferase
FT                   subunit A - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97937"
FT                   /db_xref="GOA:Q9Z9G7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G7"
FT                   /protein_id="AAP97937.1"
FT                   /translation="MYRYSALELAKAVTLGELTATGVTQHFFHRIEEAEGQVGAFISLC
FT                   KEQALEQAELIDKKRSRGEPLGKLAGVPVGIKDNIHVTGLKTTCASRVLENYQPPFDAT
FT                   VVERIKKEDGIILGKLNMDEFAMGSTTLYSAFHPTHNPWDLSRVPGGSSGGSAAAVSAR
FT                   FCPVALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFASSLDQIGPLANTVEDVA
FT                   LMMDVFSGRDPKDATSREFFRDSFMSKLSTEVPKVIGVPRTFLEGLRDDIRENFFSSLA
FT                   IFEGEGTHLVDVELDILSHAVSIYYILASAEAATNLARFDGVRYGYRSPQAHTISQLYD
FT                   LSRGEGFGKEVMRRILLGNYVLSAERQNVYYKKATAVRAKIVKAFRTAFEKCEILAVPV
FT                   CSSPAFEIGEILDPVTLYLQDIYTVAMNLAYLPAIAVPSGFSKEGLPLGLQIIGQQGQD
FT                   QQVCQVGYSFQEHAQIKQLFSKRYAKSVVLGGQS"
FT   gene            2370..3836
FT                   /locus_tag="CpB0005"
FT   CDS_pept        2370..3836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0005"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /note="similar to glutamyl-tRNA (Gln) amidotransferase
FT                   subunit B - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97938"
FT                   /db_xref="GOA:Q9Z9G6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G6"
FT                   /protein_id="AAP97938.1"
FT                   /translation="MSAVYADWESVIGLEVHVELNTASKLFSSALNRFGDEPNTNISTV
FT                   CTGLPGSLPVLNQSAVEKAVLFGCAVEGEISLLSRFDRKSYFYPDSPRNFQITQFEHPI
FT                   IRGGRIKAIVQGEERYFELAQTHIEDDAGMLKHFGEFAGVDYNRAGVPLIEIVSKPCMF
FT                   CPEDAVAYATSLVSLLDYIGISDCNMEEGSIRFDVNVSVRPKGSPELRNKVEIKNMNSF
FT                   AFMAQALEAEKQRQIDEYLNQPNKDPKLVIPAATYRWDPEKKKTVLMRLKESAEDYKYF
FT                   PEPDLPTLQLTESYIERIRKTLPELPYDKYHRYIQEYGLSEDIASILISDKNIATFFEV
FT                   ACKDCKNFRSLSNWVTVEFGGRCKTLGVKLPSSGIFPEGVAQLVNAIDQGVITGKIAKE
FT                   IADLMMESPGKNPEEILKEKPELLPMSDEGELQKIIAEVVLANPESIVDYKNGKTKALG
FT                   FLVGQIMKRTAGKAPPKRVNELLLLELDKG"
FT   gene            4127..6895
FT                   /locus_tag="CpB0006"
FT   CDS_pept        4127..6895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0006"
FT                   /product="outer membrane protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97939"
FT                   /db_xref="GOA:Q9Z9G5"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9G5"
FT                   /protein_id="AAP97939.1"
FT                   /translation="MRFSLCGFPLVFSFTLLSVFDTSLSATTISLTPEDSFHGDSQNAE
FT                   RSYNVQAGDVYSLTGDVSISNVDNSALNKACFNVTSGSVTFAGNHHGLYFNNISSGTTK
FT                   EGAVLCCQDPQATARFSGFSTLSFIQSPGDIKEQGCLYSKNALMLLNNYVVRFEQNQSK
FT                   TKGGAISGANVTIVGNYDSVSFYQNAATFGGAIHSSGPLQIAVNQAEIRFAQNTAKNGS
FT                   GGALYSDGDIDIDQNAYVLFRENEALTTPIGKGGAVCCLPTSGSSTPVPIVTFSDNKQL
FT                   VFERNHSIMGGGAIYARKLSISSGGPTLFINNISYANSQNLGGAIAIDTGGEISLSAEK
FT                   GTITFQGNRTSLPFLNGIHLLQNAKFLKLQARNGYSIEFYDPITSEADGSTQLNINGDP
FT                   KNKEYTGTILFSGEKSLANDPRDFKSTIPQNVNLSAGYLVIKEGAEVTVSKFTQSPGSH
FT                   LVLDLGTKLIASKEDIAITGLAIDIDSLSSSSTAAVIKANTANKQISVTDSIELISPTG
FT                   NAYEDLRMRNSQTFPLLSLEPGAGGSVTVTAGDFLPVSPHYGFQGNWKLAWTGTGNKVG
FT                   EFFWDKINYKPRPEKEGNLVPNILWGNAVDVRSLMQVQETHASSLQTDRGLWIDGIGNF
FT                   FHVSASEDNIRYRHNSGGYVLSVNNEITPKHYTSMAFSQLFSRDKDYAVSNNEYRMYLG
FT                   SYLYQYTTSLGNIFRYASRNPNVNVGILSRRFLQNPLMIFHFLCAYGHATNDMKTDYAN
FT                   FPMVKNSWRNNCWAIECGGSMPLLVFENGRLFQGAIPFMKLQLVYAYQGDFKETTADGR
FT                   RFSNGSLTSISVPLGIRFEKLALPQDVLYDFSFSYIPDIFRKDPSCEAALVISGDSWLV
FT                   PAAHVSRHAFVGSGTGRYHFNDYTELLCRGSIECRPHARNYNINCGSKFRF"
FT   gene            complement(7138..7293)
FT                   /locus_tag="CpB0007"
FT   CDS_pept        complement(7138..7293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97940"
FT                   /protein_id="AAP97940.1"
FT                   /translation="MQEPLRSALLERLSEWLVLLGVPSPETTRSTPEKDANQLPKDSRN
FT                   RTLESL"
FT   gene            7605..10499
FT                   /locus_tag="CpB0008"
FT   CDS_pept        7605..10499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0008"
FT                   /product="HB1 protein"
FT                   /note="similar to HB1 protein, Chlamydia pneumoniae strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97941"
FT                   /protein_id="AAP97941.1"
FT                   /translation="MRKLRILAIVLIALSIILIAGGVVLLTVAIPGLSSVISSPAGMGA
FT                   CALGCVMLALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISGADSTIRSLPTYLLD
FT                   EGHPQSMRKLRILAIVLIVFSIILIASGVVLLTVAIPGLSSVISSPAGMGACALGCVML
FT                   ALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISGADSTIRSLPTYPLDEGHPQSMR
FT                   KLRILAIVLIVFSIILIASGVVLLTVAIPGLSSIISSPAEMGACALGCVMLALGIDVLL
FT                   KKREVPIVVPAPIPEEVVIDDIDEESIRLQQEAEAALARLPEEMSAFEGYIKVVESHLE
FT                   NMKSLPYDGHGLEEKTKHQIRVVRSSLKAMVPEFLDIRRIFEEEEFFFLSARKRLIDLA
FT                   TTLVERKILTEQLERNNLRKAFSYLYQDSIFKKIIDNFEKLAWKFMILSKSICRFTIIF
FT                   ENHEHGVAKSLLHKNAVLLEKVIYRSLQKSYRDIGMSSAKMKILHGNPFFSLEDNKKTI
FT                   MKEHAEMLESLSSYRKVFLALSDENVVDTPSDPKKWDLSGIPCRDALSEISRDEQWQKK
FT                   AHLKHQESLYTQARDRLTDQSSKENQKELEKAEQEYISSWERVKKFEIERVQERIQAIQ
FT                   KLYPNILEREEETTGQETVTPTVQGTTASSDLTDILGRIEVSSREDNQNQESCVKVLRS
FT                   HEVEMSWEVKQEYGPKKKEFQDQMGSLERFFTEHIEELEVLQKDYSKHLSYFKKVNNKK
FT                   EVQYAKFRLKVLESDLEGILAQTESAESLLTQEELPILATRGALEKAVFKGSLCCALAS
FT                   KAKPYFEEDPRFQDSDTQLRALTLRLQEAKASLEEEIKRFSNLENDIAEERRLLKESKQ
FT                   TFERAGLGVLREIAVESTYDLRSLTNTWEGTPESEKVYFSMYLNYYNEEKRRAKTRLVE
FT                   MTQRYRDFKMALEAMQFNEEALLQEELSIQAPSE"
FT   gene            10864..11688
FT                   /locus_tag="CpB0009"
FT   CDS_pept        10864..11688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0009"
FT                   /product="HB2 protein"
FT                   /note="similar to HB2 protein, Chlamydia pneumoniae strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97942"
FT                   /protein_id="AAP97942.1"
FT                   /translation="MTLLVLGVLLLTLGIPGLTAGISFGAGLGFSALGGVLVISGLLFL
FT                   LVRREVPTVRSEEIPRGVSVTPSEEPALEKAQKEPETKKILDRLPKELDQLDTYIQEVF
FT                   ACLERLKDPKYEDRGLLTEAKEKLRVFDVVEKDMMSEFLDIQRVLNEEAYYVEHCQDPL
FT                   ENIAYEIFSSQELRDYYCAGVCGYLPSGDARADRLKRSVKEVMDRFMRVTWKSWEASVM
FT                   LDHSYGVARELFKKAVGVLEESVYKILFKSYRDAFYECEKAKIQRDGRFKWL"
FT   gene            11815..13122
FT                   /locus_tag="CpB0010"
FT   CDS_pept        11815..13122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0010"
FT                   /product="HB3 protein"
FT                   /note="similar to HB3 protein, Chlamydia pneumoniae strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97943"
FT                   /protein_id="AAP97943.1"
FT                   /translation="MWLDRYADKFILREKEEKMERHELFHATMVRKASGHAYAKAKAAF
FT                   EKERSNENQRKVKDVEKWLSKGLAEFRNQESRRARERLRELQTLYPEVSVEERVLERQR
FT                   TKKVNLENLYADIEKKYHHCVREQEHYWKEVENKEAEYRENGEKVLSAEEVSECLQRLE
FT                   DCLETWSKKLTKAEESVFEMKFDATEKLGNKVLSDVTNRLEILCEDAEEMIFRIEEIEM
FT                   TLRMVELPLLFMKNTFEKASLQYNSCKEMLAKVEPQCKESPTYRSSQERLERLNQDLQT
FT                   AYTNCQERLQGFSDLESKVRTCRDHLREQMKHFEVQGLNFINEELLWVGAELFTQARLD
FT                   LVATVPYMEFYLQYHNIKREKVRSQWMAKTERYREIRQAFQGVMKEDLLAEDTILKEED
FT                   YWLLRDDWLLRDERKNRQRRLICNKIAAAQQRVKGF"
FT   gene            13323..13598
FT                   /locus_tag="CpB0011"
FT   CDS_pept        13323..13598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0011"
FT                   /product="HB2 protein"
FT                   /note="similar to HB2 protein, Chlamydia pneumoniae strain,
FT                   strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97944"
FT                   /protein_id="AAP97944.1"
FT                   /translation="MQVLLSPQLPPPPQHSVGSISSPSKLRVLAITFLVFGMLLLISGA
FT                   LFLTLGIPGLSAAISFGLGIGLSALGGVLMISGLLCLLVKREIPTV"
FT   gene            13692..15749
FT                   /locus_tag="CpB0012"
FT   CDS_pept        13692..15749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0012"
FT                   /product="HB2/HB5 protein"
FT                   /note="similar to HB2 and HB5 protein, Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97945"
FT                   /protein_id="AAP97945.1"
FT                   /translation="MDQLDTDIQEVFACLRKLKDSKYESRSFLNDAKKELRVFDFVVED
FT                   TLSEIFELRQIVAQEGWDLNFLINGGRSLMMTAESESLDLFHVSKRLGYLPSGDVRGEG
FT                   LKKSAKEIVARLMSLHCEIHKVAVAFDRNSYAMAEKAFAKALGALEESVYRSLTQSYRD
FT                   KFLESERAKIPWNGHITWLRDDAKSGCAEKKLRDAEERWKKFRKAVFWVEEDGGFDINN
FT                   LLGDWGTVLDPYRQERMDEITFHELYEKTTFLKRLHRKCALAKTTFEKKRSKKNLQAVE
FT                   EANARRLKYVRDWYDQEFQKAGERLEKLHALYPEVSVSIRENKIQETRSNLEKAYEAIE
FT                   ENYRCCVREQEDYWKEEEKREAEFRERGNKILSPEELESSLEQFDHGLKNFSEKLMELE
FT                   GHILKLQKEATAEVENKILSDAESRLEIVFEDVKEMPCRIEEIEKTLRMAELPLLPTKK
FT                   AFEKACSQYNSCAEMLEKVKPYCKESLAYVTSKERLVSLDEDLRRAYTECQKRFQGDSG
FT                   LESEVRACREQLRERIQEFETQGLDLVEKELLCVSSRLRNTECDCVSGVKKEAPPGKKF
FT                   YAQYYDEIYRVRVQSRWMTMSERLREGVQACNKMLKAGLSEEDKVLKEEEYWLYREERK
FT                   NKEKRLVGTKIVATQQRIQEFQPSDIVESSNEKVSLMDKARFLFNREDHS"
FT   gene            15892..16617
FT                   /locus_tag="CpB0013"
FT   CDS_pept        15892..16617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0013"
FT                   /product="HB6 protein"
FT                   /note="similar to HB6 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97946"
FT                   /protein_id="AAP97946.1"
FT                   /translation="MTAAPAILHVSPTPPEETKFVIPKDSKSRALGITLLVVGILLVVC
FT                   GAIVLSGVISGLSALIVCGLGISTISLGVVLFVLGLILLLRKRELTLEQIEAKQIAETF
FT                   ADELKELEMYIQSTEKSLEKIEGSRYSDQGFLNRATQKILDLESSLSSITSEFRDLRQL
FT                   FDEEKIELLSGERLLEFIAANLFKQGRDVYLNLGNLADIRAYMGPNNYKVAMVIEKAKA
FT                   VVHEFIVLTTMARELEFFF"
FT   gene            16644..18215
FT                   /locus_tag="CpB0014"
FT   CDS_pept        16644..18215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0014"
FT                   /product="HB7 protein"
FT                   /note="similar to HB7 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97947"
FT                   /protein_id="AAP97947.1"
FT                   /translation="MYQENLRLLERLLYNSVQKSYADRLFSYEKTKMVHDTPLIPWEED
FT                   KEKCAEAEKAFLEQQKILLDYGKSIFWLNENDEINLNDPWSWGLNTVRTRKVFQEVDDS
FT                   ERWNHKVLIQKLEDDYEKLLEESSKESTEANKKLLSDLVDRLEDAKTKFFLKKQEEVET
FT                   RVKDLRARYGGTVDPKQDTEAKKKVELEASLETFLDSIESELVQCLEDQDIYWKEQDVK
FT                   DLARTQELEEQDIEAKREEAAEDLRSLNERLKKSKTMLDRAKWHIENAEDSITWWTSQI
FT                   EMKDMKARLKILKEDITSVLPEIDEIETCLSLEELPLLTTRELLTKSYLKFKICSETLL
FT                   KMTSVFENNIYVQEYEVQLQNLGFKLQGISQRFGKKQDDFANLEEQVALQKKRLRELTQ
FT                   NFEIQGFNFMKEDFKAAAKDLYIRSTAEQKMNFDVPCMELFRRYHEEVNKPLLELMYNC
FT                   ADSYRDAKKKLCSLRLDEKELLQKEIKKEEFYQKKQQRHADRSRHTTYQKLRIAEELAL
FT                   ELKKKI"
FT   gene            18563..20722
FT                   /locus_tag="CpB0015"
FT   CDS_pept        18563..20722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0015"
FT                   /product="outer membrane protein 7"
FT                   /note="similar to outer membrane protein 7 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97948"
FT                   /db_xref="GOA:Q9Z3A1"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z3A1"
FT                   /protein_id="AAP97948.1"
FT                   /translation="MREKKVVMKIPLRFLLISLVPTLSMSNLLGAATTEELSASNSFDG
FT                   TTSTTSFSSKTSSATDGTNYVFKDSVVIENVPKTGETQSTSCFKNDAAAGDLNFLGGGF
FT                   SFTFSNIDATTASGAAIGSEAANKTVTLSGFSALSFLKSPASTVTNGLGAINVKGNLSL
FT                   LDNDKVLIQDNFSTGDGGAINCAGSLKIANNKSLSFIGNSSSTRGGAIHTKNLTLSSGG
FT                   ETLFQGNTAPTAAGKGGAIAIADSGTLSISGDSGDIIFEGNTIGATGTVSHSAIDLGTS
FT                   AKITALRAAQGHTIYFYDPITVTGSTSVADALNINSPDTGDNKEYTGTIVFSGEKLTEA
FT                   EAKDEKNRTSKLLQNVAFKNGTVVLKGDVVLSANGFSQDANSKLIMDLGTSLVANTESI
FT                   ELTNLEINIDSLRNGKKIKLSAATAQKDIRIDRPVVLAISDESFYQNGFLNEDHSYDGI
FT                   LELDAGKDIVISADSRSIDAVQSPYGYQGKWTINWSTDDKKATVSWAKQSFNPTAEQEA
FT                   PLVPNLLWGSFIDVRSFQNFIELGTEGAPYEKRFWVAGISNVLHRSGRENQRKFRHVSG
FT                   GAVVGASTRMPGGDTLSLGFAQLFARDKDYFMNTNFAKTYAGSLRLQHDASLYSVVSIL
FT                   LGEGGLREILLPYVSKTLPCSFYGQLSYGHTDHRMKTESLPPPPRRSRRIILLGEDMSG
FT                   LESWELELLLKIPAAEDFSKSTLHL"
FT   gene            20653..21108
FT                   /locus_tag="CpB0016"
FT   CDS_pept        20653..21108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0016"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97949"
FT                   /db_xref="GOA:Q9Z3A1"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z3A1"
FT                   /protein_id="AAP97949.1"
FT                   /translation="MGTRVAVENTSGRGFFQEYTPFVKVQAVYARQDSFVELGAISRDF
FT                   SDSHLYNLAIPLGIKLEKRFAEQYYHVVAMYSPDVCRSNPKCTTTLLSNQGSWKTKGSN
FT                   LARQAGIVQASGFRSLGAAAELFGNFGFEWRGSSRSYNVDAGSKIKF"
FT   gene            21391..21924
FT                   /locus_tag="CpB0017"
FT   CDS_pept        21391..21924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0017"
FT                   /product="to outer membrane protein 5"
FT                   /note="similar to to outer membrane protein 5 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97950"
FT                   /protein_id="AAP97950.1"
FT                   /translation="MKSSFPKFVFSTFAIFPLSMIATETVLDSSASFDGNKNGNFSVRE
FT                   SQEDAGTTYLFKGNVTLENIPGTGTAITKSCFNNTKGDLTFTGNGNSLLFQTVDAGTVA
FT                   GAAVNSSVVDKSTTFIGFSSLSFIASPGSSITTGKGAVSCSTGSLSLTKMSVCSSAKTF
FT                   QRIMAVLSPQKLFH"
FT   gene            21858..24176
FT                   /locus_tag="CpB0018"
FT   CDS_pept        21858..24176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0018"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae train VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97951"
FT                   /protein_id="AAP97951.1"
FT                   /translation="MLFSKNFSTDNGGAITAKTLSLTGTTMSALFSENTSSKKGGAIQT
FT                   SDALTITGNQGEVSFSDNTSSDSGAAIFTEASVTISNNAKVSFIDNKVTGASSSTTGDM
FT                   SGGAICAYKTSTDTKVTLTGNQMLLFSNNTSTTAGGAIYVKKLELASGGLTLFSRNSVN
FT                   GGTAPKGGAIAIEDSGELSLSADSGDIVFLGNTVTSTTPGTNRSSIDLGTSAKMTALRS
FT                   AAGRAIYFYDPITTGSSTTVTDVLKVNETPADSALQYTGNIIFTGEKLSETEAADSKNL
FT                   TSKLLQPVTLSGGTLSLKHGVTLQTQAFTQQADSRLEMDVGTTLEPADTSTINNLVINI
FT                   SSIDGAKKAKIETKATSKNLTLSGTITLLDPTGTFYENHSLRNPQSYDILELKASGTVT
FT                   STAVTPDPIMGEKFHYGYQGTWGPIVWGTGASTTATFNWTKTGYIPNPERIGSLVPNSL
FT                   WNAFIDISSLHYLMETANEGLQGDRAFWCAGLSNFFHKDSTKTRRGFRHLSGGYVIGGN
FT                   LHTCSDKILSAAFCQLFGRDRDYFVAKNQGTVYGGTLYYQHNETYISLPCKLRPCSLSY
FT                   VPTEIPVLFSGNLSYTHTDNDLKTKYTTYPTVKGSWGNDSFALEFGGRAPICLDESALF
FT                   EQYMPFMKLQFVYAHQEGFKEQGTEAREFGSSRLVNLALPIGIRFDKESDCQDATYNLT
FT                   LGYTVDLVRSNPDCTTTLRISGDSWKTFGTNLARQALVLRAGNHFCFNSNFEAFSQFSF
FT                   ELRGSSRNYNVDLGAKYQF"
FT   gene            24415..26190
FT                   /locus_tag="CpB0019"
FT   CDS_pept        24415..26190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0019"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97952"
FT                   /protein_id="AAP97952.1"
FT                   /translation="MRSSFSLLLISSSLAFPLLMSVSADAADLTLGSRDSYNGDTSTTE
FT                   FTPKAATSDASGTTYILDGDVSISQAGKQTSLTTSCFSNTAGNLTFLGNGFSLHFDNII
FT                   SSTVAGVVVSNTAASGITKFSGFSTLRMLAAPRTTGKGAIKITDGLVFESIGNLDLNEN
FT                   ASSENGGAINTKTLSLTGSTRFVAFLGNSSSQQGGAIYASGDSVISENAGILSFGNNSA
FT                   TTSGGAISAEGNLVISNNQNIFFDGCKATTNGGAIDCNKAGANPDPILTLSGNESLHFL
FT                   NNTAGNSGGAIYTKKLVLSSGRGGVLFSNNKAANATPKGGAIAILDSGEISISADLGNI
FT                   IFEGNTTSTTGSPASVTRNAIDLASNAKFLNLRATRGNKVIFYDPITSSGATDKLSLNK
FT                   ADAGSGNTYEGYIVFSGEKLSEEELKKPDNLKSTFTQAVELAAGALVLKDGVTVVANTI
FT                   TQVEGSKVVMDGGTTFEASAEGVTLNGLAINIDSLDGTNKAIIKATAASKDVALSGPIM
FT                   LVDAQGNYYEHHNLSQQQVFPLIELSAQGTMTTTDIPDTPILNTTNHYGYQGNWNNCLG
FT                   RRCNCKNKKCYLNLD"
FT   gene            26108..27172
FT                   /locus_tag="CpB0020"
FT   CDS_pept        26108..27172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0020"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97953"
FT                   /protein_id="AAP97953.1"
FT                   /translation="MGIKGTGIIVWVDDATAKTKNATLTWTKTGYKPNPERQGPLVPNS
FT                   LWGSFVDVRSIQSLMDRSTSSLSSSTNLWVSGIADFLHEDQKGNQRSYRHSSAGYALGG
FT                   GFFTASENFFNFAFCQLFGYDKDHLVAKNHTHVYAGAMSYRHLGESKTLAKILSGNSDS
FT                   LPFVFNARFAYGHTDNNMTTKYTGYSPVKGSWGNDAFGIECGGAIPVVASGRRSWVDTH
FT                   TPFLNLEMIYAHQNDFKENGTEGRSFQSEDLFNLAVPVGIKFEKFSDKPTYDLSIAYVP
FT                   DVIRNDPGCTTTLMVSGDSWSTCGTSLSRQALLVRAGNHHAFASNFEVFSQFEVELRGS
FT                   SRSYAIDLGGRFGF"
FT   gene            27317..27505
FT                   /locus_tag="CpB0021"
FT   CDS_pept        27317..27505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97954"
FT                   /protein_id="AAP97954.1"
FT                   /translation="MRLLLSCPMLFIAACASFFGFQEEMQGRNIQSLDANASSLGELFS
FT                   ISTKGVSCLELHREIAR"
FT   gene            27521..29005
FT                   /locus_tag="CpB0022"
FT   CDS_pept        27521..29005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0022"
FT                   /product="outer membrane protein 11"
FT                   /note="similar to outer membrane protein 11 - Chlamydia
FT                   pneumoniae strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97955"
FT                   /protein_id="AAP97955.1"
FT                   /translation="MKTSVSMLLALLCSGASSIVLHAATTPLNPEDGFIGEGNTNTFSP
FT                   KSTTDAAGTTYSLTGEVLYIDPGKGGSITGTCFVETAGDLTFLGNGNTLKFLSVDAGAN
FT                   IAVAHVQGSKNLSFTDFLSLVITESPKSAVTTGKGSLVSLGAVQLQDINTLVLTSNASV
FT                   EDGGVIKGNSCLIQGIKNSAIFGQNTSSKKGGAISTTQGLTIENNLGTLKFNENKAVTS
FT                   GGALDLGAASTFTANHELIFSQNKTSGNAANGGAINCSGDLTFTDNTSLLLQENSTMQD
FT                   GGALCSTGTISITGSDSINVIGNTSGQKGGAISAASLKILGGQGGALFSNNVVTHATPL
FT                   GGAIFINTGGSLQLFTQGGDIVFEGNQVTTTAPNATTKRNVIHLESTAKWTGLAASQGN
FT                   AIYFYDPITTNDTGASDNLRINEVSANQKLSGSIVFSGERLSTAEAIAENLTSRINQPV
FT                   TLVEGSLVLKQGVTLITQGFSQEPESTLLLDLGTSL"
FT   gene            29021..30358
FT                   /locus_tag="CpB0023"
FT   CDS_pept        29021..30358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0023"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97956"
FT                   /protein_id="AAP97956.1"
FT                   /translation="MVITNLSINADTIYGKNPINIVASAANKNITLTGTLALVNADGAF
FT                   YENHTLQDSQDYSFVKLSPGAGGTIITQDASQKPLEVAPSRPHYGYQGHWNVQVIPGTG
FT                   TQPSQANLEWVRTGYLPNPERQGSLVPNSLWGSFVDQRAIQEIMVNSSQILCQERGVWG
FT                   AGIANFLHRDKINEHGYRHSGVGYLVGVGTHAFSDATINAAFCQLFSRDKDYVVSKNHG
FT                   TSYSGVVFLEDTLEFRSPQGFYTDSSSEACCNQVVTIDMQLSYSHRNNDMKTKYTTYPE
FT                   AQGSWANDVFGLEFGATTYYYPNSTFLFDYYSPFLRLQCIYAHQEDFKETGGEVRHFTS
FT                   GDLFNLAVPIGVKFERFSDCKRGSYELTFAYVPDVIRKDPKSTATLASGATWSTHGNNL
FT                   SRQGLQLRLGNHCLINPGIEVFSHGAIELRGSSRNYNINLGGKYRF"
FT   gene            complement(30599..32713)
FT                   /locus_tag="CpB0024"
FT   CDS_pept        complement(30599..32713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0024"
FT                   /product="putative outer membrane protein CT351"
FT                   /note="similar to probable outer membrane protein CT351 -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97957"
FT                   /protein_id="AAP97957.1"
FT                   /translation="MWSNPNLRLMKRCFLFLASFVLMGSSADALTHQEAVKKKNSYLSH
FT                   FKSVSGIVTIEDGVLNIHNNLRIQANKVYVENTVGQSLKLVAHGNVMVNYRAKTLVCDY
FT                   LEYYEDTDSCLLTNGRFAMYPWFLGGSMITLTPETIVIRKGYISTSEGPKKDLCLSGDY
FT                   LEYSSDSLLSIGKTTLRVCRIPILFLPPFSIMPMEIPKPPINFRGGTGGFLGSYLGMSY
FT                   SPISRKHFSSTFFLDSFFKHGVGMGFNLHCSQKQVPENVFNMKSYYAHRLAIDMAEAHD
FT                   RYRLHGDFCFTHKHVNFSGEYHLSDSWETVADIFPNNFMLKNTGPTRVDCTWNDNYFEG
FT                   YLTSSVKVNSFQNANQELPYLTLRQYPISIYNTGVYLENIVECGYLNFAFSDHIVGENF
FT                   SSLRLAARPKLHKTVPLPIGTLSSTLGSSLIYYSDVPEISSRHSQLSAKLQLDYRFLLH
FT                   KSYIQRRHIIEPFVTFITETRPLAKNEDHYIFSIQDAFHSLNLLKAGIDTSVLSKTNPR
FT                   FPRIHAKLWTTHILSNTESKPTFPKTACELSLPFGKKNTVSLDAEWIWKKHCWDHMNIR
FT                   WEWIGNDNVAMTLESLHRSKYSLIKCDRENFILDVSRPIDQLLDSPLSDHRNLILGKLF
FT                   VRPHPCWNYRLSLRYGWHRQDTPNYLEYQMILGTKIFEHWQLYGVYERREADSRFFFFL
FT                   KLDKPKKPPF"
FT   gene            complement(32703..34409)
FT                   /locus_tag="CpB0025"
FT   CDS_pept        complement(32703..34409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0025"
FT                   /product="putative outer membrane protein CT350"
FT                   /note="similar to probable outer membrane protein CT350 -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97958"
FT                   /protein_id="AAP97958.1"
FT                   /translation="MGLFHLTLFGLLLCSLPISLVAKFPESVGHKILYISTQSTQQALA
FT                   TYLEALDAYGDHDFFVLRKIGEDYLKQSIHSSDPQTRKSTVIGAGLAGSSEALDVLSQA
FT                   METADPLQQLLVLSAVSGHLGKTSDDLLFKALASPYPVIRLEAAYRLANLKNTKVIDHL
FT                   HSFIHKLPEEIQCLSAAIFLRLETEESDAYIRDLLAAKKSAIRSATALQIGEYQQKRFL
FT                   PTLRNLLTSASPQDQEAILYALGKLKDGQSYYNIKKQLQKPDVDVTLAAAQALIALGKE
FT                   EDALPVIKKQALEERPRALYALRHLPSEIGIPIALPIFLKTKNSEAKLNVALALLELGC
FT                   DTPKLLEYITERLVQPHYNETLALSFSKGRTLQNWKRVNIIVPQDPQERERLLSTTRGL
FT                   EEQILTFLFRLPKEAYLPCIYKLLASQKTQLATTAISFLSHTSHQEALDLLFQAAKLPG
FT                   EPIIRAYADLAIYNLTKDPEKKRSLHDYAKKLIQETLLFVDTENQRPHPSMPYLRYQVT
FT                   PESRTKLMLDILETLATSKSSEDIRLLIQLMTEGDAKNFPVLAGLLIKIVE"
FT   gene            complement(34391..34981)
FT                   /locus_tag="CpB0026"
FT   CDS_pept        complement(34391..34981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0026"
FT                   /product="septum formation protein maf"
FT                   /note="similar to septum formation protein maf - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97959"
FT                   /db_xref="GOA:Q9Z9F9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F9"
FT                   /protein_id="AAP97959.1"
FT                   /translation="MSLPLVLGSSSPRRKFILEKFRVPFTVIPSNFDESKVSYSGDPIA
FT                   YTQELAAQKAYAVSELHSPCDCIILTGDTIVSYDGRIFTKPQDKADAIQMLKTLRNQTH
FT                   DVVTSIAVLHKGKLLTGSETSQISLTMIPDHRIESYIDTVGTLNNCGAYDVCHGGLILK
FT                   KVHGCVYNVQGLPIQTLKYLLEELNIDLWDYSI"
FT   gene            complement(35010..36614)
FT                   /locus_tag="CpB0027"
FT   CDS_pept        complement(35010..36614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0027"
FT                   /product="putative ABC transporter protein ATPase"
FT                   /note="similar to probable ABC transporter protein ATPase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97960"
FT                   /protein_id="AAP97960.1"
FT                   /translation="MLSAMSIVLDKIGKSLGTRILFDDVSVVFNPGNCYGLTGPNGAGK
FT                   STLLKIIMGMIEPTRGSISLPKKVGILRQNIDSFHDTTVLDCVIMGNTRLWEALQRRDN
FT                   LYLQEFTDAIGMELGEIEEIIGEENGYRADSEAEELLTGIGIPNEMFDKKMAMIPIDLQ
FT                   FRVLLCQALFGHPEALLLDEPTNHLDLYSINWLGNFLKDYEGTVIVVSHDRHFLNTITT
FT                   HIADIDYDTIIIYPGNYDDMVEMKTASREQEKADIKSKEKKISQLKEFVAKFGAGSRAS
FT                   QVQSRLREIKKLQPQELKKSNIQRPYIRFPLSDKSSGKVVLSLEAITKDYGDHQVIHPF
FT                   SLEIYQGDKLGIIGNNGLGKTTLMKLLAGVEAPSSGSIKLGHQAICSYFPQNHSDVLAD
FT                   CGQETLFEWLRNRKTGINDQEIRSVLGKMLFGGDDAFKQIQALSGGETARLLMAGMMLE
FT                   NHNVLILDEANNHLDLESVSALSWAINDYKGTAIFVSHDRGLIQDCATKLLIFDKDKIT
FT                   FFDGTMVDYTAGHKQLL"
FT   gene            complement(36657..37595)
FT                   /gene="xerC"
FT                   /locus_tag="CpB0028"
FT   CDS_pept        complement(36657..37595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="CpB0028"
FT                   /product="site-specific integrase/recombinase"
FT                   /note="similar to site-specific integrase/recombinase XerC
FT                   - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97961"
FT                   /db_xref="GOA:Q9Z9F7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F7"
FT                   /protein_id="AAP97961.1"
FT                   /translation="MIASIYSFLDYLKMVKSASPHTLRNYCLDLNGLKIFLEERGNLAP
FT                   SSPLQLATEKRKVSELPFSLFTKEHVRMYIAKLIENGKAKRTIKRCLSSIKSFAHYCVI
FT                   QKILLENPAETIHGPRLPKELPSPMTYAQVEVLMATPDISKYHGLRDRCLMELFYSSGL
FT                   RISEIVAVNKQDFDLSTHLIRIRGKGKKERIIPVTSNAIQWIQIYLNHPDRKRLEKDPQ
FT                   AIFLNRFGRRISTRSIDRSFQEYLRRSGLSGHITPHTIRHTIATHWLESGMDLKTIQAL
FT                   LGHSSLETTTVYTQVSVKLKKQTHQEAHPHA"
FT   gene            complement(37680..38603)
FT                   /locus_tag="CpB0029"
FT   CDS_pept        complement(37680..38603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0029"
FT                   /product="putative sulphohydrolase/glycosulfatase"
FT                   /note="similar to probable sulphohydrolase/glycosulfatase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97962"
FT                   /db_xref="GOA:Q9Z9F6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F6"
FT                   /protein_id="AAP97962.1"
FT                   /translation="MSSRELIILGCSSQQPTRTRNQGAYLFRWNGEGLLFDPGEGTQRQ
FT                   FIFANIAPTTVNRIFVSHFHGDHCLGLGSMLMRLNLDKVSHPIHCYYPASGKKYFDRLR
FT                   YGTIYHETIQVVEHPISEEGIVEDFGSFRIEAQRLQHQVDTLGWRITEPDTIKFLPKEL
FT                   ESRGIRGLIIQDLIRDQEISIGGSTVYLSDVSYVRKGDSIAIIADTLPCQAAIDLAKNS
FT                   CMMLCESTYLEQHRHLAESHFHMTAKQAATLAKRAATQKLILTHFSARYLNLDDFYKEA
FT                   SAVFPNVSVAQEYRSYPFPKNPLLNK"
FT   gene            complement(38758..39624)
FT                   /locus_tag="CpB0030"
FT   CDS_pept        complement(38758..39624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97963"
FT                   /protein_id="AAP97963.1"
FT                   /translation="MSHLIPSLRNSVTSYFHKPQPIKQAAPSKSIRDICNIAYLIIICV
FT                   LVVVVLVGAMLCMFIPSVGIPLCLSSLALLVLLSIFNPCLINWISTKKTKEIAPKDASE
FT                   SQPTKSASRKGSPQLSPHHDHEPKNFIRTQLEKGVNYVTNKFKSGEESPHISDEHHSPR
FT                   QSKRSSEIESSDESSPELHRKAKGKAPHTATTKESKTSTTESSKKKKKTKHSLHRTTSS
FT                   IHKRSAPKPMVPSKKRKPVLLKKTVPLPIEDLEHQSSGNESSDSSSPPPVQRKAILPWF
FT                   CKQPTDP"
FT   gene            complement(39774..42233)
FT                   /locus_tag="CpB0031"
FT   CDS_pept        complement(39774..42233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0031"
FT                   /product="lon ATP-dependent proteinase"
FT                   /note="similar to lon ATP-dependent proteinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97964"
FT                   /db_xref="GOA:Q9Z9F4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F4"
FT                   /protein_id="AAP97964.1"
FT                   /translation="MDSTTNSDSPILDPNPEDVEKLLDESEEESEDQSTERLLPSELFI
FT                   LPLNKRPFFPGMAAPILIESGPYYEVLKVLAKSSQKYIGLVLTKKENADILKVSFNQLH
FT                   KTGVAARILRIMPIEGGSAQVLLSIEERIRIIEPIKDKYLKARVSYHADNKELTEELKA
FT                   YSISIVSVIKDLLKLNPLFKEELQIFLGHSDFTEPGKLADFSVALTTATREELQEVLET
FT                   TNMHDRIDKALILLKKELDLSRLQSSINQKIEATITKSQKEFFLKEQLKTIKKELGLEK
FT                   EDRAIDIEKFSERLRKRHVPDYAMEVIQDEIEKLQTLETSSAEYTVCRNYLDWLTIIPW
FT                   GIQSKEYHDLKKAEIVLNKDHYGLDEIKQRILELISVGKLSKGLKGSIICLVGPPGVGK
FT                   TSIGRSIAKVLHRKFFRFSVGGMRDEAEIKGHRRTYIGAMPGKMVQALKQSQAMNPVIM
FT                   IDEVDKIGASYHGDPASALLEVLDPEQNKDFLDHYLDVRVDLSNVLFILTANVLDTIPD
FT                   PLLDRMEILRLSGYILEEKLQIAKKYLVPKARKEIGLTASEVNFQPEALKYMINNYARE
FT                   AGVRTLNGNIKKVLRKVALKIVQNQEKPKSKKITFKISSKNLQTYLGKPIFSSDRFYES
FT                   TPVGVATGLAWTSLGGATLYIESVQVSSLKTDMHLTGQAGEVMKESSQIAWTYLHSALH
FT                   RYAPGYTFFPKSQVHIHIPEGATPKDGPSAGITMVTSLLSLLLETPVVNNLGMTGEITL
FT                   TGRVLGVGGIREKLIAARRSRLNILIFPEDNRRDYEELPAYLKTGLKIHFVSHYDDVLK
FT                   VAFPKLK"
FT   gene            complement(42539..43324)
FT                   /locus_tag="CpB0032"
FT   CDS_pept        complement(42539..43324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97965"
FT                   /protein_id="AAP97965.1"
FT                   /translation="MFLQFFHPIVFSDQSLSFLPYLGKSSGIIEKCSNIVEHYLHLGGD
FT                   TSVIITGVSGATFLSVDHALPISKSEKIIKILSYILILPLILALFIKIVLRIILFFKYR
FT                   GLILDVKKEDLKKTLTPDQENLSLPLPSPTTLKKIHALHILVRSGKTYNELIQEGFSFT
FT                   KITDLGQAPSPKQDIGFSYNSLLPNFYFHSLVSVPNISGEERALNYHKEQQEEMAVKLK
FT                   TMQACSFVFRSLHLPSMQTKDKKAGFGLLTFFPWKIYPL"
FT   gene            complement(43386..43754)
FT                   /locus_tag="CpB0033"
FT   CDS_pept        complement(43386..43754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97966"
FT                   /protein_id="AAP97966.1"
FT                   /translation="MNDGLRFCYSYILLRPMLLDSSLLRKGGQELLKKFQIKLRTTSIK
FT                   SSLISLRQQLGKREATQSDILYGTSRFQYLNSFEIEDPRIPPTMAAQLQEIIWSRSVME
FT                   LKIKFYVYLNSERNKTKP"
FT   gene            43890..44531
FT                   /locus_tag="CpB0034"
FT   CDS_pept        43890..44531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0034"
FT                   /product="putative o-sialoglycoprotein endopeptidase"
FT                   /note="similar to probable o-sialoglycoprotein
FT                   endopeptidase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97967"
FT                   /protein_id="AAP97967.1"
FT                   /translation="MYFYKYVIIDTSGYYPFLACVDNQQVLEHWSLPVGPDLGIVLEFL
FT                   FKSKNLSFQGVAVALGPGNFSATRIGISFAQGLAMAKNVPLLGYSSLEGYLLSKDEKKA
FT                   LMLPLGKRGGVLTLSSEIPEEGLNEKRRGVGPGALLSYEEASDYCVAHGYYHVISPNPQ
FT                   LFASSFSDKITVEEVAPSVEQIRRHVISQFMFVEYDKQLSPDYRSYSCIF"
FT   gene            44710..44886
FT                   /locus_tag="CpB0035"
FT   CDS_pept        44710..44886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0035"
FT                   /product="ribosomal protein S21"
FT                   /note="similar to ribosomal protein S21 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97968"
FT                   /db_xref="GOA:Q9Z9F0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9F0"
FT                   /protein_id="AAP97968.1"
FT                   /translation="MPSVKVRVGEPVDRALRILKKKIDKEGILKAAKSHRFYDKPSVKK
FT                   RAKSKAAAKYRSR"
FT   gene            44922..46100
FT                   /locus_tag="CpB0036"
FT   CDS_pept        44922..46100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0036"
FT                   /product="heat shock protein dnaJ"
FT                   /note="similar to heat shock protein dnaJ - Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97969"
FT                   /db_xref="GOA:Q9Z9E9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E9"
FT                   /protein_id="AAP97969.1"
FT                   /translation="MDYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPGDAAAEKRFK
FT                   EVSEAYEVLSDPQKRDSYDRFGKDGPFAGAGGFGGAGGMGNMEDALRTFMGAFGGEFGG
FT                   GSFFDGLFGGLGEAFGMRSDPAGARQGASKKVHINLTFEEAAHGVEKELVVSGYKSCET
FT                   CSGQGAVNPQGIKSCERCKGSGQVVQSRGFFSMASTCPECGGEGRIITDPCSSCRGQGR
FT                   VKDKRSVHVHIPAGVDSGMRLKMEGYGDAGQNGAPSGDLYVFIDVESHPVFERRGDDLI
FT                   LELPIGFVDAALGMKKEIPTLLKTEGSCRLTVPEGIQSGTILKVRNQGFPNVHGKGRGD
FT                   LLVRISVETPQNLSEEQKELLRTFASTEKAENFPKKRSFLDKIKGFFSDFTV"
FT   gene            46137..48173
FT                   /locus_tag="CpB0037"
FT   CDS_pept        46137..48173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0037"
FT                   /product="2-oxoisovalerate dehydrogenase alpha and beta
FT                   subunit"
FT                   /note="similar to 2-oxoisovalerate dehydrogenase alpha and
FT                   beta subunit family fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97970"
FT                   /protein_id="AAP97970.1"
FT                   /translation="MGVVQNQVISSIRDVLKLVWELRFAEHKMLLLSRQSGSGGTFQLS
FT                   CAGHELAGVLAGKSLIPGKDWSFPYYRDQGFPIGLGCDLSEIFASFLARTTPNHSSARM
FT                   MPYHYSHKKLRICCQSSVVGTQFLQAAGRAWAVKHSSADEVVYVSGGDGATSQGEFHEM
FT                   LNFVALHQLPLITVIQNNHWAISVPFEDQCGADLASLGRCHQGLAVYEVDGGNYTSLTE
FT                   TFSHAVDQARQHSVPALILIDVVRLSSHSNSDNQEKYRSALDLKLSMDKDPLILLEKEA
FT                   INVFGLSPFEIEEIKAEAQEEVRKSCEIAEALPFPSKGSTSHEVFSPYTETLIDYENSE
FT                   SAQNLRNSEPKVMRDAISEALVEEMTRDSGVIVFGEDVAGDKGGVFGVTRNLTEKFGPQ
FT                   RCFNSPLAEATIIGTAIGMALDGIHKPVVEIQFADYIWPGINQLFSEASSIYYRSAGEW
FT                   EVPLVIRAPSGGYIQGGPYHSQSIEGFLAHCPGIKVAYPSNAADAKALLKAAIRDPNPV
FT                   VFLEHKALYQRRIFSACPVFSHDYVLPFGKAAIVHPGKDLTIVSWGMPLVLSLEVAQEL
FT                   ASRGISIEVIDLRTMVPCDFATVLKSLEKTGRLLVIHEASEFCGFGSELVATMSEQGYA
FT                   YLDAPIRRLGGLHAPVPYSKVLENEVLPHKESILQAAKSLAEF"
FT   gene            complement(48206..49456)
FT                   /locus_tag="CpB0038"
FT   CDS_pept        complement(48206..49456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97971"
FT                   /protein_id="AAP97971.1"
FT                   /translation="MAEISTPSLPDSSIVSQKTPPVPDPDSSPDHIPTIPTQAPFKPQR
FT                   KKETPSSIVNAIAFAILAFLSCLGGVFAICLGCSLEITVPLFILTAVFIAFTLLYFIHY
FT                   LEKPKIPEPLPTPPPSPTLRAPTLTPEIPAPAPGIPLPPTLPKVDRTKLTCNPDIHYPS
FT                   TYDPKACFSLLKQLFSLDPETRPEDRKYSNKLASILLRSKEKSGFRFHCFKGHFSHDKI
FT                   LNKKSGAVVISSHSSMDFSTTLGRAFAVTTCLQRSCWEKIKNNIPTPEKHLPIGSCVSG
FT                   PWDVEEGAQLYTSHLIVINPPTLETLIKEKMRRAITLKDFSMKEAFTNLVLAYLQCFDI
FT                   CIEHNLESVQLEVFGLNNLSADQEEFTTWESCCHLALLESVRILLASKEEYALSNVSVN
FT                   SISQVPLQTACRALFLN"
FT   gene            complement(49565..51028)
FT                   /locus_tag="CpB0039"
FT   CDS_pept        complement(49565..51028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0039"
FT                   /product="competence locus E-like protein"
FT                   /note="similar to competence locus E homolog -
FT                   Synechocystis sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97972"
FT                   /protein_id="AAP97972.1"
FT                   /translation="MWNRCQVFSSFFFRYPISSWLIRLRASCECFQQRHPIFLCGLYWL
FT                   AGITSRGHPECSALILIFLGMFLPRNPKQWLPLASAWIISLMLTPAPFLHDGPISGTFV
FT                   IHHAGGQGTYYGEALCIQTPCGKRAHHLSCQILSESRLELKKVYELEGTLHHTSQIVFK
FT                   SNACYKEIPRSRFYIMKEKCRESSCHFLNHRFPSSEVGPFASSLLLGTPLPQNLRDLFR
FT                   QKGLSHLFAISGWHFSLCATTLWMLCALLPLKIKKILSFIVLTSLACIFPMSLSVWRSW
FT                   ISVTLLCFSWCFSGSCSGLNRLGAGFILCSIFFSPFSPTFVLSFLATLGILLFFPKIFS
FT                   FLYTPWTQFLSPFWLYPIRYLAMTLAISLSAQLFIVLPIMQYFGSLPLEGLLYNLIVPF
FT                   TILPIIVFLIATIILPCCSPITEALIQGFLSHPWLHNPNILKTLSFAPVPPWMLTLASL
FT                   ILFFIGILRTNVSPYASISATSYRFIETL"
FT   gene            51001..51798
FT                   /locus_tag="CpB0040"
FT   CDS_pept        51001..51798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0040"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT338 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97973"
FT                   /protein_id="AAP97973.1"
FT                   /translation="MKKPDNDSTFDVRSFFPFDVLCIEQLRKEMSWEVVSAKIPRLPRG
FT                   WYELMGLSKEDRIDFCLDFWCSVLGIEHKESPSICRFFSLLETIEVYIYRLEKEPYQLK
FT                   MFYVFRDGRCGFQGEPPLLDFLGHHRLPPLGDRHYEKFFSIHNGFGKWEDEGIFPMRSL
FT                   AKVQQKLRQQLVVMNKMQAEDNCYSLGIFPFYGYEEPFAYQSFFFDPEIRRDLPSPNVL
FT                   LNEESLEHRSLETIELLHLSKSYYPSFLSWLENYLHSEEVYNE"
FT   gene            51791..52117
FT                   /locus_tag="CpB0041"
FT   CDS_pept        51791..52117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0041"
FT                   /product="phosphotransferase system
FT                   phosphohistidine-containing protein"
FT                   /note="similar to phosphotransferase system
FT                   phosphohistidine-containing protein - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97974"
FT                   /db_xref="GOA:Q9Z9E4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E4"
FT                   /protein_id="AAP97974.1"
FT                   /translation="MNEPTRTYLESEKDTQDQIEELQATCIVKNAAGIHVRPAGVIVRL
FT                   FDGEPCDVHFTYAGKTINAKSIMSILMLGAPQGGEILVTIRSKEAHRILQKIQDAFSSG
FT                   FGEL"
FT   gene            52118..53833
FT                   /locus_tag="CpB0042"
FT   CDS_pept        52118..53833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0042"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="similar to phosphoenolpyruvate-protein
FT                   phosphotransferase - Bacillus stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97975"
FT                   /db_xref="GOA:Q9Z9E3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E3"
FT                   /protein_id="AAP97975.1"
FT                   /translation="MDTQSSIGNEEWRIAGTSIVSGMALGKVFFLGTSPLHVRELTLPQ
FT                   EEVEHEIHRYYKALNRSKSDIVALEQEVTGQQGLQEVSSILQAHLEIMKDPLLTEEVVN
FT                   TIRKDRKNAEYVFSSVMGKIEESLTAVRGMPSVVDRVQDIHDISNRVIGHLCCQHKSSL
FT                   GESDQNLIIFSEELTPSEVASANSAYIRGFVSLVGAATSHTAIVSRAKSIPYLANISEE
FT                   LWNIAKRYNGKLVLIDGYRGELIFNPKPATLQSCYKKELSVVAHTSQRLVRKSLHPIVS
FT                   SHAGSDKDVEDLLENFPQTSIGLFRSEFLAVILGRLPTLREQVDLYEKLARFPGDSPSV
FT                   LRLFDFGEDKPCPGIKNKKERSIRWLLDYSVILEDQLQAIAKASLQGSIKVLIPGVSDV
FT                   SEIIEVKKKWETIQTRFPKGHKVSWGTMIEFPSAVWMIEEILPECDFLSIGTNDLVQYT
FT                   LGISRESALPKHLNVTLPPAVIRMIHHVLQAAKQNQVPVSICGEAAGQLSLTPLFIGLG
FT                   VQELSVAMPVINRLRNHIALLELNSCLEITEALLQAKTCSEVEELLNRNNKITS"
FT   gene            complement(53959..54249)
FT                   /locus_tag="CpB0043"
FT   CDS_pept        complement(53959..54249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0043"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT335 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97976"
FT                   /db_xref="GOA:Q9Z9E2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9E2"
FT                   /protein_id="AAP97976.1"
FT                   /translation="MGSGYAKKKKEAKIMEQQFLEMEASLLEKRYEGQAGNGLVSVVIN
FT                   GKCDLISVKVQPTCLDPEDPEVIEDLFRAAFKLAKEQMDQEMSLMRSTMPF"
FT   gene            complement(54314..55642)
FT                   /locus_tag="CpB0044"
FT   CDS_pept        complement(54314..55642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0044"
FT                   /product="DNA polymerase III (gamma and tau subunits) dnaX"
FT                   /note="similar to DNA polymerase III (gamma and tau
FT                   subunits) dnaX - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97977"
FT                   /protein_id="AAP97977.1"
FT                   /translation="MTLQPYQASSRKYRPQIFREILGQSSVVAVLKNALVFNRAAHAYL
FT                   FSGIRGTGKTTLARILAKALNCVHLSEDGEPCNQCFSCKEIASGSSLDVLEIDGASHRG
FT                   IEDIRQINETVLFTPVKAKFKIYIIDEVHMLTKEAFNALLKTLEEPPQHVKFFFATTEI
FT                   HKIPGTILSRCQKMHLQRIPEKTILEKLSLMAQDDHIEASQEALAPIARAAQGSLRDAE
FT                   SLYDYVISLFPKSLSPDTVAQALGFASQDSLRTLDNAILQRDYATALGIVTDFLNSGVA
FT                   PVTFLHDLTLFYRNLLLTNSTTSKFSSQYKTEQLLEIIDFLGESAKHLQNTIFEQTFLE
FT                   TVIIHIIRIYQRPVLSELISSIKSRQFEGLRNIKEPTLTQQVSAPQPQPTYKEQSFLEK
FT                   KNQPAAEGKIISVEVKSSASIKSAAVDTLLQFAVVEFSGILRQ"
FT   gene            55995..57344
FT                   /locus_tag="CpB0045"
FT   CDS_pept        55995..57344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0045"
FT                   /product="HB2 protein"
FT                   /note="similar to HB2 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97978"
FT                   /protein_id="AAP97978.1"
FT                   /translation="MLLLISGALFLTLGIPGLTAGVSFGLGIGLSALGGVLVVSGLLCL
FT                   LVKREVSKVCPEEIPAVQPEETPEGVPVTPFEKPALDEAQKEQKTQKILDQLPQELDQL
FT                   DRYIQEVFACLGPLKDLKYEDQGFLQDVKEEFQVFDFVQKDMIAEFVELQQILCQEGRL
FT                   LEFVINQTRYIGRDLFKREDSLYKLWEWLGYLPSGDVRGERLKKSAREVVDRFMRTTCN
FT                   IRKIAMTFDRHVYSVAKTAFEKAFGALETCVYESMRESYREAFCEYEKAKLLGDEEKSA
FT                   HAEQRFQDIKNRWEDVKDAFFWVKEDGKIEIDDAIGNSCKWSERYEEHRITRARWYKVA
FT                   EHQLFNATMRVKDSLREHNEARVAFEKERSKENQRQVQKKKEKRLRDLKELHDQELPRA
FT                   QERLRELQALYPEIAVSVVEARREVASDLEKAHESIDKHYQSCVREQELY"
FT   gene            57402..58184
FT                   /locus_tag="CpB0046"
FT   CDS_pept        57402..58184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0046"
FT                   /product="HB5 protein"
FT                   /note="similiarity to HB5 protein, Chlamydia pneumoniae,
FT                   strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97979"
FT                   /protein_id="AAP97979.1"
FT                   /translation="MEEVSEYLQQVENQLESCSKRLTKMETFALGVRLEAKEEIESIIL
FT                   SDVVNRFEVLCRDIEDMLSRVEEIERMLRMAELPLLPIKEALTKAFVQHNSCKEKLTKV
FT                   EPYFKESPAYLTSEERLQSLNQTLQRAYKESQKVSGLESEVRACREQLKDQVRQFETQG
FT                   VSLIKEEILFVTSTFRTKFSYHSFRLHVPCMRLYEEYYDDIDLERTRARWMAMSERYRD
FT                   AFQAFQEMLKEGLVEEAQALRETEYWLYREERKSKKKH"
FT   gene            58555..60762
FT                   /locus_tag="CpB0047"
FT   CDS_pept        58555..60762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0047"
FT                   /product="HB3/HB4 fusion protein"
FT                   /note="similar to HB3/HB4 protein, Chlamydia pneumoniae;
FT                   putative fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97980"
FT                   /protein_id="AAP97980.1"
FT                   /translation="MLLLISGALFLTLGVPGLAAGLSFGLGIGLSALGGVLVVSGLLFF
FT                   LIRRGVSKVRPEEIPVTPSHEAQKILCQLPQELDQLDTSIQEVVSCLGKLKDLKYEDQG
FT                   LLTEVQEKLRVFDFVRKDMVTEFLELQQVVAQEGQFLDYLINQVQSISHKLFVPDVNIG
FT                   AHLAELCGYLPSGDVRVERLKRSARQVVDRFMRVTCDTRKVAMAFDENACGVAKNAFDK
FT                   AFGALEECVYKSLTESYREAFYEYEKAKILRNEDVEWLQDKNKSARAEQRFREVKDRWE
FT                   DLKETVFWVKENGCIDLEVLTAVGGWPDRGPEHLIPEKRRNKVMSHKLWEATMRMKGAE
FT                   GTYSVARVAFEKDGSRKNQKKFQEKTKEWLRCLKDLHDQECHRARERLAELEALYPEVS
FT                   VSVVETERETKFKLETAYGNLEERYQSVVRDQEDYWKEEENKEAEFREKGTKVRSPEEV
FT                   VEYLQILENLLEDCSKQLTIAEVVVLGVELEATAEFEYTILSGAANRLKVLCEDIEDIL
FT                   PRVEEIEIMLRIAELPFLPIKQAFTKAFLQYNSCKDKLAKVEPYCQESVDYRRNKERFQ
FT                   SLNQDLQNVYQECQKATGLESEVSAYRDHLREQITEFETQGLDVIKEELLFVSSTLKSK
FT                   LSYDPLIADIPCMKFYEEYYDGIDKARVQSRWLEKSERYRKAKKGFQEMLKEGLFKEDQ
FT                   ALKKAEYRLLREKRMNKEKLLICNKIEAAQQRVQEFGPSDS"
FT   gene            60951..61151
FT                   /locus_tag="CpB0048"
FT   CDS_pept        60951..61151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97981"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9D4"
FT                   /protein_id="AAP97981.1"
FT                   /translation="MTIVGFFRFVLEGILTMYHFQKIRMTLTTQGFVLNKSLRKDYELW
FT                   FVYGSCPESKVKLQTSSHKWL"
FT   gene            61183..63300
FT                   /locus_tag="CpB0049"
FT   CDS_pept        61183..63300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0049"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yqfF - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97982"
FT                   /protein_id="AAP97982.1"
FT                   /translation="MKELRHESYNRALHKLSHQWVRYFLYTFVSCSFIVAIFTFAWLKV
FT                   LYVPEYKAGEISRISLTAPMDFSLSWSAHKFYKRTAHISEAFGKVYHLTLSPGSLLSKE
FT                   GNADENTDYWFKKAADFLLSTNFVDSSTQKCLKDLCIYPPLLGKEKKTLEININSNKGN
FT                   VIAQCFCHLKIFLIQENCPQPCFDAIMDILKIANFEVAVDKEMSGCVKGELLGKRCIEK
FT                   ITKGTPILEKYQRIDDRDAKILKQLRAQLLSVHTLFSCRSLWGAIFVVLLILLWGYGAL
FT                   KALCPEMLKSPQRFMLYIAILTLSLLWCRGTEIFCAYWVSYLSYPPILPFTAVLLGYFL
FT                   GLPIAGFSCTFLALLYTLGSDLWNNSWFLSINLLCSWRILVSLHRVSRLSSVFWACMKL
FT                   GGVAMGSLLMFRIFTNTISREALYADGIESFVYSLITAISVVALIPVFEASFGASTNFS
FT                   LLTYLSPENALLKRLFKEAPGTYQHSVLVGSLAEAAAQAIGADSLYCLVAAHYHDIGKL
FT                   INPGFFSENQKILQQSGHSLSPLECAKMIMRHIPEGVNLARQAGLPESFIQVIEEHHGT
FT                   SVIRSAYYSHMVENPSTGSFDEELFRYSGNKPSSKETTIIMIADSFEAASRSLKNASLP
FT                   DLQRLIDQIIQGKLQDGQFSCSPVTLDELALISKSMVQTLYGALHSRMKYPEISYQISM
FT                   DSCPKPSIGGT"
FT   gene            complement(63310..63792)
FT                   /locus_tag="CpB0050"
FT   CDS_pept        complement(63310..63792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97983"
FT                   /protein_id="AAP97983.1"
FT                   /translation="MLHQPYYDKILTGNTIYIPGHTHKDSNKLFQKKSRAIWVDEKPFS
FT                   LDCFSNVFLIFVSLVPIAGLVRAYQIKKSLDRTTVQIGYSPSLSCEQKECVEAFVNGYG
FT                   LICISILGGLGILVPILILVVLSLLLLGILMLFSLSTYESIKNYISKHICWKSNAT"
FT   gene            complement(63992..64309)
FT                   /locus_tag="CpB0051"
FT   CDS_pept        complement(63992..64309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97984"
FT                   /protein_id="AAP97984.1"
FT                   /translation="MRYAKHQTNWNDENVKANLGYLPSTNCKNALCRMSSRLTSSIKTA
FT                   GILGGCGILLPIFLLLLAILLISVLFQLIMLPFRLCCFALRQSVSSDTVTNLLLLNNTL
FT                   A"
FT   gene            64329..64610
FT                   /locus_tag="CpB0052"
FT   CDS_pept        64329..64610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97985"
FT                   /protein_id="AAP97985.1"
FT                   /translation="MGNHETYIHPGVLPSSHAQDVSRSTVYPSRSFIMRRMLMGWNFNR
FT                   VPSKSSEQLMDGHRIPLIFFGKHHPTISILNVNRFSWLSIFYNGERGF"
FT   gene            complement(64797..65501)
FT                   /locus_tag="CpB0053"
FT   CDS_pept        complement(64797..65501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0053"
FT                   /product="hydroxymethylbilane synthase"
FT                   /note="similar to hydroxymethylbilane synthase -
FT                   Clostridium josui"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97986"
FT                   /db_xref="GOA:Q9Z9C9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C9"
FT                   /protein_id="AAP97986.1"
FT                   /translation="MLSVCYSDPCLSDFCQGKRPLRIASRNSNLAKAQVHECISLLRSW
FT                   YPKLWFQLSTTETTGDREKKIPLHLVENSYFFTDGVDALVHKGVCDLAIHSAKDLPETP
FT                   SLPVVAITRCLHPADLLVYADHYVHEPLPLSPRLGSSSLRRSAVLKQLFPQGQILDIRG
FT                   TIEERLDQLHRGHYDAIVLAKAASLRLHLHHAYSIELPPPYHALQGSLAITAKDHAGKW
FT                   KQLFTPIHCHSS"
FT   gene            complement(65479..66840)
FT                   /locus_tag="CpB0054"
FT   CDS_pept        complement(65479..66840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0054"
FT                   /product="DNA repair protein sms"
FT                   /note="similar to DNA repair protein sms - Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97987"
FT                   /db_xref="GOA:Q9Z9C8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C8"
FT                   /protein_id="AAP97987.1"
FT                   /translation="MATKTKTQWTCNQCGATAPKWLGQCPGCHNWNSLVEEYVPQARSG
FT                   TSSRSSTSAIALSSIELENESRIFIDHAGWDRILGGGVVRGSLTLLGGDPGIGKSTLLL
FT                   QTAERLASQKYKVLYVCGEESVTQTSLRAKRLNISSPLIYLFPETNLDNIKQQIATLEP
FT                   DILIIDSIQIIFNPTLNSAPGSVAQVREVTYELMQIAKSAQITTFIIGHVTKSGEIAGP
FT                   RVLEHLVDTVLYFEGNSHANYRMIRSVKNRFGPTNELLILSMHADGLKEVSNPSGLFLQ
FT                   EKTGPTTGSMIIPIIEGSGALLIELQALVSSSPFANPVRKTAGFDPNRFSLLLAVLEKR
FT                   AQVKLFTMDVFLSITGGLKIIEPAADLGALLAVASSLYNRLLPNNSIVIGEVGLGGEIR
FT                   HVAHLERRIKEGKLMGFEGAILPEGQISSLPKEIRENFRLQGVKTIKDAIRLLL"
FT   gene            complement(66806..67519)
FT                   /locus_tag="CpB0055"
FT   CDS_pept        complement(66806..67519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0055"
FT                   /product="ribonuclease III"
FT                   /note="similar to ribonuclease III - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97988"
FT                   /db_xref="GOA:Q9Z9C7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C7"
FT                   /protein_id="AAP97988.1"
FT                   /translation="MHPPIDITAIEAKLNFTFTQPKLLEIALTHPSYKNESAVQIEDSE
FT                   RLEFLGDAVLGLIVTEHLFLLFPSMDEGTLSTARASLVNAKACCRYTTVLGIGDYLLIG
FT                   KGEKIQSERGRLSAYANLFESILGAVYLDGGLSPARKLTVPLLPPREEILPLMSGNPKN
FT                   LLQQFTQKQFRVLPVYQSTAVTDAQGNVSYQIQVLVNQEVWGEGNASSKKEAEKIAAQQ
FT                   ALDTYGNKNQNTMDV"
FT   gene            67625..68089
FT                   /locus_tag="CpB0056"
FT   CDS_pept        67625..68089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0056"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT296 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97989"
FT                   /protein_id="AAP97989.1"
FT                   /translation="MRSALHLQHLRHFHNHGSILFENLLTIKDCFLLETKLQNFIAKAS
FT                   KTIDTVRWRENIFRSMPEIYTVVRKRRLDFFAAELVHRPKLSLVRDLWVFPGEEILEGE
FT                   EDCMLFLLLSGDRAGSGIFFTGPYPSDLYELEKGTTGLLLAFSSVGIPVI"
FT   gene            68449..70245
FT                   /locus_tag="CpB0057"
FT   CDS_pept        68449..70245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0057"
FT                   /product="phosphomannomutase"
FT                   /note="similar to phosphomannomutase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97990"
FT                   /protein_id="AAP97990.1"
FT                   /translation="MKEVEQRIRSLYDAVTAENICRWLSNDCTQQDAKTILGWLDTDPA
FT                   QLEDLFGATLTFGTGGLRSLMGIGTNRINLFTIRRTTQGLVQVLRAHLPHPGDPMRVVV
FT                   GCDTRHNSIEFAQETAKVLAGNGCEVFLFQYPEPLALVSFTVRYERAIGGVMITASHNP
FT                   PNYNGYKVYMASGGQVLPPLDQEIVAACSAVNEILSVPSIDHPNIHLIGKEYEALYRDT
FT                   LKQLQLYPEANRISGRSLSISYSPLHGTGISLVPHVLKDWGFLSVHLVEKQAIGDGDFP
FT                   TVQLPNPEDPEALTLGIEQMLANDDDLFIATDPDADRVGVVCLEDGQPYRFNGNQMASL
FT                   LADHILGAWSKTRHLGEHDKLVKSLVTTEMLSAIAKHYHVDLINVGTGFKYIGEKIESW
FT                   RNSTNKFVFGAEESYGCLYGTHVEDKDAIIASALIAEAALQQKLQGKTLCDALLSLYET
FT                   YGYFANKTESVVFSAKTDEQEIRKKLSHLEEISSANFFSGKYQVEKFENYKQGIGFNLL
FT                   SKDSYALTLPKTSMLCYYFSGGGRVIIRPSGTEPKIKFYFEMSTHYPERVTDKEIQKQR
FT                   EAESFQHLDDFIFDFKEKFSNL"
FT   gene            70430..71053
FT                   /locus_tag="CpB0058"
FT   CDS_pept        70430..71053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0058"
FT                   /product="manganese superoxide dismutase precursor"
FT                   /note="similar to manganese superoxide dismutase precursor
FT                   - Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97991"
FT                   /db_xref="GOA:Q9Z9C4"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C4"
FT                   /protein_id="AAP97991.1"
FT                   /translation="MSFVPYSLPELPYDYDALEPVISSEIMILHHQKHHQIYINNLNAA
FT                   LKRLDAAETQQNLNELIALEPALRFNGGGHINHSLFWETLAPIDQGGGQPPKHELLSLI
FT                   ERFWGTMDNFLKKLIEVAAGVQGSGWAWLGFCPAKQELVLQATANQDPLEPLTGKLPLL
FT                   GVDVWEHAYYLQYKNVRMDYLKAFPQIINWGHIENRFSEIISSK"
FT   gene            71135..72061
FT                   /locus_tag="CpB0059"
FT   CDS_pept        71135..72061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0059"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase beta
FT                   chain"
FT                   /note="similar to acetyl-CoA carboxylase
FT                   carboxyltransferase beta chain - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97992"
FT                   /protein_id="AAP97992.1"
FT                   /translation="MRLFSYDKPKIKVQKIKADGFSGWLKCNHCHEMIHANELGQNYNC
FT                   CPKCSYHYRITAIERVKLLADKDSWRPLYTDLKSQDPLEFIDTDTYANRLEKARKNTTE
FT                   SEGVIVGICTIGLHPVALAVMDFNFMAGSMGAVVGEKLTRLIEEAIETRLPVIIVSASG
FT                   GARMQESVFSLMQMVKTSAALAKLHEAGLPYISVLTNPTSGGVTASFAALGDIIIAEPK
FT                   ALICFAGPRVVAQVIGEDLPEGAQKSEFLLEHGMIDKIVERKELKTTLQTLLDYFLAQE
FT                   YTGGKSKAPRDLSKRLKEIFLLTDDSE"
FT   gene            72112..72549
FT                   /locus_tag="CpB0060"
FT   CDS_pept        72112..72549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0060"
FT                   /product="deoxyuridine 5-triphosphate nucleotidohydrolase"
FT                   /note="similar to deoxyuridine 5-triphosphate
FT                   nucleotidohydrolase - Streptomyces coelicolor'"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97993"
FT                   /db_xref="GOA:Q9Z9C2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9C2"
FT                   /protein_id="AAP97993.1"
FT                   /translation="MTVFCELDSGGELPEYTTPGAAGADLRANIEEPIALLPGQRALIP
FT                   TGIKAEIPEGYELQVRPRSGLALKHGITVLNSPGTIDSDYRGEIRVILINFGDSTFIIE
FT                   PKMRIAQVVLSPVVQATFVVKQESLAETARGSGGFGHTGAS"
FT   gene            72527..73027
FT                   /gene="fruA"
FT                   /locus_tag="CpB0061"
FT   CDS_pept        72527..73027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="CpB0061"
FT                   /product="PTS fructose-specific enzyme IIBC component"
FT                   /note="similar to PTS fructose-specific enzyme IIBC
FT                   component fruA - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97994"
FT                   /protein_id="AAP97994.1"
FT                   /translation="MVILEQAKMPSYCQNQQDFSLFSLLSPRLVMFLGKHSRDEILQDL
FT                   TDLVDAAGLLEDKQAFFDALVRRENIMSTGIGMGVAIPHGKLESCSNFFIAIGIHTQGI
FT                   LWDAIDGALVRLVFLIGGPENAQAEYLKLLSTLTLSLREESRRQQLLQVNTIEEVMNVF
FT                   VGM"
FT   gene            73030..73707
FT                   /gene="ptsN"
FT                   /locus_tag="CpB0062"
FT   CDS_pept        73030..73707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="CpB0062"
FT                   /product="phosphotransferase system enzyme II"
FT                   /note="similar to phosphotransferase system enzyme II ptsN
FT                   - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97995"
FT                   /protein_id="AAP97995.1"
FT                   /translation="MDLKLDEVASLLDVSEHTVLQWLKEGAIPSYSMNNEYRFSREEIE
FT                   DWLLHNQALMIQERGEDKEALKDLSLKYSLYKAIHRGGVLCDVVVHSKEEALQYASKYI
FT                   AQKFQLDESVLFEMLSHRENLMSTGIGEGIALPHAKDFLINAYYDIVVPMFLAEPIEYG
FT                   ALDGKPVGILFFLFACQDKSHLNLVNKIVHLGMSLNARSFFKNYPNKDQLLAYVKEWES
FT                   QTH"
FT   gene            73804..75189
FT                   /gene="mst101"
FT                   /locus_tag="CpB0063"
FT   CDS_pept        73804..75189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mst101"
FT                   /locus_tag="CpB0063"
FT                   /product="sperm tail-specific-like protein"
FT                   /note="similar to sperm tail-specific protein mst101(2) -
FT                   Drosophila hydei"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97996"
FT                   /protein_id="AAP97996.1"
FT                   /translation="MMSSKRTSKIAVLSILLTFTHSIGFANANSSVGLGTVYITSEVVK
FT                   KPQKGSERKQAKKEPRARKGYLVPSSRTLSARAQKMKNSSRKESSGGCNEISANSTPRS
FT                   VKLRRNKRAEQKAAKQGFSAFSNLTLKSLLPKLPSKQKTSIHEREKATSRFVNESQLSS
FT                   ARKRYCTPSSAAPSLFLETEIVRAPVERTKELQDNEIHIPVVQVQTNPKEQNTKTTKQL
FT                   ASQASIQQSEGTEQSLRELAQGASLPVLVRSNPEVSVQRQKEELLKELVAERRQCKRKS
FT                   VRQALEARSLTKKVARGGSVTSTLRYDPEKAAEIKSRRNCKVSPEAREQKYSSCKRDAR
FT                   ANGKQDKTTPSEDASQEEQQTGAGLVRKTPKSQVASNAQNFYRNSKNTNIDSYLTANQY
FT                   SCSSEETDWPCSSCVSKRRTHNSISVCTMVVTVIAMIVGALIIANATESQTTSDPTPPT
FT                   PTP"
FT   gene            75468..75728
FT                   /locus_tag="CpB0064"
FT   CDS_pept        75468..75728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97997"
FT                   /protein_id="AAP97997.1"
FT                   /translation="MCCIALLYCIVSDLRVHSRGTPTQTHSEICDAHPTNRFLKKHPTL
FT                   DLCMRIVSTIVSVFMILADIVLLLGSLLLLPLLIVLLWESS"
FT   gene            75842..76075
FT                   /locus_tag="CpB0065"
FT   CDS_pept        75842..76075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97998"
FT                   /protein_id="AAP97998.1"
FT                   /translation="MTKIQCSAQYYRSRPAERAQTPPQPFLARDRADFWERHPRFSACC
FT                   RVLLLVAWVVLALLFLFVMLLPLAAGSYLLAF"
FT   gene            76399..78150
FT                   /locus_tag="CpB0066"
FT   CDS_pept        76399..78150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0066"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT288 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAP97999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9B6"
FT                   /protein_id="AAP97999.1"
FT                   /translation="MFFKKNYMTDFPTHFKGPKLNPIKVNPNFFERNPKVARVLQITAV
FT                   VLGIIALLSGIVLIIGTPLGAPISMILGGCLLASGGALFVGGTIATILQARNSYKKAVN
FT                   QKKLSEPLMERPELKALDYSLDLKEVWDLHHSVVKHLKKLDLNLSETQREVLNQIKIDD
FT                   EGPSLGECAAMISENYDACLKMLAYREELLKEQTQYQETRFNQNLTHRNKVLLSILSRI
FT                   TDNISKAGGVFSLKFSTLSSRMSRIHTTTTVILALSAVVSVMVVAALIPGGILALPILL
FT                   AVAISAGVIVTGLSYLVRQILSNTKRNRQDFYKDFVKNVDIELLNQTVTLQRFLFEMLK
FT                   GVLKEEEEVSLEGQDWYTQYITNAPIEKRLIEEIRVTYKEIDAQTKKMKTDLEFLENEV
FT                   RSGRLSVASPSEDPSETPIFTQGKEFAKLRRQTSQNISTIYGPDNENIDPEFSLPWVPK
FT                   KEEEIDHSLEPVTKLEPGSREELLLVEGVNPTLRELNMRIALLQQQLSSVRKWRHPRGE
FT                   HYGNVIYSDTELDRIQMLEGAFYNHLREAQEEITQSLGDLVDIQNRILGIIVEGDSDSR
FT                   TEEEPQE"
FT   gene            78421..80154
FT                   /locus_tag="CpB0067"
FT   CDS_pept        78421..80154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0067"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT326 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98000"
FT                   /protein_id="AAP98000.1"
FT                   /translation="MANPTQSRPPSPEISIEELELQELAGSSNTETISNTPPPSCAATA
FT                   EEVSLFIEGGRRNSEDEEGPLGSCEVYDVVCITNQGDPEVRDHEVRVMYINGSGRTQHE
FT                   GILDAMNICDLRGEPVRFIHNSGYGLGSCFLGIRNRIPPRDNVISQAIQARWNEFFIFA
FT                   ENANRDYIVLFSGNGGLYLQVALDNSIYSHHILCVGIGSSYYIQGNYRVHNYRVTGDWT
FT                   TLLDRRGATAVNTTTLPYADSAEGLFLPSVRCPSYQWALRCGEQCLIMDNNQQVGFRPQ
FT                   DSSSEIALVVNLNQDHSTWTRLIEWIDRGDSQAVLELNPQPSHCRDIALTALYATTRIS
FT                   SLLQECLMISVTYAPEVFVTYAIVTGYSIMTLRYFILLLTNRPGCRRHFRVLRLAALGL
FT                   QSLGFLTVLLDHINVTRRVNRRPPLISVIFCTASFATGSFIYVDLTRMFFTSLRSRLQL
FT                   FVQRRLTGRGLPLRRVFVNHLDSLRFSQNALITFHGGLFMPLIIGFFNQLVIQVPRVVI
FT                   RPNTTAVYDLNQTSQEAWDSGDVLAIGQTINFLLCMILLVINTFFFVRSVRRNLHRRPH
FT                   R"
FT   gene            80449..81552
FT                   /locus_tag="CpB0068"
FT   CDS_pept        80449..81552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98001"
FT                   /protein_id="AAP98001.1"
FT                   /translation="MAVEGRVNSSQALNQDCQEVLANKQSKGLLRCRILSIVVAVITFI
FT                   AGVVLIALTLASILTSVPYLALGVFLLIVTLGCIIFALCSEKIKKVPPTPISHKEEIIA
FT                   WFEERKNIDMEKEKEDPEHFGRTATDIPMRSALDQFNHSCHHIHESPALTETYRSHQDV
FT                   LLFKDWCPVTLPDVTSEEEVLIRSVVGSYLLMEACVPKVSMLIDELHNKLKSPSERECL
FT                   FIDKKTLQRKASFLFTQKDLATFFLAYTRVNDGHLAPFRAGAKWILIHYVRLRRQHNQN
FT                   DFFTPGHSCYYARLAFNQTQRLYHQLFNVEKLRSIYANMDKDPLCHPWAFIPIYDLLKT
FT                   EDHGDGFLEQQEDREYPSRAAQDQFWG"
FT   gene            complement(81824..82399)
FT                   /locus_tag="CpB0069"
FT   CDS_pept        complement(81824..82399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0069"
FT                   /product="hypothetical protein"
FT                   /note="similar to F25H5.5 - Caenorhabditis elegans"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98002"
FT                   /protein_id="AAP98002.1"
FT                   /translation="MIKKFFIYSLIFSCSFSAPLKGICNEDVSSQSRIEEDPEVLITQL
FT                   NELIETPIEEGKEIRNELQAISDGQKSSEEIEESCGTSDSEGLSEKTDKESSNEYVLDF
FT                   FDSMVQRLEGISKMCQSGQVAQIIDCFNREFDIRNRELELKNRELELREKDLEFKKSIL
FT                   DWNKEKVSRELAFQREQDIKQTLMLLKK"
FT   gene            83022..84584
FT                   /locus_tag="CpB0070"
FT   CDS_pept        83022..84584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0070"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT326 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98003"
FT                   /protein_id="AAP98003.1"
FT                   /translation="MFGTLVSTLCCPANSERDWEDHEVNCIYIASTSDTQLEAVQGGMH
FT                   ITELRGEPVRVLYETGHLYAFARENTCHSRLEVSHTVRAMTYFWDRFFSRHWNVGRRFL
FT                   VFYQGNGGAYVQAALDSSMHTQDIYVLGLSPTVYIRGNYHVQHYRVRGFWPSCLDSLAA
FT                   CAENTSVLPYGESSDGIFYPSLFSHTFDNAIRYGERCLLVCSEGMGMLPETQQQTSPLT
FT                   SLEGGHEVALVLNPQQNPEALSIASRLMHEERGGRLESNYMPGRSSNPFMTSMYVLVRL
FT                   NTLAQIYLMSPYYSFQSNDIVCLIFISSAAVETVSYIFLTVTDSTCGRRYLRVPRLVCT
FT                   GLRNLALPTTLLELLILSYPRSVEGVPFNVRFILGYMCTTRVVFFAWNLILHWPFRCLR
FT                   HGIQLFVHRSIIGHTLGARITDLTLASMRYAIVFPSIVSSCLLTALAHANTNILALDPY
FT                   RLIESGDLRRPAFNDDEMQQADNPWDAYSIGLVINTCIYMLILFANLIFMVYSVRRYHR
FT                   SRR"
FT   gene            complement(84945..85017)
FT                   /locus_tag="CpBt01"
FT   tRNA            complement(84945..85017)
FT                   /locus_tag="CpBt01"
FT                   /product="tRNA-Met"
FT                   /note="CAT"
FT   gene            complement(85090..85539)
FT                   /locus_tag="CpB0071"
FT   CDS_pept        complement(85090..85539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0071"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT325 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98004"
FT                   /protein_id="AAP98004.1"
FT                   /translation="MEFICPLQHARCLKKQHKIIEELFPEPFQKDHLYLKLMENSSSRD
FT                   AFDKKRMLKENLVVGCQSDLYLYEVYQDGILFFFTYTKALMSSGIASLFTEVYSGETPS
FT                   TILTCKPIFFQRLTPYLSFGRLNGGESLYMRMKQIAVQYLKPPQT"
FT   gene            complement(85548..86579)
FT                   /locus_tag="CpB0072"
FT   CDS_pept        complement(85548..86579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0072"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT324 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98005"
FT                   /protein_id="AAP98005.1"
FT                   /translation="MFYFFHYRMSTPLSSGGISPSDQYVPQELFCDRLSSSRSNSPDSN
FT                   ASGDSPIVSPPISALVALTDLKLVPYNQNSFSWTTRLKNAVEKIGLFLQRNWKYILLYI
FT                   LAWALILVCHHTVALTLTIWLGVGLGIGVVFGIFTATCLDKENKHRHVNSLWNLINHGI
FT                   LQLDPNGTRQILLATMIASISALIYAVPQAVGLVIGFSIGNQLSINTVYGARLGDEATY
FT                   AIDRKAHKKRIENIEQAINQHQIIKHQMINQKQLNALIEINRNNQTDPATANLLASLKL
FT                   NLNQPMPYCFSMPECGVTSSYLDLNNNSPDDIIARADQCIMTLSQTLQQIKKEPDRIIE
FT                   SNH"
FT   gene            86850..87071
FT                   /locus_tag="CpB0073"
FT   CDS_pept        86850..87071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0073"
FT                   /product="translation initiation factor IF-1"
FT                   /note="similar to translation initiation factor IF-1 -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98006"
FT                   /db_xref="GOA:Q9Z9A8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A8"
FT                   /protein_id="AAP98006.1"
FT                   /translation="MAKKEDTLVLEGKVEELLPGMHFRVILENGMPVTAHLCGKMRMSN
FT                   IRLLVGDRVTVEMSAYDLTKARVVYRHR"
FT   gene            87152..87223
FT                   /locus_tag="CpBt02"
FT   tRNA            87152..87223
FT                   /locus_tag="CpBt02"
FT                   /product="tRNA-Thr"
FT                   /note="GGT"
FT   gene            87268..88452
FT                   /locus_tag="CpB0074"
FT   CDS_pept        87268..88452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0074"
FT                   /product="translation elongation factor EF-Tu"
FT                   /note="similar to translation elongation factor EF-Tu -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98007"
FT                   /db_xref="GOA:Q9Z9A7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A7"
FT                   /protein_id="AAP98007.1"
FT                   /translation="MSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGDGLASFR
FT                   DYSSIDNTPEEKARGITINASHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSATDGAMPQTKEHILLARQVGVPYIVVFLNKVDMISQEDAELIDLVEMELSELLEEK
FT                   GYKGCPIIRGSALKALEGDANYIEKVRELMQAVDDNIPTPEREIDKPFLMPIEDVFSIS
FT                   GRGTVVTGRIERGIVKVSDKVQLVGLGETKETIVTGVEMFRKELPEGRAGENVGLLLRG
FT                   IGKNDVERGMVVCQPNSVKPHTKFKSAVYVLQKEEGGRHKPFFSGYRPQFFFRTTDVTG
FT                   VVTLPEGTEMVMPGDNVELDVELIGTVALEEGMRFAIREGGRTIGAGTISKINA"
FT   gene            88493..88565
FT                   /locus_tag="CpBt03"
FT   tRNA            88493..88565
FT                   /locus_tag="CpBt03"
FT                   /product="tRNA-Trp"
FT                   /note="CCA"
FT   gene            88596..88847
FT                   /gene="secE"
FT                   /locus_tag="CpB0075"
FT   CDS_pept        88596..88847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CpB0075"
FT                   /product="SecE"
FT                   /note="similar to protein-export protein secE -
FT                   Staphylococcus carnosus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98008"
FT                   /protein_id="AAP98008.1"
FT                   /translation="MKQQHNRKALSRKIGTVKKQAKFAGSFLDEIKKIEWVSKHDLKKY
FT                   IKVVLISIFGFGFAIYFVDLVLRKSITCLDGITTFLFG"
FT   gene            88852..89400
FT                   /gene="nusG"
FT                   /locus_tag="CpB0076"
FT   CDS_pept        88852..89400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CpB0076"
FT                   /product="transcription antitermination factor"
FT                   /note="similar to transcription antitermination factor nusG
FT                   - Staphylococcus carnosus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98009"
FT                   /db_xref="GOA:Q9Z9A5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A5"
FT                   /protein_id="AAP98009.1"
FT                   /translation="MYKWYVVQVFTAQEKKVKKALEDFKESSGMTDFIQEIILPIENVM
FT                   EVKKGEHKVVEKYIWPGYLLVKMHLTDESWLYVKSTAGIVEFLGGGVPVALSEDEVRSI
FT                   LTDIEEKKSGVVQKHQFEVGSRVKINDGVFVNFIGMVSEVFHDKGRLSVMVSIFGRETR
FT                   VDDLEFWQVEEVAPGQESE"
FT   gene            89507..89932
FT                   /locus_tag="CpB0077"
FT   CDS_pept        89507..89932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0077"
FT                   /product="ribosomal protein L11"
FT                   /note="similar to ribosomal protein L11 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98010"
FT                   /db_xref="GOA:Q9Z9A4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A4"
FT                   /protein_id="AAP98010.1"
FT                   /translation="MSVKKVIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNA
FT                   ATQDKPGDLLPVVITVYADKTFTFITKQPPVSSLIKKTLNLESGSKIPNRNKVGKLTQA
FT                   QVEAIAEQKMKDMDIVLLESAKRMVEGTARSMGIDVE"
FT   gene            89959..90657
FT                   /locus_tag="CpB0078"
FT   CDS_pept        89959..90657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0078"
FT                   /product="ribosomal protein L1"
FT                   /note="similar to ribosomal protein L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98011"
FT                   /db_xref="GOA:Q9Z9A3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A3"
FT                   /protein_id="AAP98011.1"
FT                   /translation="MTKHGKRIRGILKNYDFSKSYSLREAIDILKQCPPVRFDQTVDVS
FT                   IKLGIDPKKSDQQIRGAVFLPNGTGKTLRILVFASGNKVKEAVEAGADFMGSDDLVEKI
FT                   KSGWLEFDVAVATPDMMREVGKLGKVLGPRNLMPTPKTGTVTTDVAKAISELRKGKIEF
FT                   KADRAGVCNVGVGKLSFESSQIKENIEALSSALIKAKPPAAKGQYLVSFTISSTMGPGI
FT                   SIDTRELMAS"
FT   gene            90673..91185
FT                   /locus_tag="CpB0079"
FT   CDS_pept        90673..91185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0079"
FT                   /product="ribosomal protein L10"
FT                   /note="similar to ribosomal protein L10 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98012"
FT                   /db_xref="GOA:Q9Z9A2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A2"
FT                   /protein_id="AAP98012.1"
FT                   /translation="MKQEKTLLLQEVEDKISAAQGFILLRYLRFTAAYSREFRNSLSGV
FT                   SAEFEVLKKRIFFKAIEAAGLEVDCSDTDGHLGVVFSCGDPVSAAKQVLDFNKQHKDSL
FT                   VFLAGRMDNASLSGAEVEAVAKLPSLKELRQQVVGLFAAPMSQVVGIMNSVLSGVISCV
FT                   DQKAGKN"
FT   gene            91229..91618
FT                   /locus_tag="CpB0080"
FT   CDS_pept        91229..91618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0080"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="similar to ribosomal protein L7/L12 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98013"
FT                   /db_xref="GOA:Q9Z9A1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A1"
FT                   /protein_id="AAP98013.1"
FT                   /translation="MTTESLETLVEKLSNLTVLELSQLKKLLEEKWDVTASAPVVAVAA
FT                   GGGGEAPVAAEPTEFAVTLEDVPADKKIGVLKVVREVTGLALKEAKEMTEGLPKTVKEK
FT                   TSKSDAEDTVKKLQDAGAKASFKGL"
FT   gene            91755..95513
FT                   /locus_tag="CpB0081"
FT   CDS_pept        91755..95513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0081"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /note="similar to DNA-directed RNA polymerase beta chain
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98014"
FT                   /db_xref="GOA:Q9Z9A0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9A0"
FT                   /protein_id="AAP98014.1"
FT                   /translation="MLKCPERVSVKKKEDIPDLPNLIEIQIKSYKQFLQIGKLAEEREN
FT                   IGLEEVFREIFPIKSYNEATVLEYLSYNLGVPKYSPEECIRRGITYSVTLKVRFRLTDE
FT                   TGIKEEEVYMGTIPLMTDKGTFIINGAERVVVSQVHRSPGINFEQEKHSKGNILFSFRI
FT                   IPYRGSWLEAIFDINDLIYIHIDRKKRRRKILAITFIRALGYSSDADIIEEFFTIGESS
FT                   LRSEKDFALLVGRILADNIIDEASSLVYGKAGEKLSTAMLKRMLDAGIASVKIAVDADE
FT                   NHPIIKMLAKDPTDSYEAALKDFYRRLRPGEPATLANARSTIMRLFFDPKRYNLGRVGR
FT                   YKLNRKLGFSIDDEALSQVTLRKEDVIGALKYLIRLKMGDEKACVDDIDHLANRRVRSV
FT                   GELIQNQCRSGLARMEKIVRERMNLFDFSSDTLTPGKVVSAKGLASVLKDFFGRSQLSQ
FT                   FMDQTNPVAELTHKRRLSALGPGGLNRERAGFEVRDVHASHYGRICPIETPEGPNIGLI
FT                   TSLSSFAKINEFGFIETPYRIVRDGIVTDEIEYMTADVEEECVIAQASASLDEYNMFTE
FT                   PVCWVRYAGEAFEADTSTVTHMDVSPKQLVSIVTGLIPFLEHDDANRALMGSNMQRQAV
FT                   PLLKTEAPVVGTGLECRAAKDSGAIVVAEEDGVVDFVDGYKVVVAAKHNPTIKRTYHLK
FT                   KFLRSNSGTCINQQPLCAVGDVITKGDVIADGPATDRGELALGKNVLVAFMPWYGYNFE
FT                   DAIIISEKLIREDAYTSIYIEEFELTARDTKLGKEEITRDIPNVSDEVLANLGEDGIIR
FT                   IGAEVKPGDILVGKITPKSETELAPEERLLRAIFGEKAADVKDASLTVPPGTEGVVMDV
FT                   KVFSRKDRLSKSDDELVEEAVHLKDLQKGYKNQVATLKTEYREKLGALLLNEKAPAAII
FT                   HRRTAEIVVHEGLLFDQETIERIEQEDLVDLLMPNCEMYEVLKGLLSDYETALQRLEIN
FT                   YKTEVEHIREGDADLDHGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIVPEADMP
FT                   YLSNGETVQMILNPLGVPSRMNLGQVLETHLGYAAKTAGIYVKTPVFEGFPEQRIWDMM
FT                   IEQGLPEDGKSFLYDGKTGERFDNKVVIGYIYMLKLSHLIADKIHARSIGPYSLVTQQP
FT                   LGGKAQMGGQRFGEMEVWALEAYGVAHMLQEILTVKSDDVSGRTRIYESIVKGENLLRS
FT                   GTPESFNVLIKEMQGLGLDVRPMVVDA"
FT   gene            95537..99718
FT                   /locus_tag="CpB0082"
FT   CDS_pept        95537..99718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0082"
FT                   /product="RNA polymerase beta"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98015"
FT                   /db_xref="GOA:Q9Z999"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z999"
FT                   /protein_id="AAP98015.1"
FT                   /translation="MFGENSRDIGVLSKEGLFDKLEIGIASDITIRDKWSCGEIKKPET
FT                   INYRTFKPEKGGLFCEKIFGPTKDWECCCGKYKKIKHKGIVCDRCGVEVTLSKVRRERM
FT                   AHIELAVPIVHIWFFKTTPSRIGNVLGMTASDLERVIYYEEYVVIDPGKTDLTKKQLLN
FT                   DAQYREVVEKWGKDAFVAKMGGEAIYDLLKSEDLQSLLKDLKERLRKTKSQQARMKLAK
FT                   RLKIIEGFVSSSNHPEWMVLKNIPVVPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKAILRLKTPEVIVRNEKRMLQEAVDALFDNGRHGHPVMGAGNRPLKSLSEMLKGKNGR
FT                   FRQNLLGKRVDYSGRSVIIVGPELKFNQCGLPKEMALELFEPFIIKRLKDQGSVYTIRS
FT                   AKKMIQRGAPEVWDVLEEIIKGHPVLLNRAPTLHRLGIQAFEPVLIEGKAIRIHPLVCA
FT                   AFNADFDGDQMAVHVPLSVEAQLEAKVLMMAPDNIFLPSSGKPVAIPSKDMTLGLYYLM
FT                   ADPTYFPEEHGGKTKIFKDEIEVLRALNNGGFIDDVFGDRRDETGRGIHIHEKIKVRID
FT                   GQIIETTPGRVLFNRIVPKELGFQNYSMPSKRISELILQCYKKVGLEATVRFLDDLKDL
FT                   GFIQATKAAISMGLKDVRIPDIKSHILKDAYDKVAIVKKQYDDGIITEGERHSKTISIW
FT                   TEVSEQLSDALYVEISKQTRSKHNPLFLMIDSGARGNKSQLKQLGALRGLMAKPNGAII
FT                   ESPITSNFREGLTVLEYSISSHGARKGLADTALKTADSGYLTRRLVDVAQDVIITEKDC
FT                   GTLNHIEISAIGQGSEELLPLKDRIYGRTVAEDVYQPGDKSRLLAQSGDVLNSVQAEAI
FT                   DDAGIETIKIRSTLTCESPRGVCAKCYGLNLANGRLIGMGEAVGIIAAQSIGEPGTQLT
FT                   MRTFHLGGIAATSSTPEIITNSDGILVYMDLRVVLGQEGHNLVLNKKGALHVVGDEGRT
FT                   LNEYKKLLSTKSIESLEVFPVELGVKILVADGTPVSQGQRIAEVELHNIPIICDKPGFI
FT                   KYEDLVEGISTEKVVNKNTGLVELIVKQHRGELHPQIAIYDDADLSELVGTYAIPSGAI
FT                   ISVEEGQRVDPGMLLARLPRGAIKTKDITGGLPRVAELVEARKPEDAADIAKIDGVVDF
FT                   KGIQKNKRILVVCDEMTGMEEEHLIPLTKHLIVQRGDSVIKGQQLTDGLVVPHEILEIC
FT                   GVRELQKYLVNEVQEVYRLQGVDINDKHIEIIVRQMLQKVRITDPGDTTLLFGEDVNKK
FT                   EFYEENRRTEEDGGKPAQAVPVLLGITKASLGTESFISAASFQDTTRVLTDAACCSKTD
FT                   YLLGFKENVIMGHMIPGGTGFETHKRIKQYLEKEQEDLVFDFVSETECVC"
FT   gene            99827..100810
FT                   /locus_tag="CpB0083"
FT   CDS_pept        99827..100810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0083"
FT                   /product="transaldolase"
FT                   /note="similar to transaldolase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98016"
FT                   /db_xref="GOA:Q9Z998"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z998"
FT                   /protein_id="AAP98016.1"
FT                   /translation="MSNQFDQLKKLSTIVCDSGDPELVKASGSQDATTNPSLILKVAQE
FT                   PKFQELLNEAVVWGIRQNGDDLQTLSFILDKIQVNFALEIIKNIPGRISLEIDARLSFN
FT                   VEAMVQRAVFLSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLEAKGIACNVTLIFNLVQ
FT                   AIAAAKAKATLISPFVGRIYDWWIAAYGDEGYSIDADPGVASVSNIYAYYKKFGIPTQI
FT                   MAASFRTKEQVLALAGCDLLTISPKLLDELKKSQHPVKKELDPAEAKKLDVQPIELTES
FT                   FFRFLMNEDAMATEKLAEGIRIFAGDTQILETAITEFIKQIAAEGA"
FT   gene            100869..101249
FT                   /locus_tag="CpB0084"
FT   CDS_pept        100869..101249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0084"
FT                   /product="putative predied ferredoxin"
FT                   /note="similar to probable predied ferredoxin - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98017"
FT                   /protein_id="AAP98017.1"
FT                   /translation="MDYKSQLVFSCPCCCKGNVCFSVFNLDVILTCNVCSSTYTFDSVI
FT                   RNEIRQFVALCKRIHDANSILGNATVSVSVEDNQMDIPFQLLFSRFPVVLNLSLDGKKI
FT                   AIRFLFDALNTSILHQESDLIS"
FT   gene            complement(101258..102001)
FT                   /locus_tag="CpB0085"
FT   CDS_pept        complement(101258..102001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0085"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT311 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98018"
FT                   /protein_id="AAP98018.1"
FT                   /translation="MKFFILFILIVAQFPAFSAQPRTQVSASHSKQAKARRTSRIRSSA
FT                   ATNASVSRYKTRAAARKKIGKFEKKPSLSPVQWVRYSGKNYSIQTPSLWQCIDDKTQLP
FT                   EKLDVLLIGKGKGNLTPTINIAQEITSKSSKEYIEEILAYHKANEMTLESGIFTQIQSP
FT                   SGEFTIIKTEKNSSWGRVFCLQATTVIDHTAYIFTSTATLDDYAELSFTFLKVVSSFQI
FT                   RGGKEATSGDAILEKALEALQNENK"
FT   gene            102399..103025
FT                   /gene="hrpE"
FT                   /locus_tag="CpB0086"
FT   CDS_pept        102399..103025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpE"
FT                   /locus_tag="CpB0086"
FT                   /product="HrpE"
FT                   /note="similar to hrpE gene - Erwinia amylovora"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98019"
FT                   /db_xref="GOA:Q9Z995"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR009335"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z995"
FT                   /protein_id="AAP98019.1"
FT                   /translation="MANLNADGKLKQICDALRLDTLKPAEDEAAALLHNAKEQAKRIIQ
FT                   EAQEEARKILETAEERAHQKIKQGEVALSQAGKRALEALKQAVENKIFRESLVEWLEHV
FT                   TTDPEVSTKLIQALVQALEAQGVSGNLTAYIGKHVSPRAVNELLGKAVTTKLRKKSVVV
FT                   GSFVGGVQLKVEEKNWVLDLSSSALLEIFTRYLQKDFREMIFQGS"
FT   gene            103074..103874
FT                   /locus_tag="CpB0087"
FT   CDS_pept        103074..103874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0087"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT309 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98020"
FT                   /db_xref="InterPro:IPR024492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z994"
FT                   /protein_id="AAP98020.1"
FT                   /translation="MTQYYFLSSFLPTQLPESVPLFSISDLDDLLYLNLSENDLCNYGL
FT                   LKRFFDFENFAFFWAGKPIPFSFGEVTQENIERMLSSQQWSDDNDFEDFFKDFLMNHKS
FT                   SQDRLNHFSDLFREFLSYHQTNSSKFLQDYFRFQQQLRVVLAGFRARVLNMDVSYVLRD
FT                   EDSSDPVVLEVLMQKDSPNYELPEEFSDLQGVLDDYGLLPHTLNRALALYQFHKLEGFC
FT                   SDSYFDGNVILARCATYMFAIRNSLASVEKGREIINHIEKAIKW"
FT   gene            103868..105643
FT                   /locus_tag="CpB0088"
FT   CDS_pept        103868..105643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0088"
FT                   /product="H+-transporting ATP synthase alpha chain"
FT                   /note="similar to H+-transporting ATP synthase alpha chain
FT                   - Haloferax volcanii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98021"
FT                   /db_xref="GOA:Q9Z993"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z993"
FT                   /protein_id="AAP98021.1"
FT                   /translation="MVTVSEQTAQGHVIEAYGNLLRVRFDGYVRQGEVAYVNVDNTWLK
FT                   AEVIEVADQEVKVQVFEDTQGACRGALVTFSGHLLEAELGPGLLQGIFDGLQNRLEVLA
FT                   EDSSFLQRGKHVNAISDHNLWNYTPVASVGDTLRRGDLLGTVPEGRFTHKIMVPFSCFQ
FT                   EVTLTWVISEGTYNAHTVVAKARDAQGKECAFTMVQRWPIKQAFIEGEKIPAHKIMDVG
FT                   LRILDTQIPVLKGGTFCTPGPFGAGKTVLQHHLSKYAAVDIVILCACGERAGEVVEVLQ
FT                   EFPHLIDPHTGKSLMHRTCIICNTSSMPVAARESSIYLGVTIAEYYRQMGLDILLLADS
FT                   TSRWAQALREISGRLEEIPGEEAFPAYLSSRIAAFYERGGAITTKDGSEGSLTICGAVS
FT                   PAGGNFEEPVTQSTLAVVGAFCGLSKARADARRYPSIDPLISWSKYLNQVGQILEEKVS
FT                   GWGGAVKKAAQFLEKGSEIGKRMEVVGEEGVSMEDMEIYLKAELYDFCYLQQNAFDPVD
FT                   CYCPFERQIELFSLISRIFDAKFVFDSPDDARSFFLELQSKIKTLNGLKFLSEEYHESK
FT                   EVIVRLLEKTMVQMA"
FT   gene            105648..106964
FT                   /locus_tag="CpB0089"
FT   CDS_pept        105648..106964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0089"
FT                   /product="H+-transporting ATPase chain B"
FT                   /note="similar to H+-transporting ATPase chain B -
FT                   Enterococcus hirae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98022"
FT                   /db_xref="GOA:Q9Z992"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z992"
FT                   /protein_id="AAP98022.1"
FT                   /translation="MQTIYTKITDIKGNLITVEAEGARLGELATITRSDGRSSYASVLR
FT                   FDLKKVTLQVFGGTSGLSTGDHVTFLGRPMEVTFGSSLLGRRLNGIGKPIDNEGECFGE
FT                   PIEIATPTFNPVCRIVPRSMVRTNIPMIDVFNCLVKSQKIPIFSSSGEHHNALLMRIAA
FT                   QTDADIVVIGGMGLTFVDYSFFVEESKKLGFADKCVMFIHKAVDAPVECVLVPDMALAC
FT                   AEKFAVEEKKNVLVLLTDMTAFADALKEISITMDQIPANRGYPGSLYSDLALRYEKAVE
FT                   IADGGSITLITVTTMPSDDITHPVPDNTGYITEGQFYLRNNRIDPFGSLSRLKQLVIGK
FT                   VTREDHGDLANALIRLYADSRKATERMAMGFKLSNWDKKLLAFSELFETRLMSLEVNIP
FT                   LEEALDIGWKILAQSFTSEEVGIKAQLINKYWPKACLSK"
FT   gene            107054..107578
FT                   /locus_tag="CpB0090"
FT   CDS_pept        107054..107578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0090"
FT                   /product="H+-transporting ATP synthase subunit D"
FT                   /note="similar to H+-transporting ATP synthase, subunit D -
FT                   Methanosacina mazei"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98023"
FT                   /db_xref="GOA:Q9Z991"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z991"
FT                   /protein_id="AAP98023.1"
FT                   /translation="MQAEVQNAVKDAAECDKDYVQAYERIYAFAELFSIPLCTDCVEKS
FT                   FEIQSIDNDFENIAGVEVPIVREVTLFPASYSLLGTPIWLDTMLSASKELVVKKVMAEV
FT                   SKERLKILEEELRAVSIRVNLFEKKLIPETTKILKKIAVFLSDRSITDVGQVKMAKKKI
FT                   ELRKARGDECV"
FT   gene            107569..109551
FT                   /gene="ntpI"
FT                   /locus_tag="CpB0091"
FT   CDS_pept        107569..109551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="CpB0091"
FT                   /product="H+-transporting ATP synthase subunit I"
FT                   /note="similar to H+-transporting ATP synthase subunit ntpI
FT                   - Enterococcus hirae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98024"
FT                   /db_xref="GOA:Q9Z990"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z990"
FT                   /protein_id="AAP98024.1"
FT                   /translation="MRLNIHKYLFIGRNKADFFSASRELGVVEFISKKCFITTEQGHRF
FT                   VECLKVFDHLEAEYSLEALEFVKDESVSVEDIVSEVLTLNKEIKGLLETVKALRKEIVR
FT                   VKPLGAFSSSEIAELSRKTGISLRFFYRTHKDNEDLEEDSPNVFYLSTAYNFDYYLVLG
FT                   VVDLPRDRYTEIEAPRSVNELQVDLANLQREIRNRSDRLCDLYAYRREVLRGLCNYDNE
FT                   QRLHQAKECCEDLFDGKVFAVAGWVIVDRIKELQSLCNRYQIYMERVPVDPDETIPTYL
FT                   ENKGVGMMGEDLVQIYDTPAYSDKDPSTWVFFAFVLFFSMIVNDAGYGLLFLMSSLLFS
FT                   WKFRRKMKFSKHLSRMLKMTAILGLGCICWGTTTTSFFGMSFSKTSVFREYSMTHVLAL
FT                   KKAEYYLQMRPKAYKELTNEYPSLKAIRDPKAFLLATEIGSAGIESRYVVYDKFIDNIL
FT                   MELALFIGVVHLSLGMLRYLRYRYSGIGWILFMVSAYLYVPIYLGTVSLIHYLFHVPYE
FT                   LGGQIGYYGMFGGIGLAVVLAMIQRSWRGVEEIISVIQVFSDVLSYLRIYALGLAGAMM
FT                   GATFNQMGARLPMLLGSIVILLGHSVNIILSIMGGVIHGLRLNFIEWYHYSFDGGGRPL
FT                   RPLRKIVCSEDAEASGIHLDNNSIV"
FT   gene            109646..110071
FT                   /locus_tag="CpB0092"
FT   CDS_pept        109646..110071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0092"
FT                   /product="Na+-ATPase complex 16K proteolipid chain"
FT                   /note="similar to Na+-ATPase complex 16K proteolipid chain
FT                   - Enterococcus hirae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98025"
FT                   /protein_id="AAP98025.1"
FT                   /translation="MIDMSVVGPALVLGLAMIGSAIGCGMAGVASHAVMSRIDEGHGKL
FT                   IGMSAMPSSQSIYGFILMLLMQAAIKNGTLSPVGGIAIGLSVGAALLVSSVMQGKCCVS
FT                   GIQAYARSSSIYGKCYAAIGIVESFSLFAVVFALLLL"
FT   gene            109950..110513
FT                   /locus_tag="CpB0093"
FT   CDS_pept        109950..110513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0093"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT303 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98026"
FT                   /protein_id="AAP98026.1"
FT                   /translation="MSAEFKLMLDLRQYMGSVMQRLGLSNLFHCLLLFLRYYYSKLVFG
FT                   LTVLLAAISVICLLGCSEPSLSSFTEYVGPEYSAAAQLSIEQSCHDEVYGQQVVVTWSL
FT                   PSRMRKCLPVTLYLWVYYGNGKVEKLTYEVNQSAGYRVYCLKGLEYKELQGIISYRVAL
FT                   CSGNQEIVSRRHHLWMEVISLDSP"
FT   gene            110647..113469
FT                   /locus_tag="CpB0094"
FT   CDS_pept        110647..113469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0094"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="similar to valyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98027"
FT                   /db_xref="GOA:Q9Z987"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z987"
FT                   /protein_id="AAP98027.1"
FT                   /translation="MTTEDFPKAYNFQDTEPELYVFWEKNGMFKAEASSDKPPYSVIMP
FT                   PPNVTGVLHMGHALVNTLQDVLVRYKRMSGFEVCWIPGTDHAGIATQAVVERHLQASEG
FT                   KRRTDYSREDFLKHIWAWKEKSEKVVLSQLRQLGCSCDWDRKRFTMEPLANRAVKKAFK
FT                   TLFENGYIYRGYYLVNWDPVLQTALADDEVEYEEKDGWLYYIRYRMVGSQESIVVATTR
FT                   PETSLGDTGIAVSPNDERYASWIGASVEVPFVNRQIPIIGDASVDPTFGTGAVKVTPAH
FT                   DKDDYLMGTNHHLPMINILTPSGGINENGGPFAGMAKEKAREEILIALEEQGLFVRKEP
FT                   YKLRVGVSYRSGAVIEPYLSKQWFVSVSEFRGALREFVESQDIKIFPKDFVKNYLSWVN
FT                   HLRDWCISRQLWWGHRIPVWYHKNDDERVLCYDGEGIPEEVAQDPDSWYQDPDVLDTWF
FT                   SSGLWPLTCLGWPDENSPDLKKFYPTALLVTGHDILFFWVTRMVLLCSSMSGEKPFSEV
FT                   FLHGLIFGKSYKRYNDFGEWSYISGKEKLAYDMGEALPDGVVAKWEKLSKSKGNVIDPL
FT                   EMIATYGTDAVRLTLCSCANRGEQIDLDYRLFEEYKHFANKVWNGARFIFGHISDLQGK
FT                   DLLAGIDEDSLGLEDFYILDGFNQLIHQLEEAYATYAFDKVATLAYEFFRNDLCSTYIE
FT                   IIKPTLFGKQGNEASQSTKRTLLAVLLINVLGVLHPVAPFITESLFLRIQDTLGALPEG
FT                   DGDAFTGHALRMLRSRACMEAPYPKAFDVKIPQDLRESFTLAQRLVYTIRNIRGEMQLD
FT                   PRLHLKAFVVCSDTTEIQSCIPILQALGGLESIQLLDKEPEKGLYSFGVVDTIRLGIFV
FT                   PEEHLLKEKGRLEKERVRLERAVENLERLLGDESFCQKANPNLVVAKQEALKNNRIELQ
FT                   GILDKLASFA"
FT   gene            113490..116288
FT                   /gene="pkn1"
FT                   /locus_tag="CpB0095"
FT   CDS_pept        113490..116288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn1"
FT                   /locus_tag="CpB0095"
FT                   /product="Pkn1"
FT                   /note="similar to protein kinase pkn1 - Myxococcus xanthus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98028"
FT                   /db_xref="GOA:Q9Z986"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR023507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z986"
FT                   /protein_id="AAP98028.1"
FT                   /translation="MERYDIVRIIGKGGMGEVYLAYDPVCSRKVALKKIREDLAENPLL
FT                   KRRFLREARIAADLIHPGVVPVYTIYSEKDPVYYTMPYIEGYTLKTLLKSVWQKESLSK
FT                   ELAEKTSVGAFLSIFHKICCTIEYVHSRGILHRDLKPDNILLGLFSEAVILDWGAAVAC
FT                   GEEEDLLDIDVSKEEVLSSRMTIPGRIVGTPDYMAPERLLGHPASKSTDIYALGVVLYQ
FT                   MLTLSFPYRRKKGKKIVLDGQRIPSPQEVAPYREIPPFLSAVVMRMLAVDPQERYSSVT
FT                   ELKEDIESHLKGSPKWTLTTALPPKKSSSWKLNEPILLSKYFPMLEVSPASWYSLAISN
FT                   IESFSEMRLEYTLSKKGLNEGFGILLPTSENALGGDFYQGYGFWLHIKERTLSVSLVKN
FT                   SLEIQRCSQDLESDKETFLIALEQHNHSLSLFVDGTTWLIHMNYLPSRSGRVAIIVRDM
FT                   EDILEDIGIFESSGSLRVSCLAVPDAFLAEKLYDRALVLYRRIAESFPGRKEGYEARFR
FT                   AGITVLEKASTDNNEQEFALAIEEFSKLHDGVAAPLEYLGKALVYQRLQEYNEEIKSLL
FT                   LALKRYSQHPEIFRLKDHVVYRLHESFYKRDRLALVFMILVLEIAPQAITPGQEEKILV
FT                   WLKDKSRATLFCLLDPTVLELRSSKMELFLSYWSGFIPHLNSLFHRAWDQSDVRALIEI
FT                   FYVACDLHKWQFLSSCIDIFKESLEDQKATEEIVEFSFEDLGAFLFAIQSIFNKEDAEK
FT                   IFVSNDQLSPILLVYIFDLFANRALLESQGEAIFQALDLIRSKVPENFYHDYLRNHEIR
FT                   AHLWCRNEKALSTIFENYTEKQLKDEQHELFVLYGCYLALIQGAEAAKQHFDVCREDRI
FT                   FPASLLARNYNRLGLPKDALSYQERRLLLRQKFLYFHCLGNHDERDLCQTMYHLLTEEF
FT                   QL"
FT   gene            complement(116329..121809)
FT                   /locus_tag="CpB0096"
FT   CDS_pept        complement(116329..121809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0096"
FT                   /product="excinuclease ABC chain A"
FT                   /note="similar to excinuclease ABC chain A family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98029"
FT                   /db_xref="GOA:Q9Z985"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z985"
FT                   /protein_id="AAP98029.1"
FT                   /translation="MKSLPVYVSGIKVRNLKNVSIHFNSEEIVLLTGVSGSGKSSIAFD
FT                   TLYAAGRKRYISTLPTFFATTITTLPNPKVEEIHGLSPTIAIKQNHFSHYSHATVGSTT
FT                   ELFSHLALLFTLEGQARDPKTKEVLDLYSKEKVLSTIMELSEGVQISILAPLLRKDIAA
FT                   IHEYAQQGFTKVRCNGTIHPIYSFLTSGIPEDCSVDIVIDTLIKSENNIARLKVSLFTA
FT                   LEFGEGHCSVLSDEELMTFSTKQQIDDVTYTPLTQQLFSPHALESRCSLCQGSGIFISI
FT                   DNPLLIDENLSIKENCCSFAGNCSSYLYHTIYQALADALNFNLETPWKDLSPEIQNIFL
FT                   RGKNNLVLPVRLFDQTLGKKNLTYKVWRGVLNDIGDKVRYTTKPSRYLSKGMSAHSCSL
FT                   CKGTGLGDYASVATWEGKTFTEFQQMSLNNWHVFFSKVKSPSLSIQEILQGLKQRLSFL
FT                   IDLGLGYLTPNRALATLSGGEQERTAIAKHLGGELFGITYILDEPSIGLHPQDTEKLIG
FT                   VIKKLRDQGNTVILVEHEERMISLADRIIDIGPGAGIFGGEVLFNGKPEDFLMNSSSLT
FT                   AKYLRQELTIPIPESREAPTSWLLLTEATIHNLKNLSIRLPLARLIGVTGVSGSGKSSL
FT                   INNTLVPAIESFLKQENPKNLHFEWGCIGRLIHITRDLPGRSQRSIPLTYIKAFDDIRE
FT                   LFASQPRSLRQGLTKAHFSFNQPQGACIQCQGLGTMTISDDDTPIPCSECQGKRYHSEV
FT                   LEILYEGKNIADILDMTAYEAEKFFISHPKIHEKIHALCSLRLDYLPLGRPLSTLSGGE
FT                   IQRLKLAHELLFASPKQTLYVLDEPTTGLHTHDIQALIEVLLSLTYLGHTVLVIEHNMH
FT                   VVKVCDYVLELGPEGGDLGGYLLASCTPKDLIQLNTPTAKALAPYIEGSLDIPVVKSEP
FT                   PSSPKSCDILIKDAYQNNLKHIDLALPRNSLIAIAGPGASGKHSLVFDILYASGNIAYA
FT                   ELFPPYIRQGLLKETPLPSVGEVKGLSPVISVRKCSSSNRSYHTIASALGLSNGLEKLF
FT                   AILGEPFSPLTEEKLSKTTPQTIIDSLLKSYKDDYVTITSPIPLGSDLEIFLQEKQKEG
FT                   FIKLYSEGNLYDLDERLPLNLIEPAIVIQHTKVSPKNSSSLLSAISVAFSLSSEIWIYI
FT                   SQKKQRKLSYSLGWKDKKGRLYPEITHQLLSSDHPEGRCLTCGGRGEILKISLEEHKEK
FT                   IAHYTPLEFFSLFFPKSYMKPVQKLLKDENASQPLKLLTTKEFLNFCRGSSEFPGMNAL
FT                   LMEQLDTESDSPLIKPLLALTSCPACKGSGLNDYANYVRINNTSLLDIYQEDATFLESF
FT                   LNTIGTDDTRSIIQDLMNRLTFISKVGLSYITLGQRQDTLSDGENYRLHLAKKISINLT
FT                   NIVYLFEEPLSGLHPQDLPTIVQLLKELVANNNTVIATDRSCSLIPHADHAIFLGPGSG
FT                   PQGGFLMDSDTEVCPSVDLHANVPQTEVCPKAPLSISKANHTRGSDRTLKVNLSIHHIQ
FT                   NLKVSAPLHALVAIGGVSGSGKTSLLLEGFKKQAELLIAKGTTTFSDLVVIDSHPIASS
FT                   QRSDISTYFDIAPSLRAFYASLTQAKALNISSTMFSTNTKQGQCSDCQGLGYQWIDRAF
FT                   YALEKRPCPTCSGFRIQPLAQEVLYEGKHFGELLHTPIETVALRFPFIKKIQKPLKALL
FT                   DIGLGYLPIGQKLSSLSVSEKTALKTAYFLYQTPETPTLFLIDELFSSLDPIKKQHLPE
FT                   KLRSLINSGHSVIYIDHDVKLLKSADYLIEIGPGSGKQGGKLLFSGSPKDIYASKDSLL
FT                   KKYICNEELDS"
FT   gene            122050..123504
FT                   /locus_tag="CpB0097"
FT   CDS_pept        122050..123504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0097"
FT                   /product="pyruvate kinase"
FT                   /note="similar to pyruvate kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98030"
FT                   /db_xref="GOA:Q9Z984"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z984"
FT                   /protein_id="AAP98030.1"
FT                   /translation="MITRTKIICTIGPATNSPEMLAKLLDAGMNVARLNFSHGSHETHG
FT                   QAIGFLKELREQKRVPLAIMLDTKGPEIRLGNIPQPISVSQGQKLRLVSSDIDGSAEGG
FT                   VSLYPKGIFPFVPEGADVLIDDGYIHAVVVSSEADSLELEFMNSGLLKSHKSLSIRGVD
FT                   VALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGNPKMPIIAKIEN
FT                   RLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLE
FT                   SMIRNVLPTRAEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLSH
FT                   DSFLKLDDSNSALQVSPYLSAIGLAGIQIAERADAKALIVYTESGSSPMFLSKYRPKFP
FT                   IIAVTPSTSVYYRLALEWGVYPMLTQESDRAVWRHQACIYGIEQGILSNYDRILVLSRG
FT                   ACMEETNNLTLTIVNDILTGSEFPET"
FT   gene            complement(123598..124986)
FT                   /locus_tag="CpB0098"
FT   CDS_pept        complement(123598..124986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0098"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="similar to lipid A biosynthesis lauroyl
FT                   acyltransferase - Rickettsia prowazekii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98031"
FT                   /protein_id="AAP98031.1"
FT                   /translation="MGKKFHQIKRTILEAPLYYLVSGIIALCRHTPRSFLTGLGKGFGF
FT                   LAFYIISDYRKTALTNLALAFPEKTFDERYKIARQSLQHLIITLLELLAIEQLVGNIDK
FT                   LITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQGLILFCGHQANWELPFLYITKNY
FT                   PGIAFAKAIKNQRLSKKIFALREVFKGKIVPPKNGIQQGIEALNQGKLVGIVGDQALLM
FT                   SSYTYPLFGSPAFTTTSPALLAYKTGFPVIAVNVSRQAKGFEVIPSAKLYANKSLPMKE
FT                   SVAILMDQMMGFLEKGIASQPEQWMWIHKRWKRKISNVIKKKYRYSHILVFVDQVSSHF
FT                   SFLKALAECFSGTTLHLALGNADHLEELQEQFPEYSLIQLRNDQDILALPNCYPAIFDL
FT                   TNNLQHLYKHFRKTGSCAVYSKRFLEKSLDHPQAPLKNSLRIFYSKNLKDKERKNFKVK
FT                   SKGP"
FT   gene            complement(125039..125338)
FT                   /locus_tag="CpB0099"
FT   CDS_pept        complement(125039..125338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98032"
FT                   /protein_id="AAP98032.1"
FT                   /translation="MCLIDCLGQGFEAAINTVCCCSDSSESKANVATVSAGLLALTAIV
FT                   SFILIILICTGVLGASGMTFGMSNVAAVLVLVVTILLSMFLSGACFAAKREILR"
FT   gene            complement(125374..126651)
FT                   /locus_tag="CpB0100"
FT   CDS_pept        complement(125374..126651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0100"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT011 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98033"
FT                   /protein_id="AAP98033.1"
FT                   /translation="MDLETMIKFLSQLFIRHWPRKVVSLGFAIIIWILVGQSVTITRTL
FT                   TNVPVRIVDLHPDQTVLGLQKSGFLNKKVSLTITGNKNTVQDLRPSNLEVVISAANHTE
FT                   SWIATIDKHNLVSVDHEINIRKDIHSVDANDIFVRLTQYVTEDILLTITKPIGSPPKGY
FT                   EYLDVWPKYLNQKVSGPKEYINALKEQGLELTFNLNKISFEELERNRIAQGSHDEIIFP
FT                   IPKEWKKILIPFENTFMDLNDPQADFLRLLFLKRECIPLNLNLPVFLFFPVTFIQTMNP
FT                   LEYSLDPVPPIILNHGIHQINIPLYVKDVSRQFLDVVKNNMVLTIVMPSPQDPSSINWA
FT                   IEFLDEKTLENTFLQTIIAQEHGILHDIALIDEAGIRHRFREYLRKLALFTADGEPLNL
FT                   IAEIKNNKVVIQTKTKETTKLYKKEW"
FT   gene            complement(126633..127472)
FT                   /locus_tag="CpB0101"
FT   CDS_pept        complement(126633..127472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0101"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein ybbP - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98034"
FT                   /protein_id="AAP98034.1"
FT                   /translation="MCNFSQYTTQGPSKTMPFDITYYTTPLLEIILIWVMLNYLLKFFW
FT                   GTRAMDVVFGLLAFLFLFVLADKLHLPIIRRLMLHVVNIAAIVVFIIFQPEIRLALSRI
FT                   RFHGKKFFIDTQEQFVEQLAASIYQLSERQIGALVVLENKDSFDEYLSFSSVKINATFS
FT                   EELLETIFEPSSPLHDGAVILRGDILAYARVVLPLAHDTTQLSRSMGTRHRAALGASQR
FT                   SDALIITVSEENGSVSLSRDGLLTRGVKIDRFKAVLRSILSPKEHKRKPLFSWIWKR"
FT   gene            127618..128964
FT                   /locus_tag="CpB0102"
FT   CDS_pept        127618..128964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0102"
FT                   /product="cytochrome oxidase chain I"
FT                   /note="similar to cytochrome oxidase chain I family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98035"
FT                   /protein_id="AAP98035.1"
FT                   /translation="MDALILSRIQFGLFITFHYLFVPLSMGLSMMLVIMEGLYLVTKKQ
FT                   IYKQMTWFWVGIFALTFVLGVVTGIMQIFSFGSNWANFSEYTGNIFGTLLGSEGVFAFF
FT                   LESGFLGILLFGRHKVSKKMHFFSTCMVALGAHMSAFWIICANSWMQTPSGYEMVMHKG
FT                   KLIPALTSFWGVVFSPTTIDRFIHAVLGTWLSGVFLVISVSAYYLWKKRHHEFAKQGMK
FT                   IGTICAVIVLVLQLWSADVTARGVAKNQPAKLAAFEGIFKTEEYTPIWAFGYVDMEKER
FT                   VIGLPIPGALSFLVHRNIKTPVTGLDQIPRDEWPNVQAVFQLYHLMIMLWGVMVALTLI
FT                   SWSAYKGWRWALKPFFLVILTFSVLLPEICNECGWCAAEMGRQPWVVQGLLKTKDAVSP
FT                   IVQANQIVQSLVIFSLVFIALLTLFITVLCKKIKHGPEEENDLTEFEVK"
FT   gene            128975..130009
FT                   /locus_tag="CpB0103"
FT   CDS_pept        128975..130009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0103"
FT                   /product="cytochrome oxidase chain II"
FT                   /note="similar to cytochrome oxidase chain II family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98036"
FT                   /protein_id="AAP98036.1"
FT                   /translation="MELSLTSLLPLAWYVILGVAVFAYSFGDGFDLGLGAVYLKAKEDK
FT                   ERRILLNSIGPVWDGNEVWLVIIVGGLFAGFPACYATLLSIFYMPIWTLVLLYIFRGCS
FT                   LEFRSKSESVSWKIFWDIIFICSGTAISFFLGTIVGNLILGLPLSPDTSYASLSWILFF
FT                   RPYAALCGAVVASAFAIHGSCFALMKTSDSLNARIAQQFPYILSSFLVFYVLFLGASLI
FT                   SIPKRFDAFPTYPLLILLIALTSCCCVAAKTSVSKKRYGYAFIYSTLNLLSLILSAATL
FT                   TFPNILLSTVDPQYSYTIYNSAVETKTLKSLLIIVLIGLPFIITYTCYIYRVFRGKTNF
FT                   PSIY"
FT   gene            complement(130168..131370)
FT                   /locus_tag="CpB0104"
FT   CDS_pept        complement(130168..131370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0104"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT017 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98037"
FT                   /protein_id="AAP98037.1"
FT                   /translation="MRMLQISMLLLALGTAINSPAIYAADSQSVSFPEQLPSSFTGEIK
FT                   GNHVRMRLAPHTDGTIIREFSKGDLVAVIGESKDYYVISAPPGITGYVFRSFVLDNVVE
FT                   GEQVNVRLEPSTSAPVLVRLSRGTQIQPASQEPHGKWLEVVLPSQCVFYVAKNFVANKG
FT                   PIELYTQREGQKKIAMDLINSALNFAHIELEKSLNEIDLEAIYKKINLVQSEEFKDVPG
FT                   IQGLIQKALEEIQDAYLSKSLESQNTSIASSQCSTPKVSSSEVTTSLLSRHIRKQTALK
FT                   TAPLTQGRENLEYSLFRIWASMQQGNDHSEALTQEAFYRAEQKKKQVLAGVLEVYPHVV
FT                   KNNPGDYLLKAQENTIAFLYGTSINLEQWLGKRVTVECLPRPNNHFAFPAYYVVGIKEA
FT                   S"
FT   gene            complement(131521..132375)
FT                   /locus_tag="CpB0105"
FT   CDS_pept        complement(131521..132375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0105"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT016 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98038"
FT                   /protein_id="AAP98038.1"
FT                   /translation="MPFRKFSNQNPMLLIYCKKKEIHLQWPQTAKIRFTPKIAMKVKIN
FT                   DQLICIPPFISARWSQIAFIESQEGENKDQGTLRLHLIDGKIISIPNLDQSIIDIAFQE
FT                   HLLYLETSQSGKEDSRDDDKLGVGVLMNVLQQITKGNDIQVLPKNLISPLFSGTNPIEA
FT                   ILQHTPEHKDHPDAPTDVLEKMADVIRVLSGNNATLLPRPEPHCNCMHCQIGRVMNEED
FT                   TLAVSDKDLTFRTWDIMQSGDKLYIVTNPLNPSDQFSVYLGPPIGCTCGEPNCEHIKAV
FT                   LYT"
FT   gene            132574..133872
FT                   /gene="psiH"
FT                   /locus_tag="CpB0106"
FT   CDS_pept        132574..133872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiH"
FT                   /locus_tag="CpB0106"
FT                   /product="phosphate starvation-inducible protein"
FT                   /note="similar to phosphate starvation-inducible protein
FT                   psiH - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98039"
FT                   /protein_id="AAP98039.1"
FT                   /translation="MRTQMKKTMVIDTSVFIYDPEALFSFENTRIIIPFPVIEELEAFG
FT                   KFRDESAKNASRALSNIRLLLENAKTKVTDGVLLPSGSELRIEVAPLSNDDRRGKLLTL
FT                   ELLKIIAKREPMVFVTKSLGRRVRAEALQIESRDYESKRFSFRSLYRGFRELQVSQEDI
FT                   ENFYKNGYLDLPLDVVPSPNEYFFMSAGENHFALGRYYVSEGKIIALKAMDKSVWGIKP
FT                   LNTEQRCALDLLLRDDVKLVTLIGQAGSGKTILALAAAMHKVFDKETYNKVLVSRPIVP
FT                   MGRDIGFLPGLKEDKLMHWMQPIYDNMEVLFSINQMGNSSEALQALMDAKKLEMEALTY
FT                   IRGRSLPKAFIIIDEAQNLTPHEIKTIISRAGKGTKIVLTGDPTQIDSLYFDENSNGLT
FT                   YLVGKFHHLALYGHMFMTRTERSELAAAAATIL"
FT   gene            complement(133884..134621)
FT                   /locus_tag="CpB0107"
FT   CDS_pept        complement(133884..134621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0107"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT058 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98040"
FT                   /protein_id="AAP98040.1"
FT                   /translation="MENWTPVEEPFPWPPAEKNQKIFAWALNQSKLIFVSTSGNIAQPR
FT                   LVTDSMSMMIVNAANRTMSRDGAGTNQVLSAAVSVDSWGLSQRPLNPERQGTPLNEGEC
FT                   RAGMWRNADGSNHTGKQGKPHYLAQLLGPKAVDHHNKSQAAFDRCKNAYLNCFSLAQTL
FT                   GVTFLQIPLISSGIYAPPENRKKPNSEENKVRMRWIHAVKCALVAAMQEFGNEPGNTDR
FT                   RMLIVLTDLKTPAITDPKKKSHL"
FT   gene            complement(134795..135352)
FT                   /locus_tag="CpB0108"
FT   CDS_pept        complement(134795..135352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0108"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT018 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98041"
FT                   /protein_id="AAP98041.1"
FT                   /translation="MSIFNEEVFIISHRHTPLGQTSTALRNTPLVNPLHRTNLQRIASY
FT                   IPIFSTFIGIKTLKGISSLQYSMVLMTGNFSSVCKTLPCPEIYEELPKVRKEAWLEIFG
FT                   IKALYYLVLGVIKIIKLIVRYLCPCCRPPEPREPQNPLTPTPLDMGQQIDAIFSTPTSP
FT                   TGFKDPFLDDLLQEDKKKAPHL"
FT   gene            complement(135446..135601)
FT                   /locus_tag="CpB0109"
FT   CDS_pept        complement(135446..135601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98042"
FT                   /protein_id="AAP98042.1"
FT                   /translation="MSRTRVRVSPPPLFKKIILKCYSSPLNEENLSFLPNLDNVFLKSL
FT                   KKSNIH"
FT   gene            136150..139281
FT                   /locus_tag="CpB0110"
FT   CDS_pept        136150..139281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0110"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="similar to isoleucyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98043"
FT                   /db_xref="GOA:Q9Z972"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z972"
FT                   /protein_id="AAP98043.1"
FT                   /translation="MTADEVGKNSFAKKEEQVLKFWKDNQIFEKSLQNRQGKTLYSFYD
FT                   GPPFATGLPHYGHLLASTIKDVVGRYATMDGYYVPRRFGWDCHGVPVEYEVEKSLSLTA
FT                   PGAIEDFGIASFNEECRKIVFRYVHEWEYYINRIGRWVDFSSTWKTMDASFMESVWWVF
FT                   QSLYNQGLVYEGTKVVPFSTALGTPLSNFEASQNYKEVDDPSLVVRMPLQNDSASLLVW
FT                   TTTPWTLPSNMAIAVGETLVYVRIQDKKSGEQWILSQGCVSRWFSNPEEFVILESFSGK
FT                   DLVGRTYEPPFTFFQSKREEGAFRVIAASFVEESEGTGVVHMAPAFGEGDFLVCKENHV
FT                   PLVCPVDAHGSFTEEIPQYQGQYIKHADKEIIKFLKKEGRIFYHGTVKHRYPFCWRTDT
FT                   PLIYKAVNSWFVAVEKIKDKMLRANSSIHWVPEHIQEGRFGKWLEGARDWAISRNRYWG
FT                   TPIPIWKSADGEILVVGSIRELEELTGTQITDIHRHFIDDLNIVKDGKPFHRIPYVFDC
FT                   WFDSGAMPYAQNHYPFENQKETEEAFPADFIAEGLDQTRGWFYTLTVISAILFDRPAFR
FT                   NAIVNGIILAEDGNKMSKRLNNYPSPKYVLDTYGADALRLYLLHSVVVKAEDLRFSDKG
FT                   IEGVLKQILLPLTNVLSFFNTYAELYGFDPKSQDIEPAYTEIDQWILSNLYSVVGKVRE
FT                   SMSQYHLNFAVEPFVTFIDDLTNWYIRRCRRRFWEAEDTPDRRAAFSTLYEVLTVFCKV
FT                   IAPFVPFLAEDIYQKLKLEKEPESVHLCDFPQVEMDKILPDLEKHMHDIREIVGLGHSL
FT                   RKEHKLKVRQPLANFYVVGSKDRLSLLKTFEGLIAEELNVKNVIFYEEAPSFIYTTVKP
FT                   NFRMLGKKVGSKMKEVQKALSELPNNAIDKLIQEETWVLTIDDREIALDGDDVVICRHT
FT                   DPGYIARSSALFSVILDCQLREPLIVEGIARELVNKINTMRRNQQLHVSDRIALRIKTT
FT                   EAVHRAFLDYENYICEETLIIAYDFTQDSDFQGENWDINGHATQIEITVSSIDS"
FT   gene            complement(139319..141229)
FT                   /locus_tag="CpB0111"
FT   CDS_pept        complement(139319..141229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0111"
FT                   /product="signal peptidase I"
FT                   /note="similar to signal peptidase I - Salmonella
FT                   typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98044"
FT                   /protein_id="AAP98044.1"
FT                   /translation="MKQHYSLNKSRHILRSTYKLLKSKKLAHSPADKKQLQELLEQLEE
FT                   AIFEHDQETASDLAQQALAFSNRYPNSFGRKTYELIKALLFAGVVAFLVRQFWFELYEV
FT                   PTGSMRPTILEQDRILVSKTTFGLHCPFAKKPLAFNPESVTRGGLVVFTVGDLPIPDAD
FT                   TKYFGLIPGKKRYIKRCMGRPGDFLYFYGGKIYGLDDAGKRIEFPSVHGLENLYHVPYI
FT                   SFDGTTSSHTEGQKTIIDFKQFNQSYGRLIFPQTSMYGQFFDHKEWHQDEPNKLKDPHL
FT                   SPVSYADLFGMGNYAMVRILTEHQARTSHLLPNPGSPTKVYLEICHTANLSYPKPLLRH
FT                   YEHQLSPAIQPMKTLLPLRKEHLHLIRNNLTTSRFIVAQGCAYKYHQFKINTSGIAKAY
FT                   AILLPKVPDGCYEYSKGEAYQIGFGEIRYKLKSSHPLTQLNDKQVIELFNCGINFSSIY
FT                   NPVNPLQAPLPNRYAFFNQGNLYIMDSPVFIKNDPTLQKFVTSETEKQEGSSETQPYIA
FT                   FVDKGLPPEDFKEFVEFIHNFGIQVPKGHVLVLGDNYPMSADSREFGFVPMENLLGSPL
FT                   CTFWPIGRMGRLTGVSAPTTLSGYLVSGIALATGLSLIGYVYYQKRRRLFPKKEEKNHK
FT                   K"
FT   gene            complement(141426..142232)
FT                   /locus_tag="CpB0112"
FT   CDS_pept        complement(141426..142232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0112"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT021 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98045"
FT                   /protein_id="AAP98045.1"
FT                   /translation="MPNDSSTYFERILQKYLMKKQGKTLFLFLFLSFLFSTAFSGLFAS
FT                   QTSSLRTIQENIFLAKTGDYTVLSRGSQRTFVLVKSTTPKTVWIEIIHFPCIAHKERPS
FT                   LEQASWKTVIHQLESPSQVFVVSLSSEGSQFFSLNTRTKSLEPVGKSTTVPAFLQIFDL
FT                   PLSPAPANVIKTKGKENKPWSPKVSFEGAPLTSISVNAWQGLWPKDRGPLSETGILMYF
FT                   TQPDISVFPLWVSIETPKGTSIVRAVDIGHGATSPYVYSLPDSKTQ"
FT   gene            142262..142591
FT                   /locus_tag="CpB0113"
FT   CDS_pept        142262..142591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0113"
FT                   /product="ribosomal protein L31"
FT                   /note="similar to ribosomal protein L31 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98046"
FT                   /db_xref="GOA:Q9Z969"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z969"
FT                   /protein_id="AAP98046.1"
FT                   /translation="MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQSEKTEVFEGKEYPVC
FT                   YVSVSSSSHPFFTGSKKFVDAEGRVDKFLKRYSNVRQPAQQPQPEEDALPAAKGKKKVV
FT                   TKKKK"
FT   gene            142830..143903
FT                   /locus_tag="CpB0114"
FT   CDS_pept        142830..143903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0114"
FT                   /product="translation releasing factor RF-1"
FT                   /note="similar to translation releasing factor RF-1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98047"
FT                   /db_xref="GOA:Q9Z968"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z968"
FT                   /protein_id="AAP98047.1"
FT                   /translation="MKKKVAEYLNRLAEVEIKISNPEIFSNSKEYSALSKEHSYLLELK
FT                   NAYDKILNLEKVLADDKQALAIEKDPEMVVMLEEGINENKVELEKLNKILESLLVPPDP
FT                   DDDLNVIMELRAGTGGEEAALFVGDCVRMYHLYASSKGWKYEVLSASESDLKGYKEYVM
FT                   GISGTGVKRLLQYEAGTHRVQRVPETETQGRVHTSAITIAVLPEPSEEDTELLINEKDL
FT                   KIDTFRASGAGGQHVNVTDSAVRITHLPTGVVVTCQDERSQHKNKDKAMRILKARIRDA
FT                   EMQKRHNEASAMRSAQVGSGDRSERIRTYNFSQNRVTDHRIGLTLYNLDKVMEGDLDPI
FT                   TTAMVSHAYHQLLEHGN"
FT   gene            143869..144759
FT                   /locus_tag="CpB0115"
FT   CDS_pept        143869..144759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0115"
FT                   /product="protoporphyrinogen oxidase"
FT                   /note="similar to protoporphyrinogen oxidase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98048"
FT                   /protein_id="AAP98048.1"
FT                   /translation="MPTTSYSNMEIKKAIQEGTAYLDYYGVPLSDCEALYILMDLLEVS
FT                   SRAKLFDLVGISETMLMEYRKRLALRGQRCPTAYLNGAVSFLGLRLRVDSRVLIPRTET
FT                   ELLAEYIINYLLSHSEIQTFYDICCGSGCLGLAIKKSCPHVEVVLSDVCPQAVAVANEN
FT                   AKSNGLDVKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGST
FT                   GLEFYQRIAQELPKIVTSTGVGWLEIGSSQGESIKNIFSKHGIYGRLHQDLSGRDRIFF
FT                   LEMDGRDPVSSGAYS"
FT   gene            144774..146120
FT                   /gene="ffh"
FT                   /locus_tag="CpB0116"
FT   CDS_pept        144774..146120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="CpB0116"
FT                   /product="signal recognition particle chain"
FT                   /note="similar to signal recognition particle chain ffh
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98049"
FT                   /protein_id="AAP98049.1"
FT                   /translation="MINSLSQKLSSIFSFLVSSRRINEENISESIREVRLALLDADVNY
FT                   HVVKDFISKVKEKILGEEIWKHVSPGQQFIRCLHEELVAFLSDGREEFTIQKTPSIILL
FT                   CGLQGAGKTTTAAKLADYVIKNKKAKKVLVVPCDLKRFAAVDQLKILVAQTKAEFYQSQ
FT                   ENKPIDVVVKALAYAKENGHDFVILDTAGRLNIDNELMEELTAIQKVSQANERLFVMNV
FT                   AMGQDVLATVQAFDQSLDLTGVILSMTDGDARAGAVFSIKHVLGKPIKFEGCGERIQDL
FT                   RSFDPQSMAERILGMGDTINFVKEMREYISEEEDAELGKKLVTAAFTYEDYYKQMKAFR
FT                   RMGPLRKLLGMMPGFNNAKPSQKEIEDSEQQMKRTEAIILSMTPEERKELVELDMSRMK
FT                   RIASGCGLTLGDVNQFRKQMSQSKKFFKGMSKGKMEQVRKKMSGGNQWR"
FT   gene            146111..146470
FT                   /locus_tag="CpB0117"
FT   CDS_pept        146111..146470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0117"
FT                   /product="ribosomal protein S16"
FT                   /note="similar to ribosomal protein S16 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98050"
FT                   /db_xref="GOA:Q9Z965"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z965"
FT                   /protein_id="AAP98050.1"
FT                   /translation="MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSS
FT                   INYQLKSERIFYWLERGAQLSSKAEALVKQGAPGVYSALLSKQEARKLVVRKKRRAYRQ
FT                   RRSTQREEAAKDATK"
FT   gene            146484..147569
FT                   /locus_tag="CpB0118"
FT   CDS_pept        146484..147569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0118"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /note="similar to tRNA (guanine-N1-)-methyltransferase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98051"
FT                   /db_xref="GOA:Q9Z964"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z964"
FT                   /protein_id="AAP98051.1"
FT                   /translation="MKIDILSLFPGYFDGPLQTSILGRAIKQRLLDVQLTNLRDFGLGK
FT                   WKQVDDTPFSGGGMLLMAEPVTSAIRSVRKENSKVIYLSPQGALLTAEKSRELAAASHL
FT                   ILLCGHYEGIDERAIESEVDEEISIGDYVLTNGGIAALVLIDAVSRFIPGVLGNQESAE
FT                   RDSLENGLLEGPQYTRPREFEGKEVPEVLLQGDHKAISQWRLEQSERRTYERRPDLYLN
FT                   YLYKRSIDHKFDEETTTNRDHFKCDKISVVLEVNKLKRAKNFYCKVFGLDAMSCENKFC
FT                   LPHEGKTIFWLREVQAEKKNIVTLSLSLDCACEEDFCYLLRRWELFGGKLLEKQADEHA
FT                   VWALAQDLDGHAWIFSWHRMK"
FT   gene            147597..147962
FT                   /locus_tag="CpB0119"
FT   CDS_pept        147597..147962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0119"
FT                   /product="ribosomal protein L19"
FT                   /note="similar to ribosomal protein L19 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98052"
FT                   /db_xref="GOA:Q9Z963"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z963"
FT                   /protein_id="AAP98052.1"
FT                   /translation="MVNLLKELEQEQCRNDLPEFHVGDTIRLATKISEGGKERVQVFQG
FT                   TVMARRGGGSGETVSLHRVAYGEGMEKSFLLNSPRIVSIEIVKRGKVARARLYYLRGKT
FT                   GKAAKVKEFVGPRSSKK"
FT   gene            148018..148662
FT                   /locus_tag="CpB0120"
FT   CDS_pept        148018..148662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0120"
FT                   /product="ribonuclease H II"
FT                   /note="similar to ribonuclease H II family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98053"
FT                   /db_xref="GOA:Q9Z962"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z962"
FT                   /protein_id="AAP98053.1"
FT                   /translation="MNTSISEIQRFLSMIAFEKELVSEDFSVVAGIDEAGRGPLAGPVV
FT                   ASACILPKGKVFPGVNDSKKLSPKQRAQVRDALMQDPEVCFGIGVISVERIDQVNILEA
FT                   TKEAMLQAISSLPISPDILLVDGLYLPHDIPCKKIIQGDAKSASIAAASILAKEHRDDL
FT                   MLQLHRLYPEYGFDRHKGYGTSLHVEAIRRYGPSPCHRKSFSPIKQMCAIV"
FT   gene            148770..149276
FT                   /locus_tag="CpB0121"
FT   CDS_pept        148770..149276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0121"
FT                   /product="guanylate kinase"
FT                   /note="similar to guanylate kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98054"
FT                   /db_xref="GOA:Q9Z961"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z961"
FT                   /protein_id="AAP98054.1"
FT                   /translation="MLEQEFSSAFAETISVTTRKPREGEVPGKDYHFVSHEEFQRLLDR
FT                   QALLEWVFLFGECYGTSMLEIERIWSLGKHAVAVIDIQGALFIRSRMPSVSIFIAPPSQ
FT                   EELERRLASRGSEEGSQRKERLEHSLIELAAANQFDYVIINDDLNQAYRVLKSIFIAEE
FT                   HRNIL"
FT   gene            149273..149566
FT                   /locus_tag="CpB0122"
FT   CDS_pept        149273..149566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0122"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT031 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z960"
FT                   /protein_id="AAP98055.1"
FT                   /translation="MIKKDRFTNEKLNKLFDSPFSLVNYAIKQAKIKIAKGDVRSSNVA
FT                   IETLVLLDREGIQPEFTEEIVVTASPTVERKRSEHTNSRKKDPSAYTWSDVK"
FT   gene            149566..151221
FT                   /locus_tag="CpB0123"
FT   CDS_pept        149566..151221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0123"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="similar to methionyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98056"
FT                   /db_xref="GOA:Q9Z959"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z959"
FT                   /protein_id="AAP98056.1"
FT                   /translation="MPQKVLITSALPYANGPLHFGHIAGVYLPADVYARFRRLLGDDVL
FT                   YICGSDEFGIAITLNADREGLGYQEYVDMYHKLHKDTFEKLGFALDFFSRTTNPFHAEL
FT                   VQDFYSQLKASGLIENRISEQLYSEQEQRFLADRYVEGTCPRCGFDHARGDECQSCGAD
FT                   YEAIDLIDPKSKISGVELVKKETEHSYFLLDRMKDALLSFIQGCYLPDHVRKFVVDYIE
FT                   HVRSRAITRDLSWGIPVPDFPGKVFYVWFDAPIGYISGTMEWAASQGNPDEWKRFWLED
FT                   GVEYVQFIGKDNLPFHSVVFPAMELGQKLDYKKVDALVVSEFYLLEGRQFSKSEGNYVD
FT                   MDKFLSSYSLDKLRYVLAATAPETSDSEFTFLDFKTRCNSELVGKFGNFINRVLAFAEK
FT                   NHYDKLSYHSVVLEDSDRAFLEEARQLVRDAEKCYREYSLRKATSVIMSLAALGNVYFN
FT                   QQAPWKLLKEGTRERVEAILFCACYCQKLLALISYPIIPESAVAIWEMISPKSLENCNL
FT                   DTMYARDLWKEEILDVINEEFHLKSPRLLFTTVE"
FT   gene            complement(151266..153464)
FT                   /locus_tag="CpB0124"
FT   CDS_pept        complement(151266..153464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0124"
FT                   /product="exodeoxyribonuclease V 67K chain"
FT                   /note="similar to exodeoxyribonuclease V 67K chain -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98057"
FT                   /protein_id="AAP98057.1"
FT                   /translation="MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLE
FT                   LGSPIQIYGVWSHSPSNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIE
FT                   KFQEKTCYVLDITPERLSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGV
FT                   RIFKKYQEKSIEKICEDPFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLE
FT                   ELQEEGHTCYPIELLIDVVAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTL
FT                   HVWTRYLHLAEKTIVSDLKRILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKAC
FT                   FSEKLLIITGGPGTGKSTITQAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIH
FT                   ALLQYDFKTKSFRKNHDNPIDCDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQ
FT                   LPSVGPGNILKDLITSNKMTVIRLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRD
FT                   FLFFQKDDQEEALNHIIHLVTKFVPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHAL
FT                   NPKKANLHGRFQSYAVGDKVMQIRNNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVG
FT                   YSFSELDDLVLAYATSVHKYQGSESPCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILV
FT                   GTKKAIAIATRNNRVQHRCTGLAEVLKELDTKKNYADL"
FT   gene            154226..155566
FT                   /locus_tag="CpB0125"
FT   CDS_pept        154226..155566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0125"
FT                   /product="HB1 protein"
FT                   /note="similar to HB1 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98058"
FT                   /protein_id="AAP98058.1"
FT                   /translation="MLITGLVLLIRSEKLALEQVEIKQARTRVNNELDQLSQYVFYTEN
FT                   VLDNLKRWSYRDLGFVRQAQEEVTNLEQDIEEIFLTLRDIRNALDNEEFFMTHAKQCLA
FT                   QVGESLFQDASIDEFINLAHLSEIRQHLDINDPRWSMITKKVKGTVVRFIYVSTMYKQI
FT                   KSNFEKSDFGQLRKMLLNNYKTIEEVLYQSFQKGYNRAALLSEKTRIIHTSSLLHWEKD
FT                   EDKHLNIKNECASRLENFKKFRTLFLGLSEEDVIDFTGASGWDCSKLPRKEVPLDGGKK
FT                   KLRFKRTFADEQVGDWDRTTSLEHMTPQEEDPLDRLMDQVEQEATSVLKDQDRYWKEIE
FT                   TSEAKFRSLPREDDFEKQSQIDSYIRDLDDHLSVWANQLSAAEDALIEVTDVQEHGNRE
FT                   MLKNIQQGLELIEDAVKATLPRVDFIQELLEKEELPLVAARMSLENS"
FT   gene            155591..156103
FT                   /locus_tag="CpB0126"
FT   CDS_pept        155591..156103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0126"
FT                   /product="HB7 protein"
FT                   /note="similar to HB7 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98059"
FT                   /protein_id="AAP98059.1"
FT                   /translation="MSEVKPLFLKNDSFDLATQRFQNLINMLQEQAEIYNEYEEKNARV
FT                   QNEIKEQKDFVKRCIEDFEARGLGVLKEELASLTRDFHDKAKAETSMLIECPCIGFYYS
FT                   IHQEEQRQRQERLQKMAERYRDCKQVLEAVQVEQKDMISSRVVVDDSYFEEEKEEQKVD
FT                   NRKKEQD"
FT   gene            complement(156164..156316)
FT                   /locus_tag="CpB0127"
FT   CDS_pept        complement(156164..156316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98060"
FT                   /protein_id="AAP98060.1"
FT                   /translation="MRIPITNNPIAKVCTLDSASESDLKAGEGSNFKASVMSKFKTTKQ
FT                   HCYLE"
FT   gene            156304..158583
FT                   /locus_tag="CpB0128"
FT   CDS_pept        156304..158583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0128"
FT                   /product="HB7 protein"
FT                   /note="similar to HB7 protein, Chlamydia pneumoniae, strain
FT                   VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98061"
FT                   /protein_id="AAP98061.1"
FT                   /translation="MVFSYYCMGLFFFSGAISSCGLLVSLGVGLGLSVLGVLLLLLAGL
FT                   LLFKIQSMLREVPKAPDLLDLEDASERLRVKASRSLASLPKEISQLESYIRSAANDLNT
FT                   IKTWPHKDQRLVETVSRKLERLAAAQNYMISELCEISEILEEEEHHLILAQESLEWIGK
FT                   SLFSTFLDMESFLNLSHLSEVRPYLAVNDPRLLEITEESWEVVSHFINVTSAFKKAQIL
FT                   FKNNEHSRMKKKLESVQELLETFIYKSLKRSYRELGCLSEKMRIIHDNPLFPWVQDQQK
FT                   YAHAKNEFGEIARCLEEFEKTFFWLDEECAISYMDCWDFLNESIQNKKSRVDRDYISTK
FT                   KIALKDRARTYAKVLLEENPTTEGKIDLQDAQRAFERQSQEFYTLEHTETKVRLEALQQ
FT                   CFSDLREATNVRQVRFTNSENANDLKESFEKIDKERVRYQKEQRLYWETIDRNEQELRE
FT                   EIGESLRLQNRRKGYRAGYDAGRLKGLLRQWKKNLRDVEAHLEDATMDFEHEVSKSELC
FT                   SVRARLEVLEEELMDMSPKVADIEELLSYEERCILPIRENLERAYLQYNKCSEILSKAK
FT                   FFFPEDEQLLVSEANLREVGAQLKQVQGKCQERAQKFAIFEKHIQEQKSLIKEQVRSFD
FT                   LAGVGFLKSELLSIACNLYIKAVVKESIPVDVPCMQLYYSYYEDNEAVVRNRLLNMTER
FT                   YQNFKRSLNSIQFNGDVLLRDPVYQPEGHETRLKERELQETTLSCKKLKVAQDRLSELE
FT                   SGLSRR"
FT   gene            complement(158622..159638)
FT                   /locus_tag="CpB0129"
FT   CDS_pept        complement(158622..159638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0129"
FT                   /product="putative cationic amino acid transporter"
FT                   /note="similar to probable cationic amino acid transporter
FT                   - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98062"
FT                   /protein_id="AAP98062.1"
FT                   /translation="MFPSANQESRTRNVPLGIFHGLVACLYWGIVFVIPNFLGSFGDLD
FT                   IVLTRYTIFGIFSLIACAIKNPSVIKKTPLYIWRKSLLWTLLINPVYYFGITLGIRYVG
FT                   SAITVVIASLAPTAVLYHSNTKQKELPYSLLFAISSVIITGVILTHLSALNLPTAASPL
FT                   YSILGVIAVILSTSLWVIYVIRNQSLLEKHPNLTPDTWSYLIGISALIICLPMIIILDL
FT                   CGITHVTHNLISHTPGSERLLFLLLCSAMGIFSSAKALIAWNKASLNLSPALLGAILIF
FT                   EPIFGLVLTYLYSQSLPSLQEGIGIFLMLGGSLLCLVLFGRKVQKSLENSQVSSSNE"
FT   gene            159772..160551
FT                   /locus_tag="CpB0130"
FT   CDS_pept        159772..160551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0130"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase"
FT                   /note="similar to biotin--[acetyl-CoA-carboxylase] ligase -
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98063"
FT                   /db_xref="InterPro:IPR015834"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z953"
FT                   /protein_id="AAP98063.1"
FT                   /translation="MLRNQVLVYCSEGVSPYYLRHTIRFLKYYSTQEGAFDILRVDGNF
FT                   LIKNPFWEETTRLLVFPGGADRPYHRVLHGLGTARIFQYVSEGGNFLGICAGAYFGSKM
FT                   IYFYEPEGAPLQGARDLGFFPGTAKGPAYRGNFSYVSPSGVRVSPQLFSDFGLGYAMFN
FT                   GGCFFEGSEGYPGVNIESRYDDLPGKPASIVSRIVSKGLAVLSGPHIEYLPHYCRMVKE
FT                   NVQKTREFLQRERTTLDRYCQNLVQRLRQPAFSKADC"
FT   gene            complement(160556..161740)
FT                   /locus_tag="CpB0131"
FT   CDS_pept        complement(160556..161740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0131"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT036 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98064"
FT                   /db_xref="GOA:Q9JRX2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRX2"
FT                   /protein_id="AAP98064.1"
FT                   /translation="MVKCSSIIHENKKPAQLLPESKFAAITKLSLAILSLFLGIAACIL
FT                   IALSGLLPNTLLIIALSLISIIVLSTGISLLIGTQCSKSVQKDEQKPKSIFPKETPSLD
FT                   PWLLNPLKNKIQSSETLLLDPTSINLKNELFFPSFEEWKKIFLKDPDFLIKSALANWKI
FT                   LEQDEQYILSHIHMDPRIFVTSEPLQKTYQKLQEKHVNNLGIASQVSLTDLQNKTQYEN
FT                   NLIETTTNEITYYFPVVHNPDILRSEWDPISNQLYLIFKKFFIHYHNLFSTALERNQIL
FT                   LIDSLNTGSSNPIARQMELLAFLCVFEQLDYNEDEYTIEPRDYFNRFVYKNSQTAPQIQ
FT                   SFGLLHGYEEMSYASNNIRNVLTHSIVLCSPILYQLITEFDTTKIHADDFDCLI"
FT   gene            complement(161814..161885)
FT                   /locus_tag="CpBt04"
FT   tRNA            complement(161814..161885)
FT                   /locus_tag="CpBt04"
FT                   /product="tRNA-Asn"
FT                   /note="GTT"
FT   gene            162056..163078
FT                   /locus_tag="CpB0132"
FT   CDS_pept        162056..163078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98065"
FT                   /protein_id="AAP98065.1"
FT                   /translation="MSSSFVYNGPSWILKTSVAQEVFKKHGKGIQVLLSTSVMLFIGLG
FT                   VCAFIFPQYLIVFVLTIALLMLAISLVLFLLIRSVRSSMVDRLWCSEKGYALHQHENGP
FT                   FLDVKRVQQILLRSPYIKVRALWPSGDIPEDPSQAAVLLLSPWTFFSSVDVEALLPSPQ
FT                   EKEGKYIDPVLPKLSRIERVSLLVFLSAFTLDDLNEQGVNPLMNNEEFLFFINKKAREH
FT                   GIQDLKHEIMSSLEKTGVPLDPSMSFQVSQAMFSVYRYLRQRDLTTSELRCFHLLSCFK
FT                   GDVVHCLASFENPKDLADSDFLEACKNVEWGEFISACEKALLKNPQGISIKDLKQFLVR
FT                   "
FT   gene            163082..164059
FT                   /locus_tag="CpB0133"
FT   CDS_pept        163082..164059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98066"
FT                   /db_xref="GOA:Q9Z949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z949"
FT                   /protein_id="AAP98066.1"
FT                   /translation="MIEFAFVPHTSVTADRIEDRMACRMNKLSTLAITSLCVLISSVCI
FT                   MIGILCISGTVGTYAFVVGIIFSVLALVACVFFLYFFYFSSEEFKCASSQEFRFLPIPA
FT                   VVSALRSYEYISQDAINDVIKDTMQLSTLSSLLDPEAFFLEFPYFNSLIVNHSMKEADR
FT                   LSREAFLILLGEITWKDCETKILPWLKDPNITPDDFWKLLKDHFDLKDFKKRIATWIRK
FT                   AYPEIRLPKKHCLDKSIYKGCCKFLLLAENDVQYQRLLHKVCYFSGEFPAMVLGLGSEV
FT                   PMVLGLPKVPKDLTWEMFMENMPVLLQSKREGHWKISLEDVASL"
FT   gene            complement(164056..164829)
FT                   /locus_tag="CpB0134"
FT   CDS_pept        complement(164056..164829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0134"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT109 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98067"
FT                   /protein_id="AAP98067.1"
FT                   /translation="MFKLLKNLFLIGCCIVGYFWMRKESIVEQWLSNRLHTQVTVGRVS
FT                   IRTSGIKIRHICIHNPLASERFPYAAEIEYADVRFSSISMLLTKQLEISELIIHGANFT
FT                   IFPYDSHGTKTNWSLVWKNFHPQKETPSNLWIDRAPVLIRRCLFLNTRLYGLRANHKDI
FT                   PHLSVPSLEFHSHTSSAKELPKLSEALPSLLYLALEESLYHLNLPGDIIKPLSQQAHKH
FT                   FYSSYPQFQDRLNDINTPGTPTEEIIGFIRGLFFH"
FT   gene            complement(164959..166593)
FT                   /locus_tag="CpB0135"
FT   CDS_pept        complement(164959..166593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0135"
FT                   /product="GroEL"
FT                   /note="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98068"
FT                   /db_xref="GOA:P31681"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31681"
FT                   /protein_id="AAP98068.1"
FT                   /translation="MAAKNIKYNEEARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFG
FT                   SPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGL
FT                   RNVTAGANPMDLKRGIDKAVKVVVDELKKISKPVQHHKEIAQVATISANNDSEIGNLIA
FT                   EAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFSTNPETQECVLEDALILI
FT                   YDKKISGIKDFLPVLQQVAESGRPLLIIAEEIEGEALATLVVNRLRAGFRVCAVKAPGF
FT                   GDRRKAMLEDIAILTGGQLVSEELGMKLENTTLAMLGKAKKVIVTKEDTTIVEGLGNKP
FT                   DIQARCDNIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDA
FT                   QHATIAAVEEGILPGGGTALVRCIPTLEAFLPMLANEDEAIGTRIILKALTAPLKQIAS
FT                   NAGKEGAIICQQVLARSANEGYDALRDAYTDMIDAGILDPTKVTRSALESAASIAGLLL
FT                   TTEALIADIPEEKSSSAPAMPSAGMDY"
FT   gene            complement(166635..166943)
FT                   /locus_tag="CpB0136"
FT   CDS_pept        complement(166635..166943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0136"
FT                   /product="GroES"
FT                   /note="stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98069"
FT                   /db_xref="GOA:P31682"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31682"
FT                   /protein_id="AAP98069.1"
FT                   /translation="MSDQATTLRIKPLGDRILVKREEEEATARGGIILPDTAKKKQDRA
FT                   EVLVLGTGKRTDDGTLLPFEVQVGDIILMDKYAGQEITIDDEEYVILQSSEIMAVLK"
FT   gene            complement(167061..168896)
FT                   /locus_tag="CpB0137"
FT   CDS_pept        complement(167061..168896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0137"
FT                   /product="oligoendopeptidase F"
FT                   /note="similar to oligoendopeptidase F - Lactococcus
FT                   lactis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98070"
FT                   /protein_id="AAP98070.1"
FT                   /translation="MTTELKTEALPTRTQVDPKHCWDTTLMYANREEWKKDFDLCSSGK
FT                   DRSPIWPEFSPSHYQIDNPESLLELLSKKFSVERKLDQLYIYAHLIHDQDITNPEGESD
FT                   YQSIVYLYTLFSQEISWIQPALIALSEEKVAALLSSSVLAPYRFYLEKIFRLSPHTGTA
FT                   NEEKILASSFAALNVSNKAFSSLSDAEIPFGIAKDSNGEEHPLSHALASLYMQSPDQEL
FT                   RRTAYLAQFQRYYDYRNTFANLLNGKVQAHLFEAKARNYPSCLEASLFQHNIPTTVYIN
FT                   LINETKKHTSLINRYFNLKKEALNLKEFHFYDVYAPISQTTSKNYSYEEGVDLVCKSLL
FT                   PLGTHYVEILRNGLLSNRWVDRYENKHKRSGAYSSGCYDSAPYILLNYTNTLYDVSVIA
FT                   HEAGHSMHSYFSREAQPYHDAQYPLFLAEIASTFNEMLLMEALSKSDQSKEDKIVIITK
FT                   TLDTIFATLFRQTFFAAFEYEIHSAAEQGTPLTEEFLSATYGNLQKEFYGGVVTSDSLS
FT                   ALEWARIPHFYYNFYVYQYATGIIAALSFAEKILTQEPGALELYLKFLKSGRSDFPLNI
FT                   LKKSGLDMTTSAPLDKAFAFITKKIDLLSSLLSED"
FT   gene            complement(168994..169749)
FT                   /gene="ybgI"
FT                   /locus_tag="CpB0138"
FT   CDS_pept        complement(168994..169749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="CpB0138"
FT                   /product="YbgI"
FT                   /note="similar to ybgI protein - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98071"
FT                   /db_xref="GOA:Q9Z946"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z946"
FT                   /protein_id="AAP98071.1"
FT                   /translation="MNVADLLSHLETLLSSKIFQDYGPNGLQVGDPQTPVKKIAVAVTA
FT                   DLETIKQAVAAEANVLIVHHGIFWKGMPYPITGMIHKRIQLLIEHNIQLIAYHLPLDAH
FT                   PTLGNNWRVALDLNWHDLKPFGSSLPYLGVQGSFSPIDIDSFIDLLSQYYQAPLKGSAL
FT                   GGPSRVSSAALISGGAYRELSSAATSQVDCFITGNFDEPAWSTALESNINFLAFGHTAT
FT                   EKVGPKSLAEHLKSEFPISTTFIDTANPF"
FT   gene            complement(170192..171514)
FT                   /locus_tag="CpB0139"
FT   CDS_pept        complement(170192..171514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0139"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutamate-1-semialdehyde 2,1-aminomutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98072"
FT                   /db_xref="GOA:Q9JRW9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRW9"
FT                   /protein_id="AAP98072.1"
FT                   /translation="MLNCSNQKHTVTFEEACQVFPGGVNSPVRACRSVGVTPPIVSSAQ
FT                   GDIFLDTHGREFIDFCGGWGALIHGHSHPKIVKAIQKTALKGTSYGLTSEEEILFATML
FT                   LSSLKLKEHKIRFVSSGTEATMTAVRLARGITNRSIIIKFIGGYHGHADTLLGGISTTE
FT                   ETIDNLTSLIHTPSPHSLLISLPYNNSQILHHVMEALGPQVAGIIFEPICANMGIVLPK
FT                   AEFLDDIIELCKRFGSLSIMDEVVTGFRVAFQGAQDIFNLSPDITIYGKILGGGLPAAA
FT                   LVGHRSILDHLMPEGTIFQAGTMSGNFLAMATGHAAIQLCQSEGFYDHLSQLEALFYSP
FT                   IEEEIRSQGFPVSLVHQGTMFSLFFTESAPTNFDEAKNSDVEKFQTFYSEVFDNGVYLS
FT                   PSPLEANFISSAHTEENLTYAQNIIIDSLIKIFDSSAQRFF"
FT   gene            complement(171585..172151)
FT                   /locus_tag="CpB0140"
FT   CDS_pept        complement(171585..172151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0140"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT211 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98073"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z944"
FT                   /protein_id="AAP98073.1"
FT                   /translation="MKIPYARLEKGSLLVASPDINQGVFARSVILLCEHSLNGSFGLIL
FT                   NKTLGFEISDDIFTFEKVSNHNIRFCMGGPLQANQMMLLHSCSEIPEQTLEICPSVYLG
FT                   GDLPFLQEIASSESGPEINLCFGYSGWQAGQLEKEFLSNDWFLAPGNKDYVFYSEPEDL
FT                   WALVLKDLGGKYASLSTVPDNLLLN"
FT   gene            complement(172165..172605)
FT                   /locus_tag="CpB0141"
FT   CDS_pept        complement(172165..172605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0141"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT212 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98074"
FT                   /protein_id="AAP98074.1"
FT                   /translation="MSLEKELLEETPLVLLNFYKLVSFCNYAGMILGTEEKKFAIYGHV
FT                   SMGQAFQGADTEGHSPQRPFAHDLLNFVFSGFDIQVLRVVINDYKDNVFYTRLFLEQKD
FT                   REFLYVVDVDARPSDSIPLALTHKIPILCVKSVFDAVVPYEE"
FT   gene            complement(172602..173297)
FT                   /locus_tag="CpB0142"
FT   CDS_pept        complement(172602..173297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0142"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /note="similar to ribose-5-phosphate isomerase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98075"
FT                   /db_xref="GOA:Q9Z942"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z942"
FT                   /protein_id="AAP98075.1"
FT                   /translation="MEKDLHLHEKKCLAHEAATQVTSGMILGLGSGSTAKEFIFALAHR
FT                   IQTESLAVHAIASSQNSYALAKQLAIPLLNPEKFSSLDLTVDGADEVDPQLRMIKGGGG
FT                   AIFREKILLRAAKRSIILVDESKLVPVLGKFRVPLEISRFGRSAIIEEIRHLGYEGEWR
FT                   LQDTGDLFITDSSNYIYDIFSPNSYPNPEKDLLKLIQIHGVIEVGFVIEKVEVWSSNSQ
FT                   GLISKKYSV"
FT   gene            complement(173308..173586)
FT                   /locus_tag="CpB0143"
FT   CDS_pept        complement(173308..173586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98076"
FT                   /protein_id="AAP98076.1"
FT                   /translation="MEKFHFKILQLLSTKNSILNFCSHFEISRVSHDNAIQKIRSYPLK
FT                   PIAENRINTLSFKDLKIDYPKDSSKRFRFLYSIGRIPLHKLWEYFVT"
FT   gene            complement(173706..174830)
FT                   /locus_tag="CpB0144"
FT   CDS_pept        complement(173706..174830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0144"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein of GGAI-protein
FT                   family cluster A - Chlamydia pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98077"
FT                   /protein_id="AAP98077.1"
FT                   /translation="MNTSLKRPLKSHFDVVGSFLRPEHLKKTRESLKEGSISLDQLMQI
FT                   EDIAIQDLIKKQKAAGLSFITDGEFRRATWHYDFMWGFHGVGHHRATEGVFFDGERAMI
FT                   DDTYLTDKISVSHHPFVDHFKFVKALEDEFTTAKQTLPAPAQFLKQMIFPNNIEVTRKF
FT                   YPTNQELIEDIVAGYRKVIRDLYDAGCRYLQLDDCTRGGLVDPRVCSWYGIDEKGLQDL
FT                   IQQYLLINNLVIADRPDDLVVNLHVCRGNYHSKFFASGSYDFIAKPLFEQTNVDGYYLE
FT                   FDHERSGDFSPLTFISGEKTVCLGLVTSKTPTLENKDEVIARIHQAADYLPLERLSLSP
FT                   QCGFASCEIGNKLTEEEQWAKVALVKEISEEVWK"
FT   gene            175449..178058
FT                   /locus_tag="CpB0145"
FT   CDS_pept        175449..178058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0145"
FT                   /product="ClpB"
FT                   /note="heat shock protein; similar to heat shock protein
FT                   ClpB - Synechococcus sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98078"
FT                   /db_xref="GOA:Q7AJA9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AJA9"
FT                   /protein_id="AAP98078.1"
FT                   /translation="MNFMEKFSDAVSEALEKAFELAKSSKHTYVTENHLLLALLENTES
FT                   LFYLVIKDIHGNPGLLNTAVKDALSREPTVVEGEVDPKPSPGLQTLLRDAKQEAKTLGD
FT                   EYISGDHLLLAFWSSNKEPFNSWKQTTKVSFKDLKNLITKIRRGNRMDSPSAESNFQGL
FT                   EKYCKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLA
FT                   LRLIQGDVPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESGDGEHIIFIDE
FT                   VHTLVGAGATDGAMDAANLLKPALARGTLHCIGATTLNEYQKYIEKDAALERRFQPIFV
FT                   TEPSLEDAVFILRGLREKYEIFHGVRITEGALNAAVLLSYRYIPDRFLPDKAIDLIDEA
FT                   ASLIRMQIGSLPLPIDEKERELAALIVKQEAIKREQSPSYQEEADAMQKSIDALREELA
FT                   SLRLGWDEEKKLISGLKEKKNSLESMKFSEEEAERVADYNRVAELRYSLIPQLEEEIKQ
FT                   DEASLNQRDNRLLQEEVDERLIAQVVANWTGIPVQKMLEGEAEKLLILEESLEERVVGQ
FT                   PFAVSAVSDSIRAARVGLNDPQRPLGVFLFLGPTGVGKTELAKALADLLFNKEEAMVRF
FT                   DMSEYMEKHSISKLIGSSPGYVGYEEGGSLSEALRRRPYSVVLFDEIEKADKEVLNILL
FT                   QVFDDGILTDGKKRKVNCKNALFIMTSNIGSPELADYCSKKGSELTKEAILSVVSPVLK
FT                   RYLSPEFMNRIDEILPFVPLTKEDIVKIVGIQMRRIAQRLKARRINLSWDDSVILFLSE
FT                   QGYDSAFGARPLKRLIQQKVVILLSKALLKGDIKPDTSIELTMAKEVLVFKKVETPS"
FT   gene            178299..179867
FT                   /locus_tag="CpB0146"
FT   CDS_pept        178299..179867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0146"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT114 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98079"
FT                   /protein_id="AAP98079.1"
FT                   /translation="MFVGGLVSFLLPIPDLECANNVTKTYDKKASVISRDLKLQEDCQK
FT                   FWNLDPYKLESLCAYQVLYHDDYSSKRIRELFPQIQKDEVPIFATMILTLGKVDRGFSP
FT                   EEISLIQKLSYPGLSLASLRGSTEIDPNTDLARALVVSEFSGDLGKNRADYYSNCLDIL
FT                   ALRIHAERQRYLDQSPCVPGTSEFHKATIEAINTILFYEEAVRYPSKKEMFSDEFSFLS
FT                   SVTDRKFGVCLGVSSLYFSLSQRLDLPLEAVTPPGHIYLRYQGGEVNIETTAGGRHLPT
FT                   ASYCDCLDLEDLQVRTPEEMIGLTFMNQGSFALQKKKYKEAEEAYKKAQEYLGDEELQE
FT                   LLGFVQILGGKKKEGKSLIGKSPRASQKGSVAYDYLKGRINIPTLALLFSYPGSNYEEI
FT                   ASYEEELKKAMKSSMPCCEGQRRLASVAFHLGKTAEAVALLEKCVEDIPNDLSLHLRLC
FT                   KILCDRHEYTKALKYFIIAERLMEDQGFLKKDNRSFALFYEVKKIISKVAPQKANTLLL
FT                   MESER"
FT   gene            180108..180593
FT                   /locus_tag="CpB0147"
FT   CDS_pept        180108..180593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98080"
FT                   /protein_id="AAP98080.1"
FT                   /translation="MSSSEVVFQTVHGLGFGGLSSKSVVPFKKSLSDAPRVVCSILVLT
FT                   LGLGALVCGIAITCWCVPGVILMGGICAIVLGAISLALSLFWLWGLFSNCCGSKRVLPG
FT                   EGLLRDKLLDGGFSRAAPSGMGLPGDGSPRASTPSCLEELQAEIQAVTQAIDQMSDD"
FT   gene            180720..181169
FT                   /locus_tag="CpB0148"
FT   CDS_pept        180720..181169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98081"
FT                   /protein_id="AAP98081.1"
FT                   /translation="MAVQSIKEAVTSAATSVGCVNCSREAIPAFNTEERATSIARSVIA
FT                   AIIAVVAISLLGLGLVVLAGCCPLGMAAGAITMLLGVALLAWAILITLRLLNIPKAEIP
FT                   SPGNNGEPNERNSATPPLEGGVAGEAGRGGGSPLTQLDLNSGAGS"
FT   gene            181341..183200
FT                   /locus_tag="CpB0149"
FT   CDS_pept        181341..183200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0149"
FT                   /product="protein kinase"
FT                   /note="similar to protein kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98082"
FT                   /db_xref="GOA:Q7AJA5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AJA5"
FT                   /protein_id="AAP98082.1"
FT                   /translation="MESEKDIGAKFLGDYRILYRKGQSLWSEDLLAEHRFIKKRYLIRL
FT                   LLPDLGSSQPFMEAFHDVVVKLAKLNHPGILSIENVSESEGRCFLVTQEQDIPILSLTQ
FT                   YLKSIPRKLTELEIVDIVSQLASLLDYVHSEGLAQEEWNLDSVYIHILNGVPKVILPDL
FT                   GFASLIKERILDGFISDEENRESKIKERVLLHTSEGKQGREDTYAFGAITYYLLFGFLP
FT                   QGIFPMPSKVFSDFIYDWDFLISSCLSCFMEERAKELFPLIRKKTLGEELQNVVTNCIE
FT                   SSLREVPDPLESSQNLPQAVLKVGETKVSHQQKESAEHLEFVLVEACSIDEAMDTAIES
FT                   ESSSGVEEEGYSLALQSLLVREPVVSRYVEAEKEEPKPQPILTEMVLIEGGEFSRGSVE
FT                   GQRDELPVHKVILHSFFLDVHPVTNEQFIRYLECCGSEQDKYYNELIRLRDSRIQRRSG
FT                   RLVIEPGYAKHPVVGVTWYGASGYAEWIGKRLPTEAEWEIAASGGVAALRYPCGEEVEK
FT                   SRANFFTADTTTVMSYPPNPYGLYDMAGNVYEWCQDWYGYDFYEISAQEPESPQGPAQG
FT                   VYRVLRGGCWKSLKDDLRCAHRHRNNPGAVNSTYGFRCAKNIN"
FT   gene            183210..185198
FT                   /locus_tag="CpB0150"
FT   CDS_pept        183210..185198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0150"
FT                   /product="DNA ligase (NAD+)"
FT                   /note="similar to DNA ligase (NAD+) - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98083"
FT                   /db_xref="GOA:Q9Z934"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z934"
FT                   /protein_id="AAP98083.1"
FT                   /translation="MKEENSQAHYLALCRELEDHDYSYYVLHRPRISDYEYDMKLRKLL
FT                   EIERSHPEWKVLWSPSTRLGDRPSGTFSVVSHKEPMLSIANSYSKEELSEFFSRVEKSL
FT                   GTSPRYTVELKIDGIAVAIRYEDRVLVQALSRGNGKQGEDITSNIRTIRSLPLRLPEDA
FT                   PEFIEVRGEVFFSYSTFQIINEKQQQLEKTIFANPRNAAGGTLKLLSPQEVAKRKLEIS
FT                   IYNLIAPGDNDSHYENLQRCLEWGFPVSGKPRLCSTPEEVISVLKTIETERASLPMEID
FT                   GAVIKVDSLASQRVLGATGKHYRWALAYKYAPEEAETLLEDILVQVGRTGVLTPVAKLT
FT                   PVLLSGSLVSRASLYNEDEIHRKDIRIGDTVCVAKGGEVIPKVVRVCREKRPEGSEVWN
FT                   MPEFCPVCHSHVVREEDRVSVRCVNPECVAGAIEKIRFFVGRGALNIDHLGVKVITKLF
FT                   ELGLVHTCADLFQLTTEDLMQIPGIRERSARNILESIEQAKHVDLDRFLVALGIPLIGI
FT                   GVATVLAGHFETLDRVISATFEELLSLEGIGEKVAHAIAEYFSDSTHLNEIKKMQDLGV
FT                   CISPYHKSGSTCFGKAFVITGTLEGMSRLDAETAIRNCGGKVGSSVSKQTDYVVMGNNP
FT                   GSKLEKARKLGVSILDQEAFTNLIHLE"
FT   gene            185329..189942
FT                   /locus_tag="CpB0151"
FT   CDS_pept        185329..189942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0151"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT147 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98084"
FT                   /protein_id="AAP98084.1"
FT                   /translation="MASSSNNSTKQDGIPSWVNPNVQWNRASQVGDQEANSLTPEAQTS
FT                   RSWFSDRKHFLEVLDVSLEEMENNDLKKYSRYKTIILIATLVTVAITCIVPISMVFGIP
FT                   MWVPCLILFGAGLSSAFLSHRLQSKCKEIHLRYRAYQIYRQQLLSQYPDLRKSTLYKYS
FT                   ITHVKPKKGFVGKLVENLRPDLHKNKDDGGAAADSRLDFAGYGVKHYQTDALLGVSGVN
FT                   SVEWQRLASLIMSVKNDILNDVGSREPIDKAQRSALVVSGKDIGGEIQPGGILDISRDI
FT                   LAICGYGMNVGVEAKKAIDQYKKWYLNSSTFIAWNPQLPAIAQSYLLEQQRHLDYAAKI
FT                   FQDLSALTTAHGTGQALEDLDSLLCYYDQLIESKGVGEKIIASIHQKHLDLAMQDSCDQ
FT                   EHLKKWSNLYHVFSITIKEFTEGKLEQNEVVSRIQRLRGKLEKSKCSILGNCRTNAEYA
FT                   TKSEKKLADYLLQIGDREPFLTGMHKAIATGKAIQGKVEGVISQHPEKQIMMLRCSIER
FT                   LEGMLRREDWGAILQKNEDEVLALKSTMEAQLQGFKDLVGTWEGKYQEFKKNKLSKVLV
FT                   YDFTKSYSNLLNRLEVLHAESSTDDLVLHVDRMSEDLKKTIEEIDGNLFQVTPEELSLL
FT                   AREYQGLMNELPLIVQEGNRLQEAISSEGVSQGLMLLNSLLNRDEKINKNIESSRKNLV
FT                   AIAKQARSDARNIDSQGLAPLIQRNRASLDNILQNMYLFNGSIRNIHALDTETLVATSS
FT                   NMFSAMHTFDWNIYTNLLDVLEIQSKPAPAPMENPDLPGALPEEVQDAVAEDVSGTHRL
FT                   HHQVLKRRCADLKNMISQLQKSINKWGMAKAIVLGIVAVLFCVLSAIFIGQNILSLLIL
FT                   SCVGLLLTQVCPLIFDRISKSKEFEKQVLETAQSLIPATKILPSEFNNKDLNRLAKLQD
FT                   NLNLEGFGPTWARNIVSDLEGIPTKEKSLKDLTKEFRKDSKNLNKRIKRRFKEGLGQEA
FT                   PVVRPTIPQDIRGAEVFAELHRELEHLQKQKEEISIRGDALVQERMGLCLEKSKYDNEK
FT                   AHAAAMTKKVGKLQNIDRLQKNNETYVRIQNFFRTLIQEKLGRDTVQEIDVVKEAKELH
FT                   ELAAIIYGNTSGKSQKQRAKKQFKENVLHIAGKGQLELLEAYLNVTASQGLCRHQMQAS
FT                   FRERILLNPDGAKHGEAERTLASREEMLKTLGLSYLTPFVRFSSPESTQSGYNQILKVR
FT                   EQLFDIEQRLQNQETVSPEDYAAVQAALAAYVRKHESLIVSTYGLGAQEGQTSSKVTTL
FT                   MRDLHAVEELVEMGVETYRLNRSDQILHRVHSVLHSHLRDSDSSGNGIIDVVKKLFELL
FT                   NNNGNNPNDPECQKYMQILLDAPVSLLYGAFKSFKNEFLLNFTELNIANSTKAAEEEAK
FT                   RYVEEKGRGFETYWEEAKQRLEAIAAELDDLRNQETLLEQEIRLANLKISIFSDLNLRE
FT                   KVSVEKAALEEEIQGIQEQYAEMQGIEDLELKQKFEDLQKKLEALEERLLQIGRRIDSS
FT                   VDKQKELLGLLGREEAA"
FT   gene            complement(190117..191637)
FT                   /locus_tag="CpB0152"
FT   CDS_pept        complement(190117..191637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0152"
FT                   /product="pentachlorophenol 4-monooxygenase"
FT                   /note="similar to pentachlorophenol 4-monooxygenase -
FT                   Flavobacterium sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98085"
FT                   /protein_id="AAP98085.1"
FT                   /translation="MADILVIGANPTGLILANMLIQHGISVKVIDHRASPEDPSFLDCR
FT                   KLPVILSCSSLELLHNSEMLGDFIQANHKIFGARYHWKKRTLLFKFSQATDSPVPFSLS
FT                   TTYQSLEQHLIDEFLKRGGVIDWSTRPVTLVDNSIFIESTKVSQNFENREIYNPKWIIA
FT                   CEADNNLDIRDLVKSQLRARRINREVIFINCDEGEPFEEDHIHLLPITKNFLNFVFYNP
FT                   QEKTKQLCLPQGTHSISPKLKQKLLYTYNLVISDENFHIKTSHHAFPPEHGNVLFLGSL
FT                   SNTLLLSYLNGINTNIHAAFNLAWKLLPVLKKAALKHLVITKEQEDGNILPYISPTTEK
FT                   RAKKLPFSRFYTPALMYYFLKGCRKFNTTGEEYYYPPHQALKYRSSDIIKMSPQDKEIH
FT                   GPGPGMRAIDARLENGSFLLDPLKSSKHLLIFFKDIPDLKEALQEEYGEWIEICNVKEP
FT                   RILNLYHANPNSLFIIRPDRYIGYRTHTFKLHELISYLLRIFASEKTS"
FT   gene            complement(191810..192760)
FT                   /locus_tag="CpB0153"
FT   CDS_pept        complement(191810..192760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0153"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT149 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98086"
FT                   /protein_id="AAP98086.1"
FT                   /translation="MRKVAFLVSCLFSVAIGASAAPVRVPGFPQIPEDLVQIKTEVCPK
FT                   QEVCLAVTIKCDDHNLIGVLHLPNTPTPEGGFPTVVLFHGFRGTKFGGLTGAYRKLGRK
FT                   FAAAGIATLRVDMAGCGDSEGVAEEVPIETYLRDAQTILETVQEHPDLNAYRLGISGFS
FT                   LGCHIAFELAKIYNPRDLNIKALSVWAPIADGGILLKELYENFSKHGEGDIISVGKDFG
FT                   FGPPPIIVCSGDVDLLIRIQDHVTANSLPTKPYILHQQGIDDTLVSRTQQTLFKNTAPG
FT                   RMTFISYPNTGHNLATAPDLDMILDQIVSHFQRTL"
FT   gene            192928..195390
FT                   /locus_tag="CpB0154"
FT   CDS_pept        192928..195390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0154"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="similar to leucyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98087"
FT                   /db_xref="GOA:Q9Z930"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z930"
FT                   /protein_id="AAP98087.1"
FT                   /translation="MRYDPNLIEKKWQQFWKEHRSFQANEDEDKVKYYVLDMFPYPSGA
FT                   GLHVGHLIGYTATDIVARYKRARGFSVLHPMGWDSFGLPAEQYAIRTGTHPKVTTQKNI
FT                   ANFKKQLSAMGFSYDEGREFATSDPDYYHWTQKLFLFLYDQGLAYMADMAVNYCPELGT
FT                   VLSNEEVENGFSIEGGYPVERKMLRQWILKITAYADKLLEGLDALDWPENVKQLQKNWI
FT                   GKSEGALVTFHLTQEGSLEAFTTRLDTLLGVSFLVIAPEHPDLDSIVSEEQRDEVTAYV
FT                   QESLRKSERDRISSVKTKTGVFTGNYAKHPITGNLLPVWISDYVVLGYGTGVVMGVPAH
FT                   DERDREFAEMFSLPIHEVIDDNGVCIHSNYNDFCLNGLSGQEAKDYVINYLEMRSLGRA
FT                   KTMYRLRDWLFSRQRYWGEPIPIIHFEDGTHRPLEDDELPLLPPNIDDYRPEGFGQGPL
FT                   AKAQDWVHIYDEKTGRPGCRETYTMPQWAGSCWYYLRFCDAHNSQLPWSKEKESYWMPV
FT                   DLYIGGAEHAVLHLLYSRFWHRVFYDAGLVSTPEPFKKLINQGLVLASSYRIPGKGYVS
FT                   IEDVREENGTWISTCGEIVEVRQEKMSKSKLNGVDPQVLIEEYGADALRMYAMFSGPLD
FT                   KNKTWSNEGVGGCRRFLNRFYDLVTSSEVQDIEDRDGLVLAHKLVFRITEHIEKMSLNT
FT                   IPSSFMEFLNDFSKLPVYSKRALSMAVRVLEPIAPHISEELWVILGNPPGIDQAAWPQI
FT                   DESYLVAQTVTFVVQVNGKLRGRLEVAKEAPKEEVLSLSRSVVAKYLENAQIRKEIYVP
FT                   NKLVNFVL"
FT   gene            195387..196700
FT                   /locus_tag="CpB0155"
FT   CDS_pept        195387..196700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0155"
FT                   /product="KDO transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98088"
FT                   /db_xref="GOA:Q46222"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q46222"
FT                   /protein_id="AAP98088.1"
FT                   /translation="MMLRGVHRIFKCFYDVVLVCAFVIALPKLLYKMLVYGKYKKSLAV
FT                   RFGLKKPHVPGEGPLVWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGVQVAS
FT                   QVFIPMGATVSILPLDFSIIIKSVVAKLRPSLVVFSEGDCWLNFIEEAKRIGATTLVIN
FT                   GRISIDSSKRFKFLKRLGKNYFSPVDGFLLQDEVQKQRFLSLGIPEHKLQVTGNIKTYV
FT                   AAQTALHLERETWRDRLRLPTDSKLVILGSMHRSDAGKWLPVVQKLIKEGVSVLWVPRH
FT                   VEKTKDVEESLHRLHIPYGLWSRGANFSYVPVVVVDEIGLLKQLYVAGDLAFVGGTFDP
FT                   KIGGHNLLEPLQCEVPLIFGPHITSQSELAQRLLLSGAGLCLDEIEPIIDTVSFLLNNQ
FT                   EVREAYVQKGKVFVKAETASFDRTWRALKSYIPLYKNS"
FT   gene            196725..196797
FT                   /locus_tag="CpBt05"
FT   tRNA            196725..196797
FT                   /locus_tag="CpBt05"
FT                   /product="tRNA-Met"
FT                   /note="CAT"
FT   gene            196813..196886
FT                   /locus_tag="CpBt06"
FT   tRNA            196813..196886
FT                   /locus_tag="CpBt06"
FT                   /product="tRNA-Met"
FT                   /note="CAT"
FT   gene            complement(196980..197186)
FT                   /locus_tag="CpB0156"
FT   CDS_pept        complement(196980..197186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98089"
FT                   /protein_id="AAP98089.1"
FT                   /translation="MSFGVPFLEKLKISLIPIEEMRHELFMKTHNSSSNGFSNQEKGIR
FT                   TYFKSDLLGYEDLYFLRENINPN"
FT   gene            complement(197262..197804)
FT                   /locus_tag="CpB0157"
FT   CDS_pept        complement(197262..197804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0157"
FT                   /product="kdtA KDO-transferase"
FT                   /note="similar to kdtA KDO-transferase - C. pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98090"
FT                   /protein_id="AAP98090.1"
FT                   /translation="MKLLKASFIKLLLTLDWPTELLLKNRPFDFTGHPEEEKLIKDILL
FT                   KEEGNKYFSLESKKLLARHMMHNIVVLSEEPGRSAFLGRTAFFPNKYPIAQGGVGIPST
FT                   IGNLFTIWYCFYFYRAATPQSDHPDGCGFILLERLKELGAGFFYCDLRESNTTGFTLFF
FT                   EGSNKGVLKNHLFIRDE"
FT   gene            complement(197791..198219)
FT                   /locus_tag="CpB0158"
FT   CDS_pept        complement(197791..198219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98091"
FT                   /protein_id="AAP98091.1"
FT                   /translation="MNIYQFSPGASPNWQASLMAQLNSYFCLGGETVTRIISLRPSGLI
FT                   LAKKEKAVVSTAEKILKILSFILFPLVLIALAIRYLLYNKFNKDLDRAVFFIPTEITKA
FT                   EELIIAKNPALVKEAALTVSPLFYSLPKKYQLMKVETP"
FT   gene            complement(198387..198926)
FT                   /locus_tag="CpB0159"
FT   CDS_pept        complement(198387..198926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0159"
FT                   /product="KDO-transferase"
FT                   /note="similar to KDO-transferase - C.pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98092"
FT                   /protein_id="AAP98092.1"
FT                   /translation="MLLEDLDTDSIPWPKLYLSEDFDFAYYPESKAIIDTVAKLEKNNP
FT                   GEEFCLESKKILARYLLEQLFKLETGLNFPTSTIDGGRESFLIEFSHETKKPTVWAFIY
FT                   FYYYHSNGPKLEKDFKQAGCEVHNRLLNLGLKYRPQAGAQNDGRNGGPYGPIGFLIVWE
FT                   ENYGSVLKDHGFIKDN"
FT   gene            complement(198960..199268)
FT                   /locus_tag="CpB0160"
FT   CDS_pept        complement(198960..199268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98093"
FT                   /protein_id="AAP98093.1"
FT                   /translation="MTPSGFSLATEEKVQVSTAEKVIKILALIFFPIILIALAIRYFLH
FT                   RKFDRKCFVIPQDTPKELELILAANPQLVEKAAREVHPGFFALPTKYQSMYIQTSKG"
FT   gene            complement(199564..201198)
FT                   /locus_tag="CpB0161"
FT   CDS_pept        complement(199564..201198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0161"
FT                   /product="pyrophosphate-fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /note="similar to pyrophosphate - fructose 6-phosphate
FT                   1-phosphotransferase, beta subunit - Solanum tuberosum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98094"
FT                   /protein_id="AAP98094.1"
FT                   /translation="MELLSLNKSYFEIQRLRYRPEILTLLETIRSKHIQETSSPPSPPP
FT                   ELQKHIPNLCRIPEVSIYTEQETSSKPLKIGVLLSGGQAPGGHNVVIGLFDALRVFNPK
FT                   TRLFGFIKGPLGLTRGLYKDLDISVIYDYYNMGGFDMLSSSREKIKTEEQKKNILNTVK
FT                   QLKLDGLLIIGGNNSNTDTAMLAEYFLAHNCKTSVIGVPKTIDGDLKNCWIETSLGFHT
FT                   SCRTYSEMIGNLAKDALSAKKYHHFIRLMGQQASYTTLECGLQTLPNIALISELIATRK
FT                   ISLKQLSEQLALGLVRRYKSGKNYSTVLIPEGLIEHIFDTRKLIDELNVLLANGDSSIE
FT                   KILSKLSPETLKTFHLFPKDIANQLLLARDSHGNVRVSKIATEELLAVMVKKEIEKIKP
FT                   HMEFHSVSHFFGYEARAGFPSNFDCNYGIALGIISALFLVRQKTGYMITINNLAQSYTE
FT                   WQGGATPLYKMMHLENRCGTETPVIKTDSVDPKSPAVQHLLQQSDSCLVEDLYRFPGPL
FT                   QYFGKEELIDQRPLTLLWENQTHSPLL"
FT   gene            complement(201202..202029)
FT                   /gene="cinI"
FT                   /locus_tag="CpB0162"
FT   CDS_pept        complement(201202..202029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinI"
FT                   /locus_tag="CpB0162"
FT                   /product="cinnamoyl ester hydrolase"
FT                   /note="similar to cinnamoyl ester hydrolase - Butyrivibrio
FT                   fibrisolvens"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98095"
FT                   /protein_id="AAP98095.1"
FT                   /translation="MITGVVLEKHEQRTMFSLTLLNNFTTFGLLHTPLHYNPPYPIVIL
FT                   LHGLASDKTGSKRSHVRLAQELTRLGIAALRVDLLGHGDCEGELMDFSLENYKQNIREI
FT                   IEYTHSLLHIDQERLAIFGSSLGGTLALQTLPFFNKIKALAVWAPTISGELMAAEAQKN
FT                   APEVITMSQKGAITYAGMTLNPDFYTQFLKIDIVKELMPSARNLPPILYMQGEQDLLVS
FT                   INHRTLFTEAFANQDKPITILTYPDVDHAFPFAESSALSDLTQWLKRELTSGE"
FT   gene            complement(202207..203235)
FT                   /locus_tag="CpB0163"
FT   CDS_pept        complement(202207..203235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98096"
FT                   /protein_id="AAP98096.1"
FT                   /translation="MKLYSISSDVDTPWIFQLMSKVDSYLFLGGNRIKVVSIVMQEPNL
FT                   IIGKVENVRISTIVKILKILSFLIFPLILIALALHYFLHAKYANHLLVSKILERAPQYV
FT                   PIPGRSGDTASHYKLTTLVPVSQKNLQAMGSNPLEVEAALRTTKPSFFCVPAKYRQIII
FT                   SSHGIRFSLDLEQLADDINLDSVSWPTEYLNSTMDFCSKADKRVIQNVQNLRTGTYINS
FT                   VGKRSLLKFMLQHLFIDGITQENPEALPNNTSGRLTLFPSVRYIYSHFTPQNPTIWPQV
FT                   FFRQGPLDEDRGGGFEILEQLQELGVRFPICPSQGPDNPNFQGFQGIRIYWEDSYQPNK
FT                   EV"
FT   gene            203433..203804
FT                   /locus_tag="CpB0164"
FT   CDS_pept        203433..203804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0164"
FT                   /product="lamin 2-like protein"
FT                   /note="similar to lamin 2 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98097"
FT                   /protein_id="AAP98097.1"
FT                   /translation="MRAGGSLVTTYPKEGQRLRSPEQLRVLDDLVQSYPNHLHAIELDC
FT                   GAIPQDLIGATYIITFADFSAYILSLRSYQANSPSDDTWGIWFGSIDDPVQAVISFLKD
FT                   HGFALPSTLAQDPLLCTNK"
FT   gene            203851..204408
FT                   /locus_tag="CpB0165"
FT   CDS_pept        203851..204408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98098"
FT                   /protein_id="AAP98098.1"
FT                   /translation="MCFKCIYIKIIFSFLKQLMTRSTIESSDSLCSRSFSQKLSVQTLK
FT                   NLCESRLMKITSLVIAFLTLIVGGALIALAGGGVLSFPLGLILGSVLVLFSSIYLVSCC
FT                   KFFTLKEMTMTCSVKSKINIWFEKQRNKDIEKALENPDLFGENKRNVGNRSARNQLEMI
FT                   LHETDGIILKRYMKGAKMYFYL"
FT   gene            204405..204992
FT                   /locus_tag="CpB0166"
FT   CDS_pept        204405..204992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98099"
FT                   /protein_id="AAP98099.1"
FT                   /translation="MNWVPKTIDHVDPESEIDIRKVVSCYKLIKECQPEFRSLISELLG
FT                   VIRCGLRLLKRSKYKEQARTVSDEDAPLFCLTRSYYQDGYLTPLRAGPRDLINHYIHLR
FT                   RRENPKHFFSPKHPCYYARLAFNESVCVYRELFDIERLTKMYVEGDYSKEQEKNLQAIL
FT                   SFVKTLDEGKDFLIEHKDTDLIGRGFTDVFCT"
FT   gene            205037..205372
FT                   /locus_tag="CpB0167"
FT   CDS_pept        205037..205372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98100"
FT                   /protein_id="AAP98100.1"
FT                   /translation="MSESINRSIHLEASTPFFIKLTNLCESRLVKITSLVISLLALVGA
FT                   GVTLVVLFVAGILPLLPVLILEIILITVLVLLFCLVLEPYLIEKPSKIKELPKVDELSV
FT                   VETDSTL"
FT   gene            complement(205381..205713)
FT                   /locus_tag="CpB0168"
FT   CDS_pept        complement(205381..205713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0168"
FT                   /product="ribosomal protein YmL31 precursor"
FT                   /note="similar to ribosomal protein YmL31 precursor,
FT                   mitochondrial - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98101"
FT                   /protein_id="AAP98101.1"
FT                   /translation="MWSHFPRGFFMLPFCPTILLAKPFLNSENYGLERLAATVDSYFDL
FT                   GQSQIVFLSKQDQGITVEELSAKDRKFKPGSMNCTLYTEDPILPAHNSFSNCSDIQMRT
FT                   PISPIH"
FT   gene            complement(205821..206048)
FT                   /locus_tag="CpB0169"
FT   CDS_pept        complement(205821..206048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98102"
FT                   /protein_id="AAP98102.1"
FT                   /translation="MAFNESVRIYRKLFNTAELKQMYGAGDYEQQNEDNLKSILSFVQI
FT                   LDEKDGFDDFLATHKDTTFIGRGGADIFCS"
FT   gene            complement(206114..206908)
FT                   /locus_tag="CpB0170"
FT   CDS_pept        complement(206114..206908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98103"
FT                   /protein_id="AAP98103.1"
FT                   /translation="MKNVGSECSQPLVMELNTQPLRNLCESRLVKITSFVIALLALVGG
FT                   ITLTALAGAGILSFLPWLVLGIVLVVLCALFLLFSYKFCPIKELGVVYNTDSQIHQWFQ
FT                   KQRNKDLEKATENPELFGENRAEDNNRSARSQVKETLRDCDGNVLKKIYERNLDVLLFM
FT                   NWVPKTMDDVDPVSEDSIRTVISCYKLIKACKPEFRSLISELLRAMQSGLGLLSRCSRY
FT                   QERAKTVSHKDAPLFCPTHSYYRDGYLTPLRAGPRYIINRAI"
FT   gene            207058..207213
FT                   /locus_tag="CpB0171"
FT   CDS_pept        207058..207213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98104"
FT                   /protein_id="AAP98104.1"
FT                   /translation="MSHRSKRDICHSMFYKKFFSVIFLSKLDRSFLLFPTKSRVILYLS
FT                   YVKRQS"
FT   gene            complement(207429..208433)
FT                   /locus_tag="CpB0172"
FT   CDS_pept        complement(207429..208433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98105"
FT                   /protein_id="AAP98105.1"
FT                   /translation="MSYDTLFKNLEKEDSVHKICNEIFALVPRLNTIACTEAIIKNLPK
FT                   ADIHVHLPGTITPQLAWILGVKNGFLKWSYNSWTNHRLLSPKNPHKQYSNIFRNFQDIC
FT                   HEKDPDLSVLQYNILNYDFNSFDRVMATVQGHRFPPGGIQNEEDLLLIFNNYLQQCLDD
FT                   TIVYTEVQQNIRLAHVLYPSLPEKHARMKFYQILYRASQTFSKHGITLRFLNCFNKTFA
FT                   PQINTQEPAQEAVQWLQEVDSTFPGLFVGIQSAGSESAPGACPKRLASGYRNAYDSGFG
FT                   CEAHAGEGIETRTIFSSAKVNPEGLIEITRVTFSSLKRKQPSSLPIRVTCQLG"
FT   gene            complement(208553..209842)
FT                   /locus_tag="CpB0173"
FT   CDS_pept        complement(208553..209842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0173"
FT                   /product="GMP synthase"
FT                   /note="glutamine-hydrolyzing; similar to GMP synthase
FT                   (glutamine-hydrolyzing) - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98106"
FT                   /db_xref="GOA:Q9Z913"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z913"
FT                   /protein_id="AAP98106.1"
FT                   /translation="MQSARRHLNTIFILDFGSQYTYVLAKQVRKLFVYCEVLPWNISVQ
FT                   CLKERAPLGIILSGGPHSVYENKAPHLDPEIYKLGIPILAICYGMQLMARDFGGTVSPG
FT                   VGEFGYTPIHLYPCELFKHIVDCESLDTEIRMSHRDHVTTIPEGFNVIASTSQCSISGI
FT                   ENTKQRLYGLQFHPEVSDSTPTGNKILETFVQEICSAPTLWNPLYIQQDLVSKIQDTVI
FT                   EVFDEVAQSLDVQWLAQGTIYSDVIESSRSGHASEVIKSHHNVGGLPKNLKLKLVEPLR
FT                   YLFKDEVRILGEALGLSSYLLDRHPFPGPGLTIRVIGEILPEYLAILRRADLIFIEELR
FT                   KAKLYDKISQAFALFLPIKSVSVKGDCRSYGYTIALRAVESTDFMTGRWAYLPCDVLSS
FT                   CSSRIINEIPEVSRVVYDISDKPPATIEWE"
FT   gene            complement(209844..210584)
FT                   /locus_tag="CpB0174"
FT   CDS_pept        complement(209844..210584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0174"
FT                   /product="guaB gene for inosine 5-monophosphase
FT                   dehydrogenase subunit"
FT                   /note="similar to guaB gene for inosine 5-monophosphase
FT                   dehydrogenase subunit - Escherichia coli (putative
FT                   pseudogene)'"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98107"
FT                   /protein_id="AAP98107.1"
FT                   /translation="MEAGANVLVIDTAHAHSKGVFQTVLEIKSQFPQISLVVGNLVTAE
FT                   AAVSLAEIGVDAVKVGIGPGSICTTRIVSGVGYPQITAITNVAKALKNSAVTVIADGRI
FT                   RYSGDVVKALAAGADCVMLGSLLAGTDEAPGDIVSIDEKLFKRYRGMGSLGAMKQGSAD
FT                   RYFQTQGQKKLVPGGVEGLVAYKGSVHDVLYQILGGIRSGMGYVGAETLKDLKTKASFV
FT                   RITESGRAESHIHNIYKVQPTLNY"
FT   gene            complement(210645..210908)
FT                   /locus_tag="CpB0175"
FT   CDS_pept        complement(210645..210908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0175"
FT                   /product="guaB gene for inosine 5-monophosphase
FT                   dehydrogenase subunit"
FT                   /note="similar to guaB gene for inosine 5-monophosphase
FT                   dehydrogenase subunit - Bacillus subtilis (putative
FT                   pseudogene)'"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98108"
FT                   /protein_id="AAP98108.1"
FT                   /translation="MEEALTFDDVLLIPQYSEILPSEVSLKTAISKTLSLNIPILSAAM
FT                   DSVTETAMALALAQEGGLGILHKNMSEVEQSSSVRKIKEAYP"
FT   gene            complement(211119..211394)
FT                   /locus_tag="CpB0176"
FT   CDS_pept        complement(211119..211394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98109"
FT                   /protein_id="AAP98109.1"
FT                   /translation="MDFSVFPDRFVESTSPSPIEDIDAKTLVSNCCHYCSRCLFIFLSL
FT                   LSIIICFSVYGTSGETASLVFGILSLIVLVLLIIECRNRECCRRIS"
FT   gene            211640..212134
FT                   /locus_tag="CpB0177"
FT   CDS_pept        211640..212134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98110"
FT                   /protein_id="AAP98110.1"
FT                   /translation="MEKIVILSMIMTTISNSPSPALNPELSLIPPPTLVSSGTQTSLAY
FT                   TIPAQGRRSTLRIILDIFIIILGLATIISTFIVIFFLNGLNLLSTPSIISSSCLIIVGL
FT                   LFLIMGLYFMISSLDQGLVGLLQKELSQAEEREEEYIQEIEALRGAPRAESPTESPSTW
FT                   L"
FT   gene            212305..212685
FT                   /locus_tag="CpB0178"
FT   CDS_pept        212305..212685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98111"
FT                   /protein_id="AAP98111.1"
FT                   /translation="MEQPNCVIQDTTTVLYALNSFDPRLSDDTHRLGKQSPLEAENALG
FT                   EFIEGLDTNSFPLEEVAIPILPGYHPKFYLSFIDRDDQGVHYEVLDGVFLKTVAACIIE
FT                   NSFLTDSMSPELLSEVKEALKR"
FT   gene            212693..213928
FT                   /locus_tag="CpB0179"
FT   CDS_pept        212693..213928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0179"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT153 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98112"
FT                   /protein_id="AAP98112.1"
FT                   /translation="MDESDGEEASKDSAFSASFSYEFVKSSTRESKNTVTHSTASRTLY
FT                   ILRQDCSYDPRALKVDDEFRYWVEKRLDAKNPDSLNAFVKEVGTHYVASVTYGGIGFQV
FT                   LKMSYLQVEELEKEKISISVAAASSLLKSKTSNATEKGYSSYQSESSAQTVFLGGTVLP
FT                   DLQQDKLDFKDWSESIPNEPIPLAISVSSITDLIIPELFPSEDAQVLSQKKSALGQVIL
FT                   NYLESHKPKEEGPKPVQITSGFNSSSSVFTLQAAKAPKTVSFPYIDYWSTIPYLFPTLK
FT                   ETSGAQPLSFYLRFDDIFEQQNLVHNTSYILASTSVRLGYFGDSYRDYDALSFYGSWPQ
FT                   AYFDWAGYKDRCTWTLEKLNTTGDLFIRSGDEIRLKHNTSGKYLATTSMSDGYQTLTCT
FT                   TQTSDSVFIITV"
FT   gene            complement(214012..214866)
FT                   /locus_tag="CpB0180"
FT   CDS_pept        complement(214012..214866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98113"
FT                   /protein_id="AAP98113.1"
FT                   /translation="MKQPMSLIFSSVCLGLGLGSLSSCNQKPSWNYHNTSTSEEFFVHG
FT                   NKSVSQLPHYPSAFRTTQIFSEEHNDPYVVAKTDEESRKIWREIHKNLKIKGSYIPIST
FT                   YGSLMHPKSAALTLKTYRPHPIWINGYERSFNIDTGKYLKNGSRRRTSHDGPKNRAVLN
FT                   LIKSSGRRCNAIGLEMTEEDFVIARRREGVYSLYPVEVCSYPQGNPFVIAYAWIADESA
FT                   CSKEVLPVKGYYSLVWESVSSSDSLNAFGDSFAEDYLRSTFLANGTSILCVHESYKKVP
FT                   PQP"
FT   gene            complement(215193..215459)
FT                   /locus_tag="CpB0181"
FT   CDS_pept        complement(215193..215459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98114"
FT                   /protein_id="AAP98114.1"
FT                   /translation="MKEYLDFLVQRNVERDPQTKRHCTVSQKFGGESIDAKTTTGQLFH
FT                   IAGKTEPGHGKLCLGESILKQLLALGIITGYENREREVWVYLD"
FT   gene            complement(215460..215810)
FT                   /locus_tag="CpB0182"
FT   CDS_pept        complement(215460..215810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98115"
FT                   /protein_id="AAP98115.1"
FT                   /translation="MQAGRSGIIPGKKAILLNVNDAKTPNYSCIFESIGFFNEQDLEAQ
FT                   HNQQAALVRKILKVVPHHFLKGLIAKLPRSLKKDRKFMSSLIFTKLSYALDLSAPMHLE
FT                   GKPNLSYEEKLD"
FT   gene            complement(215759..216313)
FT                   /locus_tag="CpB0183"
FT   CDS_pept        complement(215759..216313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98116"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z904"
FT                   /protein_id="AAP98116.1"
FT                   /translation="MASETYPSQILHAQREVRDAYFNQADCHPARANQILEAKKICLLD
FT                   VYHTNHYSVFTFCVDNYPNLRFTFVSSKNNEMNGLSNPLDNVLVEAMVRRTHARNLLAA
FT                   CKIRNIEVPRVVGLDLRSGILISKLELKQPQFQSLTEDFVNHSTNQEEARVHQKHVLLI
FT                   SLILLCKQAVLESFQEKKRSS"
FT   gene            complement(216181..216582)
FT                   /locus_tag="CpB0184"
FT   CDS_pept        complement(216181..216582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98117"
FT                   /protein_id="AAP98117.1"
FT                   /translation="MHELFKIDGVYYFFKKFMKLFYNNYSLNSHHEKPSSLEKAVQALD
FT                   SYFYWGGDTTDVLARDDISREIYCVRRLYIRFWIVSISQSLSRIPWRLKRILLRYCTLR
FT                   GKYVMPILIKRIAILLGLIRFSRLRKSVY"
FT   gene            complement(216738..218102)
FT                   /locus_tag="CpB0185"
FT   CDS_pept        complement(216738..218102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0185"
FT                   /product="biotin carboxylase"
FT                   /note="similar to biotin carboxylase - Anabaena sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98118"
FT                   /protein_id="AAP98118.1"
FT                   /translation="MKKVLIANRGEIAVRIIRACHDLGLSTVAVYSLADQEALHVLLAD
FT                   EAICIGEPQAAKSYLKISNILAACEITGADAVHPGYGFLSENANFASICESCGLTFIGP
FT                   SSESIAMMGDKIAAKSLAKKIKCPVIPGSEGIIEDESEGLKIAEKIGFPIVIKAVAGGG
FT                   GRGIRIVKEKDEFYRAFSAARAEAEAGFNNPNVYIEKFIENPRHLEIQVIGDTHGNYVH
FT                   LGERDCTIQRRRQKLIEETPSPILNAEIRVKVGKVAVDLARSAGYFSVGTVEFLLDKDK
FT                   KFYFMEMNTRIQVEHTITEEVTGIDLVKEQIHVAMGNKLPWKQKNIEFSGHIIQCRINA
FT                   EDPTNNFSPSPGRLDYYLPPAGPSIRVDGACYSGYAIPPYYDSMIAKVIAKGKNREEAI
FT                   AIMKRALKEFHIGGVQSTIPFHQFMLDNPKFLESNYDINYIDNLLAQGNSFFKEF"
FT   gene            complement(218099..218602)
FT                   /locus_tag="CpB0186"
FT   CDS_pept        complement(218099..218602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0186"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier"
FT                   /note="similar to acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier - Anabaena sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98119"
FT                   /db_xref="GOA:Q9Z901"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z901"
FT                   /protein_id="AAP98119.1"
FT                   /translation="MDLKQIEKLMIAMGRNGMKRFAIKREGLELELERDTREGNRQEPV
FT                   FYDSRLFSGFSQERPIPTDPKKDTIKETTTENSETSTTTSSGDFISSPLVGTFYGSPAP
FT                   DSPSFVKPGDIVSEDTIVCIVEAMKVMNEVKAGMSGRVLEVLITNGDPVQFGSKLFRIA
FT                   KDAS"
FT   gene            complement(218625..219182)
FT                   /locus_tag="CpB0187"
FT   CDS_pept        complement(218625..219182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0187"
FT                   /product="translation elongation factor EF-P"
FT                   /note="similar to translation elongation factor EF-P -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98120"
FT                   /db_xref="GOA:Q9Z900"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z900"
FT                   /protein_id="AAP98120.1"
FT                   /translation="MVLSSQLSVGMFISTKDGLYKVTSVSKVAGPKGESFIKVALQAAD
FT                   SDVVIERNFKATQEVKEAQFETRTLEYLYLEDESYLFLDLGNYEKLFIPQEIMKDNFLF
FT                   LKAGVTVSAMVYDNVVFSVELPHFLELMVSKTDFPGDSLSLSGGVKKALLETGIEVMVP
FT                   PFVEIGDVIKIDTRTCEYIQRV"
FT   gene            complement(219169..219858)
FT                   /locus_tag="CpB0188"
FT   CDS_pept        complement(219169..219858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0188"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="similar to ribulose-phosphate 3-epimerase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98121"
FT                   /db_xref="GOA:Q9Z8Z9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z9"
FT                   /protein_id="AAP98121.1"
FT                   /translation="MKKQESVLVGPSIMGADLTCLGVEAKKLEQAGSDFIHIDIMDGHF
FT                   VPNLTFGPGIIAAINRSTDLFLEVHAMIYNPFEFIESFVRSGADRIIVHFEASEDIKEL
FT                   LSYIKKCGVQAGLAFSPDTSIEFLPSFLPFCDVVVLMSVYPGFTGQSFLPNTIEKIAFA
FT                   RHAIKTLGLKDSCLIEVDGGIDQQSAPLCRDAGADILVTASYLFEADSLAMEDKILLLR
FT                   GENYGVK"
FT   gene            220306..221478
FT                   /locus_tag="CpB0189"
FT   CDS_pept        220306..221478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0189"
FT                   /product="inclusion membrane protein A"
FT                   /note="similar to inclusion membrane protein A - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98122"
FT                   /protein_id="AAP98122.1"
FT                   /translation="MSSPVNNTPSAPNIPIPAPTTPGIPTTKPRSSFIEKVIIVAKYIL
FT                   FAIAATSGALGTILGLSGALTPGIGIALLVIFFVSMVLLGLILKDSISGGEERRLREEV
FT                   SRFTSENQRLTVITTTLETEVKDLKAAKDQLTLEIEAFRNENGNLKTTAEDLEEQVSKL
FT                   SEQLEALERINQLIQANAGDAQEISSELKKLISGWDSKVVEQINTSIQALKVLLGQEWV
FT                   QEAQTHVKAMQEQIQALQAEILGMHNQSTALQKSVENLLVQDQALTRVVGELLESENKL
FT                   SQACSALRQEIEKLAQHETSLQQRIDAMLAQEQNLAEQVTALEKMKQEAQKAESEFIAC
FT                   VRDRTFGRRETPPPTTPVVEGDESQEEDEGGTPPVSQPSSPVDRATGDGQ"
FT   gene            221655..222455
FT                   /locus_tag="CpB0190"
FT   CDS_pept        221655..222455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0190"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein 2 - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98123"
FT                   /protein_id="AAP98123.1"
FT                   /translation="MHSKFLSRRKKNSSHKEETSWDCIASSYNKIVQDKGHYYHRETIL
FT                   PQLLPSLTLGSKSSVLDIGCGQGFLERALPKECRYLGIDISSRLIALAKKMRSVNSHQF
FT                   KVADLSKRLEFVEPTLFSHAVAILSLQNMEFPGEAIRNTATLLEPLGQFFIVLNHPCFR
FT                   IPRASSWHYDENKKAISRHIDRYLSPMKIPIMAHPGQKDSPSTLSFHFPLSYWFKELSS
FT                   HGFLVSGLEEWTSSKTSTGKRAKAENLCRKEFPLFLMISCIKIK"
FT   gene            222518..223810
FT                   /locus_tag="CpB0191"
FT   CDS_pept        222518..223810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0191"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT132 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98124"
FT                   /protein_id="AAP98124.1"
FT                   /translation="MFRKLFPFSKKKTGQKQRLRNNGLLQAIIQSIKVLLHNEASKEAC
FT                   VLSYYGLLTCVPILVFFLRLSQHLFTNLNWKEWLIIKFPDYKKPIVAIVEAAYHATESN
FT                   IGLVLVGSFFVFCWAGILMLLSLEDGLNKIFRTSWTPISLKRLVSYFVITLVSPMIFII
FT                   VCGSWIYITQIMPIQYAKLFSLSHSMTALYFISRFVPYLLLYLALFCCYAFLPRVAIQK
FT                   TSALISTLIIGSVWIVFQKAFFSLQVSIFNYSFTYGALVALPSFLLLLYIYTMIYLFGG
FT                   ALTFIIQNRGCTFIFLGDKILPSCYLQLITSTYILALTTRQFNEGLSPLTAQFIAKQSK
FT                   VPIGEVSQCLDVLEKEGFLFPYNNGYQPVFNFSELTIKDIADKLLHREIFKKFNPDLGI
FT                   TFIENSFQNIFNQASKNKENLTLSEIARRIK"
FT   gene            223807..227235
FT                   /locus_tag="CpB0192"
FT   CDS_pept        223807..227235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0192"
FT                   /product="putative transmembrane protein CT131"
FT                   /note="similar to probable transmembrane protein CT131 -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98125"
FT                   /protein_id="AAP98125.1"
FT                   /translation="MKRRSWLKILGICLGSSIVLGFLIFLPQLLSTESGKYLVFSLIHK
FT                   ESGLSCSAEELKISWFGRQTARKIKLTGEAKDEVFSAEKFELDGSLLRLLIYKKPKGIT
FT                   LSGWSLKINEPASIDHPSVSHLDPGSLLTYLNDCKIISEHGFITMKTVSGSSLSVSGFY
FT                   LEKSSEKFMTKCVVSEDQQSGNIFIESVLSPDVSISAQFSSVPVAFFKIFIASPFWDHL
FT                   LSYEDIINLSAEATHTNDGKISMTASGEGNQIQMKLQGHIHKSTFYIVEGSSSFIELKP
FT                   ELASALCNQIIPLSTPITSKQIHATVSYAKIPLDITKWKHIEITSQAQLPEVAIHPKDP
FT                   NLALQLRDTKLGIKKTEKFSDIRYSSSTVLGGASPSHLNGLISIDNKKHLTKFRLQQAQ
FT                   LPHTYLRAIFPQPFVINVPLDVAYYSLNIEGTYKNAHLEADAILDNPLLKLSCSMSGAW
FT                   KNFLFKGQGTYHFNKKWQEILSPHFSYAEARFSGKAQITDTNLFFPKFSGKITARENEL
FT                   LIHAKFGSPNEPIKPETTSILIHGQFCSLPLSLVSNHLAPFHLKKLTFSFHTDGGKFVT
FT                   KGNLQALIENPDYPDLNNTRILIPDLLLSLDESSTSPSSKDLKIQGSGEIFSLPLDSIT
FT                   KTYGKQVRLSPYFGSSGDLNFVVNYNPKDQNKLTLLSNFKSEALLGELKLVMDFSMKLS
FT                   SGTQGTLQWEVSPERYASFFKNASCSPTCLLHRTANVRLDISKLSCPEETKGLSCLTLL
FT                   AAGGLEGSLEATPLIFYDNVSKETFIINDFKGSLRANNLDAKIEYDLKGSCLAPRQDSK
FT                   TLAEFSLEGQVDHLFSPESREFKQTANWIHIPSSFIAGIIPMSPGLKAQISSLAGPRIN
FT                   VSIKNAFRFGEGPVDIMVDSENLQAQIPLILNEKSILLRENLTAHLSINEDVNKAFLQE
FT                   FNPLLAGGAYSQYPVTLEIDKQNFYLPIRPYSFEEFRIQSATLDMGKISIANTGTMYAL
FT                   FQFLDITDQKQFVESWFTPIFFSVQKGSIICKRFDALIDRRIRLALWGKTDIAHDRLFM
FT                   TLGIDPEVIKKYFHNTSLKTKNFFLIKIRGSISSPEVDWSSAYARIALLKSYSLGNPFS
FT                   SLADKLFSSLGDSTPPPTVHPFPWEKSNFDSIENK"
FT   gene            227326..228684
FT                   /locus_tag="CpB0193"
FT   CDS_pept        227326..228684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0193"
FT                   /product="myosin heavy chain, skeletal muscle"
FT                   /note="similar to myosin heavy chain, skeletal muscle -
FT                   Oryctolagus cuniculus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98126"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z4"
FT                   /protein_id="AAP98126.1"
FT                   /translation="MRKRHSFDSTSTKKEAVSKAIQKIIKIMETTDPSLNVETPNAEIE
FT                   SILQEIKEIKQKLSKQAEDLGLLEKYCSQETLSNLENTNASLKLSIGSVIEELASLKQL
FT                   VEESIEESLGQQDQLIQSVLIEISDKFLSSIGETLSGNLDMNQNVIQGLLIKENPEKSE
FT                   AASVGYVQTLLEPLSKRIGETHKKVATHDVNISSLQFHMMSVAGGRFRGHIDMNGYRVL
FT                   GLGEPKNGEDAVSKDYLERYVSSQLTIDKVEDKPITKPNKGKLLYSQGTSPKLESPLPL
FT                   GLLTSGISGFTWKSASKSNDGSFPFSALRHKETESDTDCFQITSTTLSGNQAGTYTWSL
FT                   SLKVLVPSIFQIEKPEVQLSLVYSYEDWLPIDNIFNMSQPRTIPLALLGQTMLAGQKYD
FT                   ILELAAHQTNQTLMISPNCSRFSLQLKQTNQFENSPVDFYIVHAAHSCHWSGF"
FT   gene            complement(228718..229398)
FT                   /locus_tag="CpB0194"
FT   CDS_pept        complement(228718..229398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0194"
FT                   /product="amino acid transport ATP-binding protein"
FT                   /note="similar to amino acid transport ATP-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98127"
FT                   /protein_id="AAP98127.1"
FT                   /translation="MTIRVRNLAYSVNKKKILDGVTFSLERGHITLFVGKSGSGKTMIL
FT                   RALAGLVQPTQGDIWIEGEAPALVFQQPELFSHMTVLGNCTHPQIHIKGRSTEEAREKA
FT                   FELLHLLDIEEVAKNYPDQLSGGQKQRVAIVRSLCMDKHTLLFDEPTSALDPFATASFR
FT                   HLLETLRDQELTVGLTTHDMQFVHSCLDRIYLIDQGTVAGVYDKRDGELDSGHPLSKYI
FT                   HSAQ"
FT   gene            complement(229388..230041)
FT                   /locus_tag="CpB0195"
FT   CDS_pept        complement(229388..230041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0195"
FT                   /product="ABC amino acid transporter permease"
FT                   /note="similar to ABC amino acid transporter permease
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98128"
FT                   /protein_id="AAP98128.1"
FT                   /translation="MDHWLAIARLLLRGCGYTLCVSGIGILCGSILGLLIGTVTSLYFP
FT                   SKLTKLLANSYVTVIRGTPLFIQILIIYFGLPEVLPIEPTPLVAGIIALSMNSAAYLAE
FT                   NIRGGINSLSIGQWESAMVLGYKKYQIFVYIIYPQVFKNILPSLTNEFVSLIKESSILM
FT                   VVGVPELTKVTKDIVSRELNPMEMYLICAGLYFLMTTSFSCISRLSEKRRSYDN"
FT   gene            complement(230090..230533)
FT                   /locus_tag="CpB0196"
FT   CDS_pept        complement(230090..230533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0196"
FT                   /product="arginine repressor protein"
FT                   /note="similar to arginine repressor protein - Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98129"
FT                   /db_xref="GOA:Q9Z8Z1"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z1"
FT                   /protein_id="AAP98129.1"
FT                   /translation="MKKKVTIDEALKEILRLEGAATQEELCAKLLAQGFATTQSSVSRW
FT                   LRKIQAVKVAGERGARYSLPSSTEKTTTRHLVLSIRHNASLIVIRTVPGSASWIAALLD
FT                   QGLKDEILGTLAGDDTIFVTPIDEGRLPLLMVSIANLLQVFLD"
FT   gene            230617..231651
FT                   /locus_tag="CpB0197"
FT   CDS_pept        230617..231651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0197"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="similar to O-sialoglycoprotein endopeptidase -
FT                   Pasteurella haemolytica"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98130"
FT                   /db_xref="GOA:Q9Z8Z0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Z0"
FT                   /protein_id="AAP98130.1"
FT                   /translation="MLTLGLESSCDETACAIVNEDKQILANIIASQDIHASYGGVVPEL
FT                   ASRAHLHIFPQVINKALQQANLLIEDMDLIAVTQTPGLIGSLSVGVHFGKGIAIGAKKS
FT                   LIGVNHVEAHLYAAYMAAQNVQFPALGLVVSGAHTAAFFIENPTSYKLIGKTRDDAIGE
FT                   TFDKVGRFLGLPYPAGPLIEKLALEGSEDSYPFSPAKVPNYDFSFSGLKTAVLYAIKGN
FT                   NSSPRSPAPEISLEKQRDIAASFQKAACTTIAQKLPTIIKEFSCRSILIGGGVAINEYF
FT                   RSAIQTACNLPVYFPPAKLCSDNAAMIAGLGGENFQKNSSIPEIRICARYQWESVSPFS
FT                   LASP"
FT   gene            231597..233195
FT                   /locus_tag="CpB0198"
FT   CDS_pept        231597..233195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0198"
FT                   /product="oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor"
FT                   /note="similar to oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98131"
FT                   /protein_id="AAP98131.1"
FT                   /translation="MRKISVGICITILLSLSVVLQGCKESSHSSTSRGELAINIRDEPR
FT                   SLDPRQVRLLSEISLVKHIYEGLVQENNLSGNIEPALAEDYSLSSDGLTYTFKLKSAFW
FT                   SNGDPLTAEDFIESWKQVATQEVSGIYAFALNPIKNVRKIQEGHLSIDHFGVHSPNEST
FT                   LVVTLESPTSHFLKLLALPVFFPVHKSQRTLQSKSLPIASGAFYPKNIKQKQWIKLSKN
FT                   PHYYNQSQVETKTITIHFIPDANTAAKLFNQGKLNWQGPPWGERIPQETLSNLQSKGHL
FT                   HSFDVAGTSWLTFNINKFPLNNMKLREALASALDKEALVSTIFLGRAKTADHLLPTNIH
FT                   SYPEHQKQEMAQRQAYAKKLFKEALEELQITAKDLEHLNLIFPVSSSASSLLVQLIREQ
FT                   WKESLGFAIPIVGKEFALLQADLSSGNFSLATGGWFADFADPMAFLTIFAYPSGVPPYA
FT                   INHKDFLEILQNIEQEQDHQKRSELVSQASLYLETFHIIEPIYHDAFQFAMNKKLSNLG
FT                   VSPTGVVDFRYAKEN"
FT   gene            233346..234929
FT                   /locus_tag="CpB0199"
FT   CDS_pept        233346..234929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0199"
FT                   /product="oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor"
FT                   /note="similar to oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98132"
FT                   /protein_id="AAP98132.1"
FT                   /translation="MLRFFAVFISTLWLITSGCSPSQSSKGIFVVNMKEMPRSLDPGKT
FT                   RLIADQTLMRHLYEGLVEEHSQNGEIKPALAESYTISEDGTRYTFKIKNILWSNGDPLT
FT                   AQDFVSSWKEILKEDASSVYLYAFLPIKNARAIFDDTESPENLGVRALDKRHLEIQLET
FT                   PCAHFLHFLTLPIFFPVHETLRNYSTSFEEMPITCGAFRPVSLEKGLRLHLEKNPMYHN
FT                   KSRVKLHKIIVQFISNANTAAILFKHKKLDWQGPPWGEPIPPEISASLHQDDQLFSLPG
FT                   ASTTWLLFNIQKKPWNNAKLRKALSLAIDKDMLTKVVYQGLAEPTDHILHPRLYPGTYP
FT                   ERKRQNERILEAQQLFEEALDELQMTREDLEKETLTFSTFSFSYGRICQMLREQWKKVL
FT                   KFTIPIVGQEFFTIQKNFLEGNYSLTVNQWTAAFIDPMSYLMIFANPGGISPYHLQDSH
FT                   FQTLLIKITQEHKKHLRNQLIIEALDYLEHCHILEPLCHPNLRIALNKNIKNFNLFVRR
FT                   TSDFRFIEKL"
FT   gene            234985..236292
FT                   /locus_tag="CpB0200"
FT   CDS_pept        234985..236292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0200"
FT                   /product="oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor"
FT                   /note="similar to oligopeptide ABC transport system
FT                   substrate-binding protein oppA precursor - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98133"
FT                   /protein_id="AAP98133.1"
FT                   /translation="MFSRWITLFLLFISLTGCSSYSSKHKQSLIIPIHDDPVAFSPEQA
FT                   KRAMDLSIAQLLFDGLTRETHRESNDLELAIASRYTVSEDFCSYTFFIKDSALWSDGTP
FT                   ITSEDIRNAWEYAQENSPHIQIFQGLNFSTPSSNAITIHLDSPNPDFPKLLAFPAFAIF
FT                   KPENPKLFSGPYTLVEYFPGHNIHLKKNPNYYDYHCVSINSIKLLIIPDIYTAIHLLNR
FT                   GKVDWVGQPWHQGIPWELHKQSQYHYYTYPVEGAFWLCLNTKSPHLNDLQNRHRLATCI
FT                   DKRSIIEEALQGTQQPAETLSRGAPQPNQYKKQKPLTPQEKLVLTYPSDILRCQRIAEI
FT                   LKEQWKAAGIDLILEGLEYHLFVNKRKVQDYAIATQTGVAYYPGANLISEEDKLLQNFE
FT                   IIPIYYLSYDYLTQDFIEGVIYNASGAVDLKYTYFP"
FT   gene            236570..238156
FT                   /locus_tag="CpB0201"
FT   CDS_pept        236570..238156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0201"
FT                   /product="dipeptide ABC transporter"
FT                   /note="similar to Bacillus subtilis dipeptide ABC
FT                   transporter, dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98134"
FT                   /protein_id="AAP98134.1"
FT                   /translation="MKMHRLKPTLKSLIPNLLFLLLTLSSCSKQKQEPLGKHLVIAMSH
FT                   DLADLDPRNAYLSRDASLAKALYEGLTRETDQGIALALAESYTLSKDHKVYTFKLRPSV
FT                   WSDGTPLTAYDFEKSIKQLYFEEFSPSIHTLLGVIKNSSAIHNAQKSLETLGIQAKDDL
FT                   TLVITLEQPFPYFLTLIARPVFSPVHHTLRESYKKGTPPSTYISNGPFVLKKHEHQNYL
FT                   ILEKNPHYYDHESVKLDRVTLKIIPDASTATKLFKSKSIDWIGSPWSAPISNEDQKVLS
FT                   QEKILTYSVSSTTLLIYNLQKPLIQNKALRKAIAHAIDRKSILRLVPSGQEAVTLVPPN
FT                   LSQLNLQKEISTEERQTKARAYFQEAKETLSEKELAELSILYPIDSSNSSIIAQEIQRQ
FT                   LKDTLGLKIKIQGMEYHCFLKKRRQGDFFIATGGWIAEYVSPVAFLSILGNPRDLTQWR
FT                   NSDYEKTLEKLYLPHAYKENLKRAEMIIEEETPIIPLYHGKYIYAIHPKIQNTFGSLLG
FT                   HTDLKNIDILS"
FT   gene            238449..239393
FT                   /gene="oppB"
FT                   /locus_tag="CpB0202"
FT   CDS_pept        238449..239393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="CpB0202"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="similar to oligopeptide transport system permease
FT                   protein oppB - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98135"
FT                   /protein_id="AAP98135.1"
FT                   /translation="MFSYIKNRILFNLLSLWIVLTLTFLVMKTIPGDPFNDEGCNVLSE
FT                   EVLQTLKSRYGLDKPLYQQYTQYLHSIAKLDFGNSLVYKDRKVTNIISTAFPISAILGL
FT                   QSLFLSIGGGIALGTIAALKKKKQRRYILGASILQISIPAFIFATLLQYVFAVKIPLLP
FT                   IACWGSFTHTILPTLALAVTPMAFIIQLTYSSVSAALNKDYVLLAYAKGLSPLKVVIKH
FT                   ILPYAIFPTISYSAFLTTTVITGTFAIENIFCIPGLGKWFICSIKQRDYPVALGLSVFY
FT                   GTLFMLSSLLSDLIQSIIDPQIRYAHGKEKKRK"
FT   gene            239424..240278
FT                   /gene="oppC"
FT                   /locus_tag="CpB0203"
FT   CDS_pept        239424..240278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="CpB0203"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="similar to oligopeptide ABC transporter (permease)
FT                   oppC - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98136"
FT                   /protein_id="AAP98136.1"
FT                   /translation="MENLSSAPSRSIWKSIIQNKMLVLGLTTLIILMLGALLLPWFYQD
FT                   YEQTSLKDILVSPCSRFPFGTDTLGRCMFARTLRGLRLSLLIATIATLIDVCVGLLWAT
FT                   VAISGGKKIDFLMMRTTEILFSLPRIPIIILLLVIFHHGLLPLILAMTITGWIPISRII
FT                   YGQFLLLKNKPFVLSAKAMHASTFHILKKHLLPNTLAPIISTLIFTIPNAIYTEAFISF
FT                   LGLGIQPPQASLGTLVKEGINAIDYYPWLFFFPSLIMIALSISFNLIGEGAKTLCLEEG
FT                   SHG"
FT   gene            240271..241125
FT                   /gene="oppD"
FT                   /locus_tag="CpB0204"
FT   CDS_pept        240271..241125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="CpB0204"
FT                   /product="oligopeptide transport ATP-binding protein"
FT                   /note="similar to oligopeptide transport ATP-binding
FT                   protein oppD - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98137"
FT                   /protein_id="AAP98137.1"
FT                   /translation="MDNYLLNIKDLTITSTNPKRTLIENLSLQLKENRNLALVGESGSG
FT                   KTTITKAILGFLPENCLIKTGSILFEDIDITKLSPKELHKIRGQKIATILQNAMGSLTP
FT                   SMRIGMQIIETLRQHHKMNKEEAYNKAMQLLTDVCIPNPKYSFSQYPFELSGGMRQRVV
FT                   IAIALASQPKLILADEPTTALDSMSQAQVLRILRNIQQQKQATILLVTHNLSLVKELCN
FT                   DICIIKDGKLIETGTVEEIFLSPKHPYTLKLLNAVSKIPIKKTSSPILKNKFQPLMSMQ
FT                   GGL"
FT   gene            241122..241910
FT                   /gene="oppF"
FT                   /locus_tag="CpB0205"
FT   CDS_pept        241122..241910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="CpB0205"
FT                   /product="oligopeptide transport protein"
FT                   /note="similar to oligopeptide transport protein oppF -
FT                   Lactococcus lactis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98138"
FT                   /protein_id="AAP98138.1"
FT                   /translation="MTTLLSIKDLSLTIRGKKILNHINLNLIKGSYLTIVGPSGSGKSS
FT                   LALTILDLLKPTTGTITFHMDPKIPRARKVQVIWQDIDSSLNPCMSIKGIISEPLNIIG
FT                   TYSKAEQNKEIYNVLDLVNLPKSVLHLKPYKLSGGQKQRIAIAKALVSKPELLICDEPL
FT                   SSLDTLNQSLILDLFQTIKKEYQNTLLFITHDMSAAYYIADTIAVMDQGSLVEHACREK
FT                   IFSTPKHTTTQDLLDAIPIFSLISTEMEPSEEYELQVASK"
FT   gene            242017..242199
FT                   /locus_tag="CpB0206"
FT   CDS_pept        242017..242199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98139"
FT                   /protein_id="AAP98139.1"
FT                   /translation="MIFELFFLRKFLDSTKNSLSSYKIESTPPTAVQSRVRSKKLNTRI
FT                   RRQLFLNYCITIIPI"
FT   gene            242415..243212
FT                   /locus_tag="CpB0207"
FT   CDS_pept        242415..243212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98140"
FT                   /protein_id="AAP98140.1"
FT                   /translation="MNTYTFSPTLQKSFSLFLLEKLDSYFFFGGTRTQILVITPTNIRL
FT                   AAKKRGCKVSTIEKIIKILSFILLPLVIIAFILRYFLHKKFDKQFLCIPKVISNEDEAL
FT                   LGSRPQAVEKAVREISPAFFSIPRKYQLIRIDTPKDDAPSILFPIGIEIILKDLCIDTL
FT                   KQSNLFLKREMDFLGHPEEKALFDSICSIEKDQEWMSLESKKLLITHFLKYLFVSGIEQ
FT                   LNPGFNPENGRGYFSEISTAKIHFHQHGRYGPIRSSGPIMKEI"
FT   gene            243224..243412
FT                   /locus_tag="CpB0208"
FT   CDS_pept        243224..243412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98141"
FT                   /protein_id="AAP98141.1"
FT                   /translation="MGYQIFTRLKKLGISFSSYNSINPNPYFFDEGCFVYWESQFKSAL
FT                   QDHGILQKQTETFYRNT"
FT   gene            243540..243737
FT                   /locus_tag="CpB0209"
FT   CDS_pept        243540..243737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98142"
FT                   /protein_id="AAP98142.1"
FT                   /translation="MLKFFLVCEELCILTVATHRALLETPLALSFFKELKTKYVYRAKD
FT                   ILQLHNYKGFTILNTSPLCS"
FT   gene            243816..244571
FT                   /locus_tag="CpB0210"
FT   CDS_pept        243816..244571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0210"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT203 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98143"
FT                   /db_xref="InterPro:IPR010602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8X8"
FT                   /protein_id="AAP98143.1"
FT                   /translation="MLMDISHILEDLAYDEGILPREAIEAAIVKQMQITPYLLHILHDA
FT                   TQRVPEIVNDGSYQGHLYAMYLLAQFRESRALPLIIKLFAFEDDTPHAIAGDVLTEDLP
FT                   RILASVCNDDSLIKELIETPKINPYVKAAAISGLVTLVGAGKIPRDKVIRYFAELLNYR
FT                   LEKQPSFAWDNLIAGICTLYPGELFYPISKAFDGGLVDTSFISMEDVENIIHEETVESC
FT                   IHTLCSSTELINDTLEEMEKWLEDFPIEP"
FT   gene            244615..246027
FT                   /locus_tag="CpB0211"
FT   CDS_pept        244615..246027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0211"
FT                   /product="2-oxoglutarate/malate translocator precursor"
FT                   /note="similar to 2-oxoglutarate/malate translocator
FT                   precursor - Spinacia oleracea"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98144"
FT                   /protein_id="AAP98144.1"
FT                   /translation="MNKKKRFLSLLFLTAVLLGIWFSPHPASINSNAWQLFAIFTTTIM
FT                   GIIFQPVPMGAIAIIGISTLLLTQTLTLEQGLSGFHNPIAWLVFLSFSIAKGIIKTGLG
FT                   ERIAYFFVSALGKSPLGLSYGLVITDFFLAPAIPSVTARAGGILYPVVTSLSDSFGSSA
FT                   EKGTQDLIGSFLIKVAYQSSVITSAMFLTAMAGNPLVAALAGHVGVSLSWVLWAKAAII
FT                   PGLLSLFLMPIILYKLYPPKITSCEEAIRSAKLRLKEMGPLKKEEKTILMIFFLLVVLW
FT                   TFGDLLGISATTAALIGLSLLILTNILDWQKDVIANTTAWETFIWFGALIMMASFLNQL
FT                   GFIPLVGDSAAALVSGLSWKIGFPLLFLIYFYSHYLFASNTAHIGAMYPIFLAVSISLG
FT                   TNPIFAALTLAFASNLFGGLTHYGSGPAPLYFGSHLVTVQEWWRSGFALSIVNIVIWIG
FT                   IGSLWWKALGLI"
FT   gene            246360..248012
FT                   /locus_tag="CpB0212"
FT   CDS_pept        246360..248012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0212"
FT                   /product="pyrophosphate-dependent phosphofructokinase beta
FT                   subunit"
FT                   /note="similar to pyrophosphate-dependent
FT                   phosphofructokinase beta subunit - Citrus X paradisi"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98145"
FT                   /protein_id="AAP98145.1"
FT                   /translation="MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGV
FT                   KTLFPQTYHLPYLKFVQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSS
FT                   LVGFVNNGDGLTNNKSIDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEAL
FT                   DLDGLVIIGGDGSNTATAILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTAT
FT                   KFYSSIISNISRDALSCKAHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLP
FT                   LKTIIHKICSVIADRAAMEKYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLS
FT                   PESQRLLKSFPAPIIEQILNDRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAI
FT                   SHFLGYEGRSGLPTKFDNTYGYSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIP
FT                   VVKMFTVKQQADGTLQPKIKKYLVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPP
FT                   EMHSDNFPPLTLLLNHNFWQRHQGCIEIPDTTY"
FT   gene            248437..248682
FT                   /locus_tag="CpB0213"
FT   CDS_pept        248437..248682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98146"
FT                   /protein_id="AAP98146.1"
FT                   /translation="MKMETYSFSTELQKNTSLYIMEKLDSYFSFQGKRTRVIAITPAGL
FT                   AIAYEQNIHLSMTVKILKVLSFPRSLLRTTSLWYRP"
FT   gene            complement(248844..249791)
FT                   /locus_tag="CpB0214"
FT   CDS_pept        complement(248844..249791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98147"
FT                   /protein_id="AAP98147.1"
FT                   /translation="MLVELEALKREFAHLKDQKPTSDQEITSLYQCLDHLEFVLLGLGQ
FT                   DKFLKATEDEDVLFESQKAIDAWNALLTKARDVLGLGDIGAIYQTIEFLGAYLSKVNRR
FT                   AFCIASEIHFLKTAIRDLNAYYLLDFRWPLCKIEEFVDWGNDCVEIAKRKLCTFEKETK
FT                   ELNESLLREEHAMEKCSIQDLQRKLSDIIIELHDVSLFCFSKTPSQEEYQKDCLYQSRL
FT                   RYLLLLYEYTLLCKTSTDFQEQARAKEEFIREKFSLLELEKGIKQTKELEFAIAKSKLE
FT                   RGCLVMRKYEAAAKHSLDSMFEEETVKSPRKDTE"
FT   gene            complement(249867..250163)
FT                   /locus_tag="CpB0215"
FT   CDS_pept        complement(249867..250163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98148"
FT                   /protein_id="AAP98148.1"
FT                   /translation="MSYPDISNVQASSIQSALLHKTSDQIQQKRCFKQSTFVILAVSLV
FT                   IIGSLFLLAGVAILTVFSHGVLSLVFGVLGIVLGLLLLAGGVGLLVEEAKSLL"
FT   gene            complement(250292..251485)
FT                   /locus_tag="CpB0216"
FT   CDS_pept        complement(250292..251485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98149"
FT                   /protein_id="AAP98149.1"
FT                   /translation="MSYGVVVSIYSEILSFSELTSCKHSLFPFGPIETASIRIHHVFNV
FT                   VIVCLIILGTLFVCLGMVFLGVFSTYLLGMSSMILGLLLISIGLALLKFKERYGLEPKE
FT                   LFGVEGGFDKKLPSEIIQMQDQIADLARELDLEQKKDTLIRGFSARLDVLEGSKTEKKQ
FT                   ILKIGVPRNLSEIQERAQEQNSILEQCKEALLFRRKSAQEIFKKLYDRKAAFWRSYRED
FT                   LWCYSEIHVSKKALSNLYIGDVFEGTAPHFLMEAYAMCRTAKNLRNYVKVCVEDMRVNE
FT                   EKKRAKQLSVSELLCCCTEIETDLENETNLFTSDSEDVLEEYQIHCIRVTMLHALWAIY
FT                   NDEVVSRKPIDTLDRVRARMAVEDCIETFEELQMCVVHTKTLELEIAQLYVDILLEA"
FT   gene            complement(251521..251679)
FT                   /locus_tag="CpB0217"
FT   CDS_pept        complement(251521..251679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98150"
FT                   /protein_id="AAP98150.1"
FT                   /translation="MEERERSFLFSVFCFRELRVRLSSLISNSITTYFKRRISRIIELE
FT                   ERFVKKY"
FT   gene            complement(251857..253071)
FT                   /locus_tag="CpB0218"
FT   CDS_pept        complement(251857..253071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0218"
FT                   /product="transport protein USO1"
FT                   /note="similar to transport protein USO1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98151"
FT                   /protein_id="AAP98151.1"
FT                   /translation="MVVVALFILGIFFLSGSLAFLVHTSCGVLLGAALPILCIGLVLLA
FT                   VALIVFLCHKHKTRQDLDYYDQDLDSLVIHKKEIPNDISELRVTFEKLQNLFQFHTKDF
FT                   SDLSQELQGKFINCMEKWLTLEDEVTKFLIVRDRFLETRRNFTTFGEQVKGIQSNIFDL
FT                   HEEKSSLYLELYRLRKDLQVLLNFFLLPPGILKVDYDEIEAIKGLFIRLTSRLDKLDVK
FT                   AQERKKFINEMSREFKEVEKAFDIVDRATKKLMDRAKKESPARLFMGRTESLLEMKKNE
FT                   EALKNQGLDPENLSHPELFSPYQQLLILNYLNSEIVLHHYEFLISGTVTSGLTLEECEN
FT                   RMRAASTGLNALLVRKLQFRGAIKSAYFEKLTEIEKELRSLQDVIKSLELELIHKIKDI
FT                   VTEET"
FT   gene            complement(253170..254429)
FT                   /locus_tag="CpB0219"
FT   CDS_pept        complement(253170..254429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0219"
FT                   /product="mammalian coiled coil synaptonemal complex
FT                   protein"
FT                   /note="similar to mammalian coiled coil synaptonemal
FT                   complex protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98152"
FT                   /protein_id="AAP98152.1"
FT                   /translation="MSSAIARDCFPSPSPQPSSTLGVHPPKYKSLILSVSLIVLGVLLL
FT                   CVGMLLLVNAIFSFSVLTVGLGGAGVFLGSLLLILGLIFFVSYHRKLSEATRSLEQKIT
FT                   LEYQPWADLRKELNEVQEWSNFLLDEWEDFKEVVAQHKSQFATFEGDLLLFGREVEKYE
FT                   TIWKELDGRDVALLTELKNIWGPLEFLRKKGDRLQCEIDKLRKEVMKVGKSGLKLACEL
FT                   TKFKSALKDVKIEQECYRDKRKVEKLEVFPEGYRRELLEVLKTRLSVEKEIQLFEEVVS
FT                   AFEEKLASLHRTVFSEEELQEALDKAKAELLDIQVRKSVVEDLSCEPTLIQYHLLRLYE
FT                   VQCRIVEQFLTQTFSSEQEKVLEEYEALKARIRKTLRVKLDQVRANVAFVASTTDLLSE
FT                   SESLDGNDSVFEDAHDDFLD"
FT   gene            complement(254585..255022)
FT                   /locus_tag="CpB0220"
FT   CDS_pept        complement(254585..255022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98153"
FT                   /protein_id="AAP98153.1"
FT                   /translation="MNPVTFDRIQVDFIPEDTSLRINSYIVAGGLLILGVVLSILSVIC
FT                   LDIGLVGLSAGAAFTLGLGCLIFALFLFSFSLILLLSQEKRVPDVLSLYLEKEVPQYET
FT                   PLYKEDLESERDMSAISERLGIIEEKLRIAEKFRYSDSVFV"
FT   gene            255310..255996
FT                   /locus_tag="CpB0221"
FT   CDS_pept        255310..255996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98154"
FT                   /protein_id="AAP98154.1"
FT                   /translation="MKGFLSVNELIFGFQTFSVVVLGVFFASRGKAWLTGWLSLLSSIM
FT                   NVFVLKQIHLWGFEVTSADVYVIGLLTCLNYAREHYEKNDINDAMLCSWVISIAFLVLT
FT                   QLHLFLIPSPNDSSQEHFLALFSSTPRIVVASLVTLIFVQIVDIKLFTFLQRVFSKKYF
FT                   AMRSTISLLFSQLIDTIIFSFLGLYGLVSNLCDVMIFAMLVKGIVITLAIPTLTVTKAV
FT                   LDRRSS"
FT   gene            complement(255993..256562)
FT                   /locus_tag="CpB0222"
FT   CDS_pept        complement(255993..256562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98155"
FT                   /protein_id="AAP98155.1"
FT                   /translation="MGIFCFKKINLFKTFILMNNNVYLFCFLIFLSKKVFFESYEDFAN
FT                   VASSWPKSLRALVQGRYFVDSELKETPYRIHDFKKTPIHHRLYRSLPIISTIGGIIRLI
FT                   EAHSGPIHPRDKMKYRFEVLQAVIEILGLGVLILVFDIIGCFLAFLVAIILSLLLYCNS
FT                   TFTCVQNLSFTERMLEGIGEAVNFLA"
FT   gene            256771..257889
FT                   /locus_tag="CpB0223"
FT   CDS_pept        256771..257889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0223"
FT                   /product="queuine tRNA ribosyl transferase"
FT                   /note="similar to queuine tRNA ribosyl transferase -
FT                   Zymomonas mobilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98156"
FT                   /db_xref="GOA:Q9Z8W5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8W5"
FT                   /protein_id="AAP98156.1"
FT                   /translation="MALKFHLIHQSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGV
FT                   IDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFMGRQAPIITDSGGFQIFSLAYGSVA
FT                   EEIKSCGKKKGMSSLVKITDEGAWFKSYRDGRKLFLSPELSVQAQKDLGADIIIPLDEL
FT                   LPFHTDQEYFLTSCSRTYVWEKRSLEYHRKDPRHQSMYGVIHGGLDPEQRRIGVRFVED
FT                   EPFDGSAIGGSLGRNLQEMSEVVKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFD
FT                   SSYPTKAARHGLILSKAGPIKIGQQKYSQDSSTIDPSCSCLTCLSGISRAYLRHLFKVR
FT                   EPNAAIWASIHNLHHMQQVMKEIREAILKDEI"
FT   gene            258110..258655
FT                   /locus_tag="CpB0224"
FT   CDS_pept        258110..258655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98157"
FT                   /protein_id="AAP98157.1"
FT                   /translation="MSKESIRSYSEISTPTPIFRETPSKEGVAYKLQLRSPAKDCILRN
FT                   RVSLKGALLRSIPFYGSFLGAKRIHSAWSAKDAPCTTRVYHYLVGGLELLGLGVVVLAC
FT                   KVLATALKFLFSKASSKIKQMKWREKARNLAAKDTVQSIKEFCSVDLTSCFTRCFRLRN
FT                   RVVEEGASENQTVREIIV"
FT   gene            259071..259481
FT                   /locus_tag="CpB0225"
FT   CDS_pept        259071..259481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98158"
FT                   /protein_id="AAP98158.1"
FT                   /translation="MVNRYKSSAEFSADHYYDDNLVRMGYKRNLRGLAPVENEVCLFEE
FT                   NNLLESVMASIPIMGSILGLGRLHSVWSTQDPKDSKISIIFHTALGILETLGLGIIVLL
FT                   IKITITILLILFTPCLLCYFMYSAAYSDFHPI"
FT   gene            complement(259646..259837)
FT                   /locus_tag="CpB0226"
FT   CDS_pept        complement(259646..259837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98159"
FT                   /protein_id="AAP98159.1"
FT                   /translation="MFPCEREAFYARMFQTLMLVCRVLQVVRRIVCEIGAYGSQSSYTP
FT                   LLTGRELGELLVPYENHS"
FT   gene            259918..260259
FT                   /locus_tag="CpB0227"
FT   CDS_pept        259918..260259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0227"
FT                   /product="hypothetical protein"
FT                   /note="similar to 47.6K protein - Chlamydia psittaci phage
FT                   Chp1"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98160"
FT                   /protein_id="AAP98160.1"
FT                   /translation="MRELNAFELTQPEEYRNRWVLMPCLKCRFCRTQHAKVWSYRCVHE
FT                   ASLYEKNCFLTLTYDDKHLPQYGSLVKLHLQLFLKRLRKMISPHKIRYFECGAYGTKLQ
FT                   RPHYHLLLS"
FT   gene            260370..260750
FT                   /locus_tag="CpB0228"
FT   CDS_pept        260370..260750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98161"
FT                   /protein_id="AAP98161.1"
FT                   /translation="MLIGRYSSDDQFTEATKNTPTIIKLGFVRDNLEGLTNPISEIVSE
FT                   TSSSIKDSVLRSLPILGSILGCARLYSTLSTNDPLDETQEKIWHTIFGALETLGLGILI
FT                   LLFKIIFVILHCIFHLVIGFCK"
FT   gene            260849..261091
FT                   /locus_tag="CpB0229"
FT   CDS_pept        260849..261091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0229"
FT                   /product="major adhesion protein"
FT                   /note="similar to major adhesion protein MgPa gene -
FT                   Mycoplasma genitalium"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98162"
FT                   /protein_id="AAP98162.1"
FT                   /translation="MKPNSIIFLENTKHYPDIFREGFVRDRHGLMEASDWLLSTEITII
FT                   RSILGAIPILGNILGAGRLYSVWYTSDEDWKKQVV"
FT   gene            261070..261240
FT                   /locus_tag="CpB0230"
FT   CDS_pept        261070..261240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98163"
FT                   /protein_id="AAP98163.1"
FT                   /translation="MEKTSGLTHDIWNPRSSWPWDSCFSIKDSPNHHLLLATRPLERFL
FT                   YAYRDLFRTGP"
FT   gene            261287..261958
FT                   /locus_tag="CpB0231"
FT   CDS_pept        261287..261958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98164"
FT                   /protein_id="AAP98164.1"
FT                   /translation="MTKNAINSQTTTPQPNLTDAEPIASRAQCKSIAVIISLFALGMLL
FT                   LCLGIILISIPIPGLAAQVALGLGIVSLILGIALANIGFLCLLLRCKQVPQKPDTLPSE
FT                   SSKQPSEGSTPTALPWQAGEFLEKVQVSATPILLPKNKDEELSAKVMKEGAEAASSIKQ
FT                   AVLESTEKLIDARKQEESRREARKKIVAEEAEASRKRIQQQMAADQEALRKRKEEVAKR
FT                   K"
FT   gene            261980..262384
FT                   /locus_tag="CpB0232"
FT   CDS_pept        261980..262384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98165"
FT                   /protein_id="AAP98165.1"
FT                   /translation="MPYYANTLEFIQGTQSLCPLFKYGFVRHHYKGQLEIEDASHDWDF
FT                   LEPPSTWKRTLLAAIPILGSVIGLGRLFSIWSIREPQDSQEYKSIFWHTLCAVLEILGL
FT                   GIVALILKILATFIMAMPGLKRVATFLFYS"
FT   gene            complement(262420..262833)
FT                   /locus_tag="CpB0233"
FT   CDS_pept        complement(262420..262833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0233"
FT                   /product="putative protein-disulfide oxidoreductase"
FT                   /note="similar to probable protein-disulfide oxidoreductase
FT                   - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98166"
FT                   /db_xref="GOA:Q9Z8V7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8V7"
FT                   /protein_id="AAP98166.1"
FT                   /translation="MMINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRI
FT                   CLFPLTVILGISAYREDSSIKLYILPQAVLGLGISIYQVFLQEIPGMQLDICGRVSCST
FT                   KIFLFSYVTIPMASVVAFGAIVCLLVLTKKYRG"
FT   gene            complement(262823..263524)
FT                   /locus_tag="CpB0234"
FT   CDS_pept        complement(262823..263524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0234"
FT                   /product="putative disulfide bond chaperone"
FT                   /note="similar to probable disulfide bond chaperone -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98167"
FT                   /protein_id="AAP98167.1"
FT                   /translation="MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTI
FT                   GNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHYIDTGEISFTLIPVCFIRGSKPAAQ
FT                   ALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRSVNP
FT                   KGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIR
FT                   QLQAVEGDHDD"
FT   gene            263598..264977
FT                   /locus_tag="CpB0235"
FT   CDS_pept        263598..264977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0235"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT178 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98168"
FT                   /protein_id="AAP98168.1"
FT                   /translation="MRIEQENFSFKFKKSALSFTYNTANLTKSTFTFILLLLLRKKDQG
FT                   LRFMDKETLENIYRHFRYRFLKLNILPAFLGLLLLCSPNTLNYTQVDVIFSDRLCSCLL
FT                   IFLAIASLTKRSLLWLGAPLGIWVTLFACVAGRSPTIFANDTLIGFAILAVVCISPTRP
FT                   EALEVGPTLPEGFSYNPSAGGRRAAVLFLSLLGWLEARYLTASSLGITSSQSSNFLLLY
FT                   SSIMTVYSLLVVLSLAGSERRWHTRPKIVIATALALTGVIILTLLPIILHQLRYDCWLC
FT                   LCLTIEPALAVVFAYDETRATLRYISQFLGDKRALTRASFFGSEYYKHTLSWEERTVLP
FT                   LRKAYKQAFEGISFPINQLLAILVATVFVKVNSSMGLPTFPRNFLNICCWFIIVLFILA
FT                   FAESLRHLRWMNLIFSAAILFSPVLFHIPVESPMFLPIIVTGLILIILSIGKRRRTKRK
FT                   L"
FT   gene            complement(264987..265667)
FT                   /locus_tag="CpB0236"
FT   CDS_pept        complement(264987..265667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0236"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT179 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98169"
FT                   /protein_id="AAP98169.1"
FT                   /translation="MSSQPLVTTSSSLSRYVVLTGEEKVACYKKAFNHIWHGAPAIILA
FT                   AALLMFCIFGFVLGSILLGAPLEGASILYDVILPWLLPSILVFVLLVLPLNIYAYSHHK
FT                   QVLALHERITQSNYKEIYDHCEKEKKTPNKKALSLYIESQVLVPEYSKRFSSMILGKTL
FT                   KIIPKKDSPESLKHDELIQKALERAKENIYMNKNQREKRDEREAKKEAKNASKTNPLWE
FT                   GLGT"
FT   gene            complement(265664..266371)
FT                   /locus_tag="CpB0237"
FT   CDS_pept        complement(265664..266371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0237"
FT                   /product="ATP-binding cassette-transport protein"
FT                   /note="similar to ATP-binding cassette-transport protein -
FT                   Mycobacterium smegmatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98170"
FT                   /protein_id="AAP98170.1"
FT                   /translation="MLQAHRLCYSCDNQVILKDASFQASPGTITIILGSSGVGKTTLFR
FT                   LLAGFLPLQEGELLWNGSPLNRKDVAYMQQKEALLPWRTALKNMTLSTELGINTSHNAL
FT                   SNERLEEIIHNFDLGQLLDRYPDELSGGQRQRIALAAQCLSLKPILLLDEPFSSLDVLL
FT                   KEQLYQDIVALAKKENKTVLLVTHDFHDVSCLGDVLYVIKNKTLTPVPLDPSMRPLNNG
FT                   LCFIKDLKKHLYT"
FT   gene            complement(266407..266480)
FT                   /locus_tag="CpBt07"
FT   tRNA            complement(266407..266480)
FT                   /locus_tag="CpBt07"
FT                   /product="tRNA-Ile"
FT                   /note="GAT"
FT   gene            complement(266485..266557)
FT                   /locus_tag="CpBt08"
FT   tRNA            complement(266485..266557)
FT                   /locus_tag="CpBt08"
FT                   /product="tRNA-Ala"
FT                   /note="TGC"
FT   gene            complement(266643..267536)
FT                   /locus_tag="CpB0238"
FT   CDS_pept        complement(266643..267536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0238"
FT                   /product="pfs protein"
FT                   /note="similar to pfs protein - Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98171"
FT                   /protein_id="AAP98171.1"
FT                   /translation="MRRFLFLILSSLPLVAFSADNFTILEEKQSPLSRVSIIFALPGVT
FT                   PVSFDGNCPIPWFSHSKKTLEGQRIYYSGDSFGKYFVVSALWPNKVSSAVVACNMILKH
FT                   RVDLILIIGSCYSRSQDSRFGSVLVSKGYINYDADVRPFFERFEIPDIKKSVFATSEVH
FT                   REAILRGGEEFISTHKQEIEELLKTHGYLKSTTKTEHTLMEGLVATGESFAMSRNYFLS
FT                   LQKLYPEIHGFDSVSGAVSQVCYEYSIPCLGVNILLPHPLESRSNEDWKHLQSEASKIY
FT                   MDTLLKSVLKELCSSH"
FT   gene            complement(267659..267832)
FT                   /locus_tag="CpB0239"
FT   CDS_pept        complement(267659..267832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98172"
FT                   /protein_id="AAP98172.1"
FT                   /translation="MGKVLLFLLRISRRSYVQEIGIFFHLETPDLKIVLCAFVSTFIVV
FT                   EMDVSLKNKGQS"
FT   gene            complement(267959..268654)
FT                   /locus_tag="CpB0240"
FT   CDS_pept        complement(267959..268654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0240"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT181 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98173"
FT                   /protein_id="AAP98173.1"
FT                   /translation="MLQSCKKALLSIVVSILAFHPIPGMGVEAKSGFLGKVKGWFSKKE
FT                   IQEEARILPVKDSLSWKRYDYTSSSGFSVEFPGEPDHSGQIVEVPQSEITIRYDTYVTE
FT                   THPDNTVYVVSVWEYPEKVDISRPELNLQEGFSGMMQALPESQVLFMQARQIQGHKALE
FT                   FWIVCEDVYFRGMLISVNHTLYQVFMVYKNKNPQALDKEYEAFSQSFKITKIREPRTIP
FT                   SSVKKKVSL"
FT   gene            268830..269594
FT                   /locus_tag="CpB0241"
FT   CDS_pept        268830..269594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0241"
FT                   /product="CMP-2-keto-3-deoxyoctulosonic acid synthetase"
FT                   /note="similar to CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98174"
FT                   /db_xref="GOA:Q9Z8U9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U9"
FT                   /protein_id="AAP98174.1"
FT                   /translation="MKPEESECLCIGVLPARWNSSRYPGKPLAKIHGKSLIQRTYENAS
FT                   QSSLLDKIVVATDDQHIIDHVTDFGGYAVMTSPTCSNGTERTGEVARKYFPKAEIIVNI
FT                   QGDEPCLNSEVVDALVQKLRSSPEAELVTPVALTTDREEILTEKKVKCVFDSEGRALYF
FT                   SRSPIPFILKKATPVYLHIGVYAFKREALFRYLQHSSTPLSDAEDLEQLRFLEHGGKIH
FT                   VCIVDAKSPSVDYPEDIAKVEQYITCLSNAYF"
FT   gene            269570..271183
FT                   /locus_tag="CpB0242"
FT   CDS_pept        269570..271183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0242"
FT                   /product="CTP synthetase"
FT                   /note="similar to CTP synthetase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98175"
FT                   /db_xref="GOA:Q9Z8U8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U8"
FT                   /protein_id="AAP98175.1"
FT                   /translation="MPFKCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYL
FT                   NVDPGTMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVIKRER
FT                   EGDYLGSTVQVIPHITNEIIQVILDAAKEHSPDVLIVEIGGTIGDIESLPFLEAIRQFR
FT                   YDHSEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLRGIGIIPDAILCRSEKPLTQEVK
FT                   SKISLFCNVPNRAVFNVIDVKHTIYEMPLMLAQEKIANFIGEKLKLATVPENLDDWKVL
FT                   VNQLSQDLPKVKIGVVGKYVQHRDAYKSIFEALTHAALRLGHAAEIIPIDAEDENLTME
FT                   LSQCDACLVPGGFGVRGWEGKIAAAKFCREQGIPYFGICLGMQVLVVEYARNVLNLDQA
FT                   NSLEMDPNTPHPIVYVMEGQDPLVATGGTMRLGAYPCLLKPGSKAHKAYNESSLIQERH
FT                   RHRYEVNPDYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWMIGVQFHPEFVSKLISPH
FT                   PLFIAFIEAALVYSKDASHV"
FT   gene            271176..271631
FT                   /locus_tag="CpB0243"
FT   CDS_pept        271176..271631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0243"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yggf - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98176"
FT                   /db_xref="GOA:Q9Z8U7"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U7"
FT                   /protein_id="AAP98176.1"
FT                   /translation="MSKPSSCKAYLGIDYGKKRIGLAYAAEPLLLTLPIGNIEAGKNLK
FT                   LSAEALHKIILSRNITCVVLGNPLPMQKGLYSSLQEEVSLLAEELKKLSTVEIILWDER
FT                   LSSVQAERMLKQDCGLSRKDRKGKTDSLAATLILTSFLDSLPKKLTL"
FT   gene            271717..273255
FT                   /locus_tag="CpB0244"
FT   CDS_pept        271717..273255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0244"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /note="similar to glucose-6-phosphate 1-dehydrogenase -
FT                   Synechococcus sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98177"
FT                   /db_xref="GOA:Q9Z8U6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U6"
FT                   /protein_id="AAP98177.1"
FT                   /translation="MTNVVQETIGGLNSPRTCPPCILVIFGATGDLTARKLLPALYHLT
FT                   KEGRLSDQFVCVGFARREKSNELFRQEMKQAVIQFSPSELDIKVWEDFQQRLFYHRSEF
FT                   DNNMGYTSLKDSLEDLDKTYGTRGNRLFYLSTPPQYFSRIIENLNKHKLFYKNQDQGKP
FT                   WSRVIIEKPFGRDLDSAKQLQQCINENLNENSVYHIDHYLGKETVQNILTTRFANTIFE
FT                   SCWNSQYIDHVQISLSETIGIGSRGNFFEKSGMLRDMVQNHMMQLLCLLTMEPPTTFDA
FT                   DEIRKEKIKILQRISPFSEGSSIVRGQYGPGTVQGVSVLGYREEENVDKDSRVETYVAL
FT                   KTVINNPRWLGVPFYLRAGKRLAKKSTDISIIFKKSPYNLFAAEECSRCPIENDLLIIR
FT                   IQPDEGVALKFNCKVPGTNNIVRPVKMDFRYDSYFQTTTPEAYERLLCDCIIGDRTLFT
FT                   GGDEVMASWKLFTPVLEEWDQDSSPSFPNYPAGSSGPKEADALIERDGRSWRPL"
FT   gene            273289..274089
FT                   /locus_tag="CpB0245"
FT   CDS_pept        273289..274089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0245"
FT                   /product="glucose 1-dehydrogenase"
FT                   /note="similar to glucose 1-dehydrogenase - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98178"
FT                   /db_xref="GOA:Q9Z8U5"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U5"
FT                   /protein_id="AAP98178.1"
FT                   /translation="MTNIGIETMATLINFNDTNKLLLTKQPSLFIDLASKDWIASANQA
FT                   IKQRGAFYVALSGGKTPLEIYKDIVINKDKLIDPSKIFLFWGDERLAPITSSESNYGQA
FT                   MSILRDLNIPDEQIFRMETENPDGAKKYQELIENKIPDASFDMIMLGLGEDGHTLSLFS
FT                   NTSALEEENDLVVFNSVPHLETERMTLTFPCVHKGKHVVVYVQGENKKPILKSVFFSEG
FT                   REEKLYPIERVGRDRSPLFWIISPESYDIADFDNISSIYKMDIL"
FT   gene            complement(274109..275275)
FT                   /locus_tag="CpB0246"
FT   CDS_pept        complement(274109..275275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98179"
FT                   /protein_id="AAP98179.1"
FT                   /translation="MVYFMVFSPSSESVVKANSVVRSNFCYFLENKFVSPSESTEVMFS
FT                   EIMKGRVPDIESLFDRPTDMMMTGFKAAQNLGNLFNSFGILIMCFSQCKSCQTPEKETS
FT                   AIVLGATLLFFVIALILGPTLGALVYCAYKVYTLGKMIYSLNKAKAKVLRHPAQNVFHR
FT                   AAGVATIRSSEEAVKACKLYKSAMIGSLVVSLIASLALIALTAGIVLVLFFVAPGAAPV
FT                   ITAAMMGCCAAGGGALLISLLGLWIAIVRKAKHQEACVGHLTNVVLHTAVSEALLHDPS
FT                   HFQTNALARDLFLTDCLSHYGHLFSNEEVAQLVQGGAPGGGSRPSQHYGGSSDYQNRRG
FT                   GNGNFGGSHFGGGGGFAGSHFGAGYPTAPTMPSAPPPFPPPAYDTIYG"
FT   gene            complement(275614..276780)
FT                   /locus_tag="CpB0247"
FT   CDS_pept        complement(275614..276780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98180"
FT                   /protein_id="AAP98180.1"
FT                   /translation="MVKFMSAMISLSSSHEASIASNTQVRDVLVSLAMDEFVEHNTEIL
FT                   PIKVFLARGTLSSTAIIDDLKDVVETEGEHHFQVYSNISLKMIYQRFFEKIFGIGCCPL
FT                   LLVTDSHHTDPCGALITGIFAAVLFTVLAIVFGPTLGILCYSAYKIYQLTKKISSLSRT
FT                   HTEVINSVQKSDPFIHRSGAVAAAAASQSTIKACKVFRQSTLIFFVLGLIITISLAALI
FT                   VGLVFALFFLDPGAPAVMTAAMIGCCAAGGTGILLSVIGFLLASVYSVQKSQEGVHHMH
FT                   TALLRCIVSNTIIQMPYLPITPGTKKVLTQSIRRYQQFFSDDEYRDIESEVPLNRQTTP
FT                   PPSYETLFHEEGSDGSSNVIPRESPPAYSTIDSSNSPFPSSSPPPYYR"
FT   gene            complement(276898..277332)
FT                   /locus_tag="CpB0248"
FT   CDS_pept        complement(276898..277332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98181"
FT                   /protein_id="AAP98181.1"
FT                   /translation="MACSIFFRMSQGDYDDEPLSKKTACLVVDTMLYPVIAVVCAVVSV
FT                   VLLILKVLFLLLSFPFKLCSASSALPGERVSLGSHFKCLYGGGLPYLLACLLIVPVIGT
FT                   AIHGFIISHRTSEDARLSSAIVFMQAPILQLAGMSGLIKP"
FT   gene            complement(277544..277969)
FT                   /locus_tag="CpB0249"
FT   CDS_pept        complement(277544..277969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98182"
FT                   /protein_id="AAP98182.1"
FT                   /translation="MACSIGYHLCNANEPDRFVASKVALVADILLYPFMAVICAVVFAV
FT                   LMVVKLLFLAIKFLVNTCIAACKSRPLPSCKENFQCLFGPKDKPGPSDWLGCLVLIPII
FT                   GTLIYSTIITVQSDTNRLRYFIISPAYQVGSTAIINW"
FT   gene            278100..278339
FT                   /locus_tag="CpB0250"
FT   CDS_pept        278100..278339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98183"
FT                   /protein_id="AAP98183.1"
FT                   /translation="MFFYIYSILKRYIVVLGKILGLITIQFYQNLGGMSSERYSALHSR
FT                   KSLSVLPHVVRKVLLSFPDFRGNGDVNLRSIRSD"
FT   gene            278332..278973
FT                   /locus_tag="CpB0251"
FT   CDS_pept        278332..278973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0251"
FT                   /product="adenylate kinase"
FT                   /note="similar to adenylate kinase - Bacillus
FT                   stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98184"
FT                   /db_xref="GOA:Q9Z8U0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8U0"
FT                   /protein_id="AAP98184.1"
FT                   /translation="MTKGSVFIIMGPPGSGKGTQSQYLANRIGLPHISTGDLLRAIIRE
FT                   GTPNGLKAKAYLDKGAFVPSDFVWEILKEKLQSQACSKGCIIDGFPRTLDQAHLLDSFL
FT                   MDVHSNYTVIFLEISEDEILKRVCSRFLCPSCSRIYNTSQGHTECPDCHVPLIRRSDDT
FT                   PEIIKERLTKYQERTAPVIAYYDSLGKLCRVSSENKEDLVFEDILKCIYK"
FT   gene            279059..279916
FT                   /locus_tag="CpB0252"
FT   CDS_pept        279059..279916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0252"
FT                   /product="p60 precursor"
FT                   /note="similar to Listeria seeligeri p60 precursor;
FT                   invasion-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98185"
FT                   /protein_id="AAP98185.1"
FT                   /translation="MKHYLSFSPSADFFSKQGAIETQVLFGERVLVKGSTCYAYSQLFH
FT                   NELLWKPYPGHSFRSTLVPCTPEFHIHPNVSVVSVDAFLDPWGIPLPFGTLLHVNSQNT
FT                   VIFPKDILNHMNTIWGSGTPQCDPRHLRRLNYNFFAELLIKDADLLLNFPYVWGGRSVH
FT                   ESLEKPGVDCSGFINILYQAQGYNVPRNAADQYADCHWISSFENLPSGGLIFLYPKEEK
FT                   RISHVMLKQDSSTLIHASGGGKKVEYFILEQDGKFLDSTYLFFRNNQRGRAFFGIPRKR
FT                   KAFL"
FT   gene            complement(279962..280366)
FT                   /locus_tag="CpB0253"
FT   CDS_pept        complement(279962..280366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0253"
FT                   /product="ribosomal protein S9"
FT                   /note="similar to ribosomal protein S9 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98186"
FT                   /db_xref="GOA:Q9Z8T8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T8"
FT                   /protein_id="AAP98186.1"
FT                   /translation="MAKSTIQESVATGRRKQAVSSVRLRPGSGKIDVNGKSFEDYFPLE
FT                   IQRTTILSPLKKITEDQSQYDLIIRVSGGGIQGQVIATRLGLARALLKENEENRQDLKS
FT                   CGFLTRDPRKKERKKYGHKKARKSFQFSKR"
FT   gene            complement(280380..280829)
FT                   /locus_tag="CpB0254"
FT   CDS_pept        complement(280380..280829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0254"
FT                   /product="ribosomal protein L13"
FT                   /note="similar to ribosomal protein L13 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98187"
FT                   /db_xref="GOA:Q9Z8T7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T7"
FT                   /protein_id="AAP98187.1"
FT                   /translation="MEKRKDTKTTIVKSSETTKSWYVVDAAGKTLGRLSSEVAKILRGK
FT                   HKVTYTPHVAMGDGVIVINAEKVRLTGAKKGQKIYRYYTGYISGMREIPFENMMARKPN
FT                   YIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYETFESQKPILLDI"
FT   gene            complement(281061..281741)
FT                   /locus_tag="CpB0255"
FT   CDS_pept        complement(281061..281741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0255"
FT                   /product="ABC transporter ATPase"
FT                   /note="similar to ABC transporter ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98188"
FT                   /protein_id="AAP98188.1"
FT                   /translation="MSLLIEAKNLSKTIQQQNQNISILTDVSLSLHAGETISITGASGN
FT                   GKTTLLHLLGTLDVPSSGSLRFFDKDLKNQDLANFRNQHIGFVFQNFYLLEDDTVLKNV
FT                   LMPALIARKNISKGSPVYTRALELLDLVNLEDKVRTRCSKLSGGEKQRVAIARALINEP
FT                   AILLADEPSGNLDEETSEQIHNLLLEQASALCGILIVTHNKHLASRCSREGVLSNGKLF
FT                   FHNS"
FT   gene            complement(281744..283255)
FT                   /locus_tag="CpB0256"
FT   CDS_pept        complement(281744..283255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0256"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT151 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98189"
FT                   /protein_id="AAP98189.1"
FT                   /translation="MKFEFSVALKYLIPGRGRLYSAIVSLFSVGIISLVVWLSIVFISV
FT                   IHGLEQRWIEDLSQLHSPITILPSDTYYSSYYYQIDKHSSLSNYTTKTLGEKIASPQVD
FT                   PYDPESDYLLPETFPLKDCDLGGQQKDPVKMTLESLGPYLQSQHGKVIEFEQGVGYLDI
FT                   KTSLKLQKPQPRNLTHFLTYPSKLSYEDKVLPYDETDYTSAELNPFNRSPSGWQQDFHH
FT                   LEELYRGASIILPSTYKDSGYKVGDTGVFSTYSIENEKETQYTVHVIGFYNPGLSPLGG
FT                   RTVFIDPDLARSIRSQSEGLGMSNGFHLFFPDTKRIVFVKKQIENILTSLGVDDYWEIS
FT                   SLHDYDYFQPILDQLQSDQVLFLFVCILILIVACSNIVTMSMLLVNNKKKEIGILKAMG
FT                   TSSRSLKIIFACCGAFSGACGVVIGTIFAIITLKNLQFIVKALNYLQGRETFNTAFFGQ
FT                   NLPNSVHPQAIYFLGLGTLLLAAVSGALPARKVAKMHVSEILKAD"
FT   gene            complement(283313..283471)
FT                   /locus_tag="CpB0257"
FT   CDS_pept        complement(283313..283471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0257"
FT                   /product="ribosomal protein L33"
FT                   /note="similar to ribosomal protein L33 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98190"
FT                   /db_xref="GOA:Q9Z8T4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T4"
FT                   /protein_id="AAP98190.1"
FT                   /translation="MASKNREIIKLKSSESSDMYWTVKNKRKTTGRLELKKYDRKLRRH
FT                   VIFKEAR"
FT   gene            283474..284976
FT                   /locus_tag="CpB0258"
FT   CDS_pept        283474..284976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0258"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein aq_849 - Aquifex
FT                   aeolicus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98191"
FT                   /db_xref="GOA:Q9Z8T3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8T3"
FT                   /protein_id="AAP98191.1"
FT                   /translation="MSPFKKIVNRLLCYISFQKESRTLPIIIREPRMTTKSLGSFNSVI
FT                   SKNKIHFISLGCSRNLVDSEVMLGILLKAGYESTNEIEDADYLILNTCAFLKSARDEAK
FT                   DYLDHLIDVKKENAKIIVTGCMTSNHKDELKPWMSHIHYLLGSGDVENILSAIESRESG
FT                   EKISAKSYIEMGEVPRQLSTPKHYAYLKVAEGCRKRCAFCIIPSIKGKLRSKPLDQILK
FT                   EFRILVNKSVKEIILIAQDLGDYGKDLSTDRSSQLESLLHELLKEPGDYWLRMLYLYPD
FT                   EVSDGIIDLMQSNPKLLPYVDIPLQHINDRILKQMRRTTSREQILGFLEKLRAKVPQVY
FT                   IRSSVIVGFPGETQEEFQELADFIGEGWIDNLGIFLYSQEANTPAAELPDQIPEKVKES
FT                   RLKILSQIQKRNVDKHNQKLIGEKIEAVIDNYHPETNLLLTARFYGQAPEVDPCIIVNE
FT                   AKLVSHFGERCFIEITGTAGYDLVGRVVKKSQNQALLKTSKA"
FT   gene            complement(284987..285499)
FT                   /locus_tag="CpB0259"
FT   CDS_pept        complement(284987..285499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0259"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT144 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98192"
FT                   /protein_id="AAP98192.1"
FT                   /translation="MLQTYQSHDDAASCSFRRACRFGRYWLGGVNVPWNKFNQTSTQST
FT                   VINSAIYIDSSQTWMMRFQASASIPRLFRISIFMTKHGDWIDNGTGGELLLVAYEANQN
FT                   PLFPDIRIELAMSTCSGTSYYRARPMQWLCSTYYAVRPGYFVLENRSYSFRVQSFSWNI
FT                   ATLPFVN"
FT   gene            complement(285361..285870)
FT                   /locus_tag="CpB0260"
FT   CDS_pept        complement(285361..285870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0260"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT144 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98193"
FT                   /protein_id="AAP98193.1"
FT                   /translation="MSSSIPTTQKITISIPTFVRFNIESINLTDEQKKTALTIGQNIAT
FT                   ENTQVLGNFVDADGGLICQNDLSVGGNINITPQTFNTMVFNGRVNLSNSPFSYQDSLGN
FT                   KRQDYANINTEQPQQYVPYGYYKLTRVMMMQRAALSGGHVGSGDIGWGESMYLGISSIK
FT                   RQHKVQ"
FT   gene            complement(285870..286676)
FT                   /locus_tag="CpB0261"
FT   CDS_pept        complement(285870..286676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0261"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT143 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98194"
FT                   /protein_id="AAP98194.1"
FT                   /translation="MKTLGVKDQNLFIDQATLSVERNVRIENNLETRDLKVLDTTTSPC
FT                   EFIVKGNVSAEGSQLNATTLSDGFNIYSKTDVSQTPVCNNISDPQSARDALTFSYYRKT
FT                   GCQAANLYTYYPGNGYYVAPNTTIETHVAAITSKSVSRNATPDFSRYADIEPVVKLKQV
FT                   GIYQVTMQLTRWSGQHDGDNSATLILNFVSGNNKTLLCTSDTRGGYSSDRTSVAVTAIF
FT                   SVTELVSSPPYDYPWINLESTIWMNLMSLSTCVIWFPFPSNFVEVD"
FT   gene            complement(286740..287579)
FT                   /locus_tag="CpB0262"
FT   CDS_pept        complement(286740..287579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0262"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT142 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98195"
FT                   /protein_id="AAP98195.1"
FT                   /translation="MKNNINNNECYFKLDSTVDGDLLAANLKTFDTQAQGISSTETFSV
FT                   QGNATFKDQVSATGLTSGTTYNLNAQNFTSSQISIDFKNNRLSNCALPKEDCDPVPANY
FT                   VRSPEYFFCSKPLIGDFDFNSGESYLPLTGSEYTLYQSRNVNSIFRFIGWKQSTRELTV
FT                   GGNTAIQFLAAGTYIVSFTVGKRWGWNNRWGGAIYINNGLGQVQCESTIYSGGGYATIG
FT                   TLGTSIYRASVDVAPNPNDPNASDRYRAGIFYLSNGGSSAGIGNYSFSLLYYPDDRG"
FT   gene            complement(287809..288678)
FT                   /locus_tag="CpB0263"
FT   CDS_pept        complement(287809..288678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0263"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT144 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98196"
FT                   /protein_id="AAP98196.1"
FT                   /translation="MSNPTPKTKISIPTFVRFNIQSINLTEDQKKTTFTVGGKVTTENT
FT                   VVRGDLTCTDGGLTCQSDLTIQKDINIRPTSTNSMVFDGRLNLSNSPLSYKNSQGQDIT
FT                   DYEKMSSGKPQEYVPFGYYKRTQIMMAQRAAHSSGYVGGGSVPSGSYVPWNKFDQTSTQ
FT                   KTSGTEIYIDPNDSTKLVFEVNNKVPKLFRISVIMAKHGSWLDNGTGADILLAANEYEQ
FT                   GGGRINVTDLAMTTSRGSSYYETRPLQVVCVTYYAQNNGYFTFQNRAGGGLRVSFFSWN
FT                   IVALPYVE"
FT   gene            complement(288678..289541)
FT                   /locus_tag="CpB0264"
FT   CDS_pept        complement(288678..289541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0264"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT143 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98197"
FT                   /protein_id="AAP98197.1"
FT                   /translation="MKRRNLQKILPNASTPSTNVAENTGIKDQNLFLDQATLNVDGNVD
FT                   IENFLETRDLKVADTITSPCEFTVGGGLSAESSQFKATTLSKGLEITSEDQDGRVPKFT
FT                   NVSDPQSPRDALTYNYYRNTGCQALNLYTYYSSSQPTTVGKPIETVCQNPNPETYRISA
FT                   SAKIYDAVTRFPYIQFKAPGIYQVTIQIRRESGQHSGLDNPNLYLNLMIGNNKTLLCAS
FT                   DTRGYSGGHRTSIAVTGTFTLTEIVATPPHDYPWLFLETTIGLDIKSMSTCVIWFPFQA
FT                   NFAEVD"
FT   gene            complement(289852..290400)
FT                   /locus_tag="CpB0265"
FT   CDS_pept        complement(289852..290400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0265"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT142 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98198"
FT                   /protein_id="AAP98198.1"
FT                   /translation="MTTTNNQDNNECYFKLDSTVDGDLLASNIQTFDKQAKGISSTETF
FT                   SVQGNATFKEKVSATGLTSASTYKLNATGPAPSSITIDMKNNRLSNPALPKNPCDPVPA
FT                   NYVRSPQYFFCAKPIEGTFMFDGSSRYLPITGDGSNYTLYQSSKAGDVFRFVDWDQNSK
FT                   KLHLGGTQPYNFLLQEPIS"
FT   gene            complement(290547..290711)
FT                   /locus_tag="CpB0266"
FT   CDS_pept        complement(290547..290711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0266"
FT                   /product="pEARLI 4"
FT                   /note="similar to pEARLI 4 - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98199"
FT                   /protein_id="AAP98199.1"
FT                   /translation="MNSQGSYIKLITIGNAFHELSSHSFYLINSLRKCKKLFGFGERTF
FT                   ELKVPNLNR"
FT   gene            complement(290732..290814)
FT                   /locus_tag="CpBt09"
FT   tRNA            complement(290732..290814)
FT                   /locus_tag="CpBt09"
FT                   /product="tRNA-Tyr"
FT                   /note="GTA"
FT   gene            complement(290820..290892)
FT                   /locus_tag="CpBt10"
FT   tRNA            complement(290820..290892)
FT                   /locus_tag="CpBt10"
FT                   /product="tRNA-Thr"
FT                   /note="TGT"
FT   gene            complement(290959..291474)
FT                   /locus_tag="CpB0267"
FT   CDS_pept        complement(290959..291474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0267"
FT                   /product="YecA"
FT                   /note="similar to YecA - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98200"
FT                   /protein_id="AAP98200.1"
FT                   /translation="MEEDHVSKKINRNDLCPCGSNKKYKQCCLKKEEQTARYTTEGKFK
FT                   FSAEVLSASEQGEAGDNCTKLFQRLSQSLTSEQKAAVGKFHQITKNKEVMSKKALKKAQ
FT                   AKEEKLVTEKLQQHNFEILNTGENLAPPMESTATLNQDTNFVCEDFIPTQEDFRISENS
FT                   QKPPVEED"
FT   gene            291716..292450
FT                   /locus_tag="CpB0268"
FT   CDS_pept        291716..292450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0268"
FT                   /product="YdaO"
FT                   /note="similar to ydaO protein - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98201"
FT                   /protein_id="AAP98201.1"
FT                   /translation="MSTLLLNPPWMKAGKRIESLVRKALYTHTMLANHRKIVVALSGGK
FT                   DSLTLLLMLKAISGRGFPDLDLHAVNIGGKYSCGAEVNKPYLTRICDQLCIPFRTIPSP
FT                   YAPETPECYPCSQARRRLLFQAAKEIGASAIAFGHHRDDLVQTALLNLLHKAEFAGMLP
FT                   VLDMVHFGVTILRPLIFTPEFWIRKFAKENGFARVTCRCPVVSLRSKAEQSLKLLEEVF
FT                   PLARHNIALAIQEHGSSKSQKI"
FT   gene            292505..293350
FT                   /gene="surE"
FT                   /locus_tag="CpB0269"
FT   CDS_pept        292505..293350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="CpB0269"
FT                   /product="stationary-phase survival protein"
FT                   /note="similar to stationary-phase survival protein SurE -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98202"
FT                   /db_xref="GOA:Q9Z8S6"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8S6"
FT                   /protein_id="AAP98202.1"
FT                   /translation="MVLMNKRLKIILTNDDGITAKGMSCLVSALLEANIGDIYIAAPQA
FT                   EQSGKSMAISLNQVVCASPYAYPQPVKEAWAVGGSPTDCVRLGLRTLFESVSPDLVISG
FT                   INCGNNICKNAWYSGTIGAAKQALVDGIPSMALSQDNHISFFQQDKAPEILKALVIYLL
FT                   SQPFPCLTGLNINFPTSPGGSSWEGMRLVPPGDEFFYEEPQYLGSVNKNQYYVGKISGV
FT                   RIGEHPSEELACMLENHISVSPIFSQNSPIGLMTLEEFQKTQENFNASLLSSELTTKIF
FT                   "
FT   gene            293490..293562
FT                   /locus_tag="CpBt11"
FT   tRNA            293490..293562
FT                   /locus_tag="CpBt11"
FT                   /product="tRNA-Val"
FT                   /note="TAC"
FT   gene            293566..293639
FT                   /locus_tag="CpBt12"
FT   tRNA            293566..293639
FT                   /locus_tag="CpBt12"
FT                   /product="tRNA-Asp"
FT                   /note="GTC"
FT   gene            293663..294553
FT                   /locus_tag="CpB0270"
FT   CDS_pept        293663..294553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0270"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yqfU - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98203"
FT                   /protein_id="AAP98203.1"
FT                   /translation="MSHGPRPTKFSFPLYFSKTLSWFILGGFLAACGVQMVLVPNELID
FT                   GGIVGLSIIASHFLGHKALPFCLVLFNLPFVFLAFKQIGKYFVIQMLTAVIIFSCSLWL
FT                   IDQLPSWLGMSPFVFKGSEMETVVLGGAIIGVGCGLIIRHGGSTDGTEILGIIINKKKG
FT                   YTVGQIILFVNFFIFALSGIVYKNWHTAFVSFLTYGIATKVMDMVILGLEDTKSVTIIT
FT                   SSPRKLGHILMETLGIGLTYIHAEGGYSGEPRNLLYVVVERLQLSQLKEIVHREDPSAF
FT                   IAIENLHEVINGRRT"
FT   gene            complement(294566..295144)
FT                   /locus_tag="CpB0271"
FT   CDS_pept        complement(294566..295144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0271"
FT                   /product="phenylacrylic acid decarboxylase"
FT                   /note="similar to phenylacrylic acid decarboxylase -
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98204"
FT                   /db_xref="GOA:Q9Z8S4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8S4"
FT                   /protein_id="AAP98204.1"
FT                   /translation="MKRYVVGISGASGVILAVKLIKELVNAKHQVEVIISPSGRKTLYY
FT                   ELGCQSFDALFSEENLEYIHTHSIQAIESSLASGSCPVEATIIIPCSMTTVAAISIGLA
FT                   DNLLRRVADVALKERRPLILVPRETPLHTIHLENLLKLSKSGATIFPPMPMWYFKPQSV
FT                   EDLENALVGKILAYLNIPSDLTKQWSNPE"
FT   gene            complement(295141..296034)
FT                   /locus_tag="CpB0272"
FT   CDS_pept        complement(295141..296034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0272"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /note="similar to 4-hydroxybenzoate octaprenyltransferase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98205"
FT                   /protein_id="AAP98205.1"
FT                   /translation="MRLNYFLNLVNFKYSIFSILFLSASTVFALSINEISQNLSFKEGF
FT                   KISVFGAIAFVFARTTGIVVNQCIDRFIDKKNTRTSKRVLPANLVSLNFAWVLSLFCSF
FT                   LFLFLCKILRIFSLGIASLTLMIVYPYMKRVTFFCHWGLGLVYTVAILMNFCAFAESGL
FT                   SMRLCFLALLWGGSVGMVIAANDIIYAIEDTEFDREEGLRSVPAHYGEKKAVEIAKVNL
FT                   WVSYLAYIFSGFVGSLDKEFYFTAIIPLVVILKVVRMYSNYSKKDQEGESKFFLANIAI
FT                   ALSFLVSMTLFWSLSR"
FT   gene            296598..297293
FT                   /locus_tag="CpB0273"
FT   CDS_pept        296598..297293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0273"
FT                   /product="HB6 protein"
FT                   /note="similar to HB6 protein, Chlamydia pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98206"
FT                   /protein_id="AAP98206.1"
FT                   /translation="MALDEINNQNNPSQQIASSTSQTSKINQDRKTFACTVTLLVVATL
FT                   MILSGIVLLFTIGSLGLSVPLSGILGTFAVTVGAVLFITGLTILVRKSLGIEQKNEDLN
FT                   FLKIKTPTPPARPLMSKFSVTCSTTSIVLGMALLIGAVVSVFFLTGYLQLGLCAGLVGL
FT                   GTALFVAGLARMSPRSLADQEGSGSADSQSNIVGIGEPKAAQEQKWYKMAVVRGEDGIP
FT                   TAIRLTPEK"
FT   gene            297545..298327
FT                   /locus_tag="CpB0274"
FT   CDS_pept        297545..298327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98207"
FT                   /protein_id="AAP98207.1"
FT                   /translation="MSLNKTNALLNQPEPAVCLNAWDPKYINQDRKTFACTVTLLVIAT
FT                   LMILTTGVIVLLAMGSPGLSVLVSTIIGTSVTTLGTALFIIGLVKLIKKSLAWIQYQKY
FT                   FQEVVKQKYEPFSIPKNDNVHKLTSCLPSPLDIESPSPEASTPVSKLRIACSGVAIVLG
FT                   VTLLIGAVVSVFFCTGYLQLALCVGFACLGTALFVGGLAGLRTHSLIAQGIMYLYLTYY
FT                   LSSALEERNETVKDQRNEINTYLTEECRQQKREKALLE"
FT   gene            298391..298735
FT                   /locus_tag="CpB0275"
FT   CDS_pept        298391..298735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98208"
FT                   /protein_id="AAP98208.1"
FT                   /translation="MKSFVPNWKNPTPPLSPIPSEDEFILAYEPFVLPKTDPENAQANP
FT                   PGTSTPNVENGIDDLNPLLGQPNEQNNANNPGTSGSNPTSLPAPERLPETEENSQEEEQ
FT                   GSQNNEDLIG"
FT   gene            complement(298887..299864)
FT                   /locus_tag="CpB0276"
FT   CDS_pept        complement(298887..299864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0276"
FT                   /product="membrane dipeptidase precursor"
FT                   /note="similar to membrane dipeptidase precursor - rat"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98209"
FT                   /protein_id="AAP98209.1"
FT                   /translation="MTIDMHCDLLSHPHFCRKDPAVRCSPEQLLSGGVRQQVCAIFVPH
FT                   SRGEPNCDKQNSLFFSLPNQYPDIGLLSYEEEENGSSSQKKSLSLIRSIENASALGDDT
FT                   APLGTLLAKLIHLTKQGPLAYLGIVWKGDNRFGGGTEAPKRLSNDGKVLLDIMYELGVP
FT                   IDLSHCSDKLAEDILDYTADKLPNLAVIASHSNFRSVLDHRRNLVDAHAKEIVRRKGVI
FT                   GLNLVRSYVGDSLGDLEKHVLHAENLGILSSIVLGSDFFYANEDENFFFNECSSAEAHP
FT                   VLNQLIHRIFSKGKAESILSSRAEKFLKQVIVEQVNPKITDVKL"
FT   gene            complement(299879..300739)
FT                   /locus_tag="CpB0277"
FT   CDS_pept        complement(299879..300739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0277"
FT                   /product="SUA5 protein"
FT                   /note="similar to SUA5 protein - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98210"
FT                   /protein_id="AAP98210.1"
FT                   /translation="MPDKKAQITFSLPEVMSAIHQGKIVALPTDTVYGFVLSLYAPEAE
FT                   ERLYALKDREPSKAFALYVNSIEDIENISGYPLSPTAKKLAQLFPGAITLVVKHRNPRF
FT                   PKETLAFRIVDHSVVREIVDHCGTLIGTSANLSEFPSALTAQEIFADFADHDLCIFDGP
FT                   CSHGLESTVVASDPLYIYREGLISRSVIENIAGTEAKIFHRTSHAFSKHIKIYTVKNQE
FT                   QLVSFLSGSLDFKGVVCEHPKPKNFYTRLREALKKKTPSIVFIYDINTSDYPELFPFLS
FT                   PYYIE"
FT   gene            301048..301779
FT                   /locus_tag="CpB0279"
FT   CDS_pept        301048..301779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0279"
FT                   /product="esterase"
FT                   /note="similar to esterase - Spirulina platensis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98211"
FT                   /protein_id="AAP98211.1"
FT                   /translation="MTDYSFFRRKIGNIEAIECPGNPQDPIIILCHGYGSLADNLTFFP
FT                   SICSFSKLRPTWIFPNGILPLENDFRGSRACFPLNVLLLQELSRLYANGVGNLQEKYDE
FT                   LFDVDLETPKEALEELILNLNRPYNEIIIGGFSQGAILATHLVLTSQNPYAGALIFAGA
FT                   RLFNQGWEEGLKQCAQVPFLQSHGYEDEILPYHLGAHLNDLLLTKLNGQFVSFHGGHEI
FT                   PSVVFQKMQVTVPNWIDPARG"
FT   gene            complement(301751..302506)
FT                   /gene="dnaX"
FT                   /locus_tag="CpB0278"
FT   CDS_pept        complement(301751..302506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CpB0278"
FT                   /product="DNA-directed DNA polymerase III chain"
FT                   /note="similar to DNA-directed DNA polymerase III chain
FT                   dnaX - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98212"
FT                   /protein_id="AAP98212.1"
FT                   /translation="MLSSSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLPRGIKKQIY
FT                   ISPFEANYKIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRSL
FT                   SIFIERGEKILCSKETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLRDKVQRFMEVL
FT                   LELYRDRYTLNLGLKASALNYPEHVKEILQLPLLPLDKVLLIVESACRSLNNSSSAASV
FT                   LEWVAIQLVSLQYKEKELVSVSPGQDLSN"
FT   gene            complement(302638..303258)
FT                   /locus_tag="CpB0280"
FT   CDS_pept        complement(302638..303258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0280"
FT                   /product="dTMP kinase"
FT                   /note="similar to dTMP kinase - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98213"
FT                   /db_xref="GOA:Q9Z8R5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R5"
FT                   /protein_id="AAP98213.1"
FT                   /translation="MFIVIEGGEGSGKSSLAKALGDQLVAQDRKVLLTREPGGCLIGER
FT                   LRDLILEPPHLELSRCCELFLFLGSRAQHIQEVIIPALRDGYIVICERFHDSTIVYQGI
FT                   AEGLGADFVADLCSKVVGPTPFLPNFVLLLDIPADIGLQRKHRQKVFDKFEKKPLSYHN
FT                   RIREGFLSLASADPSRYLVLDARESLASLIDKVMLHTQLGLCT"
FT   gene            complement(303263..305767)
FT                   /locus_tag="CpB0281"
FT   CDS_pept        complement(303263..305767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0281"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /note="similar to DNA topoisomerase IV subunit A family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98214"
FT                   /db_xref="GOA:Q9Z8R4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R4"
FT                   /protein_id="AAP98214.1"
FT                   /translation="MFNKDEIIVPKNLEEEMKESYLRYSMSVIISRALPDIRDGLKPSQ
FT                   RRVLYAMKQLSLSPGAKHRKCAKICGDTSGDYHPHGESVIYPTLVRMAQNWAMRYPLVD
FT                   GQGNFGSIDGDPPAAMRYTEARLTHSAMYLMEDLDKDTVDIVPNYDETKHEPVVFPSKF
FT                   PNLLCNGSSGIAVGMATNIPPHNLGELIEATLLLLANPQASVDEILQVMPGPDFPTGGI
FT                   ICGSEGIRSTYTTGRGKIKVRARLHVEENEDKHRESIIITEMPYNVNKSRLIEQIANLV
FT                   NEKTLAGISDVRDESDKDGIRVVLEIKKGESSEIIINRLYKFTDVQVTFGANMLALDKN
FT                   LPRTMSIHRMISAWIRHRKEVIRRRTRYELNKAETRAHVLEGYLKALSCLDALVKTIRE
FT                   SGNKEHAKERIIESFGFTEPQALAILELRLYQLTGLEAEKIQKEYEELLNKIAYYKQVL
FT                   SDEGLVKDIIRNELQDLLKHHKVARRTTIEFDADDIRDIEDIITNESVIITISGDDYVK
FT                   RMPVKVFKEQRRGGHGVTGFDMKKGAGFLKAVYSAFTKDYLLIFTNFGQCYWLKVWQLP
FT                   EGERRAKGKPIINFLEGIRPGEELAAILNIKNFDNAGFLFLATKRGVVKKVSLDAFSNP
FT                   RKKGIRALEIDEGDELIAACHIVSDEEKVMLFTHLGMAVRFPHEKVRPMGRTARGVRGV
FT                   SLKNEEDKVVSCQIVTENQSVLIVCDQGFGKRSLVEDFRETNRGGVGVRSILINERNGN
FT                   VLGAIPVTDHDSILLMSSQGQAIRINMQDVRVMGRSTQGVRLVHLKEGDALVSMEKLSS
FT                   NENDDEVLSGSEEECSDTVSLR"
FT   gene            complement(305783..308200)
FT                   /locus_tag="CpB0282"
FT   CDS_pept        complement(305783..308200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0282"
FT                   /product="DNA gyrase subunit B"
FT                   /note="similar to DNA gyrase subunit B family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98215"
FT                   /db_xref="GOA:Q9Z8R3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8R3"
FT                   /protein_id="AAP98215.1"
FT                   /translation="MDPKEKNYDASAITVLEGLQAVRERPGMYIGDTGITGLHHLVYEV
FT                   VDNSIDEAMAGYCSRIDVRILEDGGIVIVDNGRGIPIEVHERESAKQGREVSALEVVLT
FT                   VLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKLVATVFKDKKCYQMEFSRGIPVTPLQ
FT                   YVSVSDRQGTEIVFYPDPKIFSTCTFDRSILMKRLRELAFLNRGITIVFEDDRDVSFDK
FT                   VTFFYEGGIQSFVSYLNQNKESLFSEPIYICGTRVGDDGEIEFEAALQWNSGYSELVYS
FT                   YANNIPTRQGGTHLTGFSTALTRVINTYIKAHNLAKNNKLALTGEDIREGLTAVISVKV
FT                   PNPQFEGQTKQKLGNSDVSSVAQQVVGEALTIFFEENPQIARMIVDKVFVAAQAREAAK
FT                   KARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILP
FT                   IRGKILNVEKARLQKIFQNQEIGTIIAALGCGIGADNFNLSKLRYRRIIIMTDADVDGS
FT                   HIRTLLLTFFYRHMTALIENECVYIAQPPLYKVSKKKDFRYILSEKEMDSYLLMLGTNE
FT                   SSILFKSTERELRGEALESFINVILDVESFINTLEKKAIPFSEFLEMYKEGIGYPLYYL
FT                   APATGMQGGRYLYSDEEKEEALAQEETHKFKIIELYKVAVFVDIQNQLKEYGLDISSYL
FT                   IPQKNEIVIGNEDSPSCNYSCYTLEEVINYLKNLGRKGIEIQRYKGLGEMNADQLWDTT
FT                   MNPEQRTLIHVSLKDAVEADHIFTMLMGEEVPPRREFIESHALSIRINNLDI"
FT   gene            complement(308204..308551)
FT                   /locus_tag="CpB0283"
FT   CDS_pept        complement(308204..308551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0283"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT191 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98216"
FT                   /protein_id="AAP98216.1"
FT                   /translation="MFLKRKKRGGSQVQNKRTASPIKHAKHYLHNYLQELQKIMAARPH
FT                   DAIDAWNQVFRDKYKGMSQAIGFRDHILLVKVYNSSLYALLKQTPQNDLIMSLYQVASH
FT                   VQIREIQFLLG"
FT   gene            308618..308818
FT                   /locus_tag="CpB0284"
FT   CDS_pept        308618..308818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98217"
FT                   /protein_id="AAP98217.1"
FT                   /translation="MSRLFSVFLYDQFLNKVLITCCIKRNFLYPQKRKKSIRRRGILMI
FT                   KIPFRGCKDVKRAVNTHVVTC"
FT   gene            complement(308815..309324)
FT                   /locus_tag="CpB0285"
FT   CDS_pept        complement(308815..309324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98218"
FT                   /protein_id="AAP98218.1"
FT                   /translation="MIINVRAPAFGITSVQQFSTNFQAAIPILNIVIGCSRISSTYAED
FT                   IEEVAQEKLEKSTHSKSSTSVNLWAHRVRGVVEILGGGIVILALEITALVLQVIIKLIK
FT                   CLIDVLCVCLFGLGVCVVAIIGAIAFCVVVVVKYLGFCSQGEELEPIEVKTLISPDKPY
FT                   PTVVYV"
FT   gene            complement(309471..310289)
FT                   /locus_tag="CpB0286"
FT   CDS_pept        complement(309471..310289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0286"
FT                   /product="gene encoding a 29 kDa immunogenic protein"
FT                   /note="similar to gene encoding a 29 kDa immunogenic
FT                   protein - Legionella pneumophila"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98219"
FT                   /protein_id="AAP98219.1"
FT                   /translation="MKKKLSLLVGLIFVLSSCHKEDAQNKIRIVASPTPHAELLESLQE
FT                   EAKDLGIKLKILPVDDYRIPNRLLLDKQVDANYFQHQAFLDDECERYDCKGELVVIAKV
FT                   HLEPQAIYSKKHSSLERLKSQKKLTIAIPVDRTNAQRALHLLEECGLIVCKGPANLNMT
FT                   AKDVCGKENRSINILEVSAPLLVGSLPDVDAAVIPGNFAIAANLSPKKDSLCLEDLSVS
FT                   KYTNLVVIRSEDVGSPKMIKLQKLFQSPSVQHFFDTKYHGNILTMTQDNG"
FT   gene            complement(310286..310951)
FT                   /locus_tag="CpB0287"
FT   CDS_pept        complement(310286..310951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0287"
FT                   /product="ABC transporter"
FT                   /note="similar to ABC transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98220"
FT                   /protein_id="AAP98220.1"
FT                   /translation="MQSDLIQILLKETVNTLYMVSTAFFFSCAIGGMLGLGLFCTSPKS
FT                   LNPKKSLYATISMILSFLTAIPFAILIVILFPITRWIVGTSLGPTASIVPLTIGAIPFV
FT                   VTIVVDAFRNSALNYLESAVALGIPKRNILFGILLPESYPQLIFSLKSLVVHLISCSTL
FT                   AGFVGGGGLGQLLLQYGYYRFEWSVTTSVLVITLVLIESVRILGDFWGRRVLKYRGIL"
FT   gene            complement(310961..311986)
FT                   /locus_tag="CpB0288"
FT   CDS_pept        complement(310961..311986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0288"
FT                   /product="amino-acid ABC transporter protein"
FT                   /note="similar to amino-acid ABC transporter protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98221"
FT                   /db_xref="GOA:Q9Z8Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Q8"
FT                   /protein_id="AAP98221.1"
FT                   /translation="MSEQHSPIISVQDVSKKLGDHILLSKVSFSVYPGEVFGIVGHSGS
FT                   GKTTLLRCLDFLDMPTSGSISVAGFDNSLPTQKFSRRNFSKNVAYISQNYGLFSSKTVF
FT                   ENIAYPLRIHHSEMSKSEVEEQVYDTLNFLNLYHRHDAYPGNLSGGQKQKVAIARAIVC
FT                   QPEVVLCDEITSALDPKSTENIIERLLQLNQERGITLVLVSHEIDVVKKICSHVLVMHQ
FT                   GAVEELGTTEELFLNSENSITNELFHEDINIAALSSCYFAEDREEVLRLNFSKELAIQG
FT                   IISKVIQTGLVSINILSGNINLFRKSPMGFLIIVLEGEVEQRKKAKELLIELGVVIKEF
FT                   Y"
FT   gene            312471..313520
FT                   /locus_tag="CpB0289"
FT   CDS_pept        312471..313520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0289"
FT                   /product="class I fructose bisphosphate aldolase"
FT                   /note="similar to class I fructose bisphosphate aldolase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98222"
FT                   /db_xref="GOA:Q9Z8Q7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8Q7"
FT                   /protein_id="AAP98222.1"
FT                   /translation="MLNIHDILGNDDENLLSYQCKHITKDKLTLPSHDFVDKVFGLSDR
FT                   NNRVLRSLQTMFSHGRLANSGYLSILPVDQGIEHSAGASFAINPIYFDPENIVKLAIES
FT                   GCSAVASTYGTLSLLSRKYAHKIPFMLKLNHNELLSYPTKYHQIFFTQVEAAYSMGAVA
FT                   VGATVYFGSETSNEEIVAVSNAFAKARSLGLATVLWCYLRNPAFVANGVDYHTAADLTG
FT                   QADHLGATLGADIVKQKLPTCQGGFKAINFGKTDERVYSELSSNHPIDLCRYQVLNSYC
FT                   GKVGLINSGGPSGKNDFTEAARTAVINKRAGGMGLILGRKAFQRPLSEGIQLLNLVQDI
FT                   YLDPNITIA"
FT   gene            313540..314946
FT                   /locus_tag="CpB0290"
FT   CDS_pept        313540..314946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0290"
FT                   /product="extreme acid resistance protein xasA"
FT                   /note="similar to extreme acid resistance protein xasA -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98223"
FT                   /protein_id="AAP98223.1"
FT                   /translation="MHSHSKPTKPLGTFTVGMLSLAVVISLRNLPLTAKHGLSTLFFYG
FT                   LAVICFMIPYALISAELASFKPQGIYIWARDALGKWWGFFAIWMQWFHNMTWYPAVLAF
FT                   IASTIVYKINPELAHNKVYIATVILAGFWILTFFNFLGITSSALFSSICVIIGTLIPGV
FT                   ILVSLALFWIFSGNPIAISLSWGNLLPNFSNVSSLVLLAGMLLALCGLEANANLASDMV
FT                   NPRKNYPKAVFIGAIATLTILVLGSLSIAIVIPKEEISLVSGLVKTFTLFFDKYNLSWM
FT                   TGIVVVMTIAGSLGELNAWMFAGTKGLFISTQNDCLPRLFKKVNSKNVPTNLMLFQGIV
FT                   VTIFTLLFLCLDSADLVYWILTALSVQMYLAMYICLFLAGPILRIKEPRAQRLYSVPGK
FT                   FLGICTMSILGILSCAFALWVSFLPPRELAQISEGSKIGYTTFLLLAFSLNCLIPFGIY
FT                   FTHKRLSKKS"
FT   gene            complement(314943..315911)
FT                   /locus_tag="CpB0291"
FT   CDS_pept        complement(314943..315911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98224"
FT                   /protein_id="AAP98224.1"
FT                   /translation="MKLLIKFAKKDLKNSSIAPLYEVLLEILEAPGEEILEVLFSLDPM
FT                   WLKSMLDPKKHSTLGIEISSETAETIESCSLGLISINLLLSGLCLRSSHDRSQAVKIIQ
FT                   QFCPQFSSEEVQNFVEQRNILTPFLHHLFEGDEVALLNQLSLRLDLIVPNALYPEPDPS
FT                   CWQSINSEDCAKDAEDQQEDFNKTKEACKEGLKKLVLPALSITSIPQLLRARRFKQGAE
FT                   ILMAIDRKKMKQNPFIFLEALLESEEFSISVGKYLKLLMPIHLWDKLLHAIYLGYFQTG
FT                   LICQGEIETFCRRANLNPEAFQAAIQQGRLLSFLFPKMLLD"
FT   gene            complement(315962..316384)
FT                   /locus_tag="CpB0292"
FT   CDS_pept        complement(315962..316384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98225"
FT                   /protein_id="AAP98225.1"
FT                   /translation="MKSSLRPITYLILAILAIATLMSVLYFCGIISVGTFVLGMLIPLS
FT                   VCSVLCVAYLFYQQSSIEKTKVFSITSPSVFFSDEDLNLLLGREEDSVSAIDELLKNFP
FT                   ADDFRRPKMLPYSNFLDEQGRPNESREEDSHTSKIL"
FT   gene            complement(316462..318009)
FT                   /locus_tag="CpB0293"
FT   CDS_pept        complement(316462..318009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98226"
FT                   /protein_id="AAP98226.1"
FT                   /translation="MFNLFFFTANKETTASHELIYRKNQSFSLSPVTILCLLAISVLLL
FT                   LGVVFALVGCHVLAAPLGLLVWGCAASVCSMMAIVSLMCLYKGGKPLIEPSNEEKIDPT
FT                   KDLEIKDPESLKPVPVEGQSLPKERKTVSFKAKIPSIVEDDFKPYVIQSTFYHQNKVYS
FT                   KPIAERMQSLEKEITTLIVDFPRALEESSKSSGSLLRGVISEIKNLFLPRFLSRKVKYS
FT                   LTACLRRLGSIVEEYASSDLLILLLTKPEPLNMVTQQLIAHLNSLKTEKRKLTPHMQKL
FT                   VLSINFWFYGWSLEEKCIEKIVAYDPNLLTDELKAHLEAGNIVQFLLSFQSSEMQREFR
FT                   ALFPSDAQELPSAKDGSNYVPAINSSEYMYDFKDLSVLKKSLSERLAFCEKIPSPSSWN
FT                   FTSSVASHYKDFSLLFTFFSNQQSVILQNPFLLIELLHENPKCQTFLKGLLEKAMPMSN
FT                   WAALFRPMLMGMLCSGIARKKELKIIAEHLGVPFKEITQAIASGKILDLLLQHLFDF"
FT   gene            complement(318061..319473)
FT                   /gene="mgtE"
FT                   /locus_tag="CpB0294"
FT   CDS_pept        complement(318061..319473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="CpB0294"
FT                   /product="MgtE"
FT                   /note="similar to mgtE protein - Bacillus firmus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98227"
FT                   /protein_id="AAP98227.1"
FT                   /translation="MDSRTSHLDDELSFKLEKAFTCLSTDIHSHDLSKIVIEYNPIDLA
FT                   YAVSCLPSESRAILYKNLSCITAKVAFIINTDSASRWAIFRRLSDSEVCALIEQMPPDE
FT                   AVWVLDDIPDRRYRRILELIDSKKALKIRDLQKHGRNTAGRLMTNEFFAFLMETTVKDV
FT                   SACIRSNPGIDLTRLVFVLDFKGELQGVVTDRSLIINPPEMSLKQIMNQIEHKVLPDAT
FT                   REEVVDLVERYKIAALPVVDEENFLIGAITYEDVVEAIEDIADETIARMAGTTEDVGYQ
FT                   TCHVVQRFLLRAPWLLVTLFAGLISASVMAYFQKISPALLALIIFFIPLINGMSGNVGV
FT                   QCSTILVRSMATGTLSFGRRRETIFKEMSIGLLTGVVLGILCGLVVYLMGFLGLNIFSG
FT                   GGIQLGVTVATGVLGASLTATTLGVLSPFFFAKLGVDPALASGPIVTALNDIMSMIIFF
FT                   LIAGGINFLFFN"
FT   gene            complement(319500..321635)
FT                   /locus_tag="CpB0295"
FT   CDS_pept        complement(319500..321635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0295"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT195 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98228"
FT                   /protein_id="AAP98228.1"
FT                   /translation="MIRSPLPFISSKRALNMLGLQDEFSCPEDVVDFLFSEIELLAQQD
FT                   EPSEGYLALSRSLLMMTHNHPKVVKRVIFYGVSYGLKHKSMSIFIDVLTYIDFLFEKLG
FT                   ISASDRLSLCSARTCINFELYSQTGEMKFLSEVVDNFRLIEQLLKMHPQLKNRLGWEHF
FT                   RIGAKQEEVSLVASASVYQAVGRSFIELYHKHLELSDLACGMKCLALALDLSPNNAHIH
FT                   ADYAKGLVVLGTRQGKSLLIERGMEHFSKAIFLSFSRDGDTLAYQNYRYSYALASVKLF
FT                   DLTYKKEHFDQAMNILYQTVQAFPNLSGLWMVWGELLIRSGWLNSNMKYIEVGLEKLAS
FT                   LQKKTNDPIALSGLLATGIAILGLYLEEPNLFKDSRHRLISAMRTFPGNSALVHALGVV
FT                   QLCSALYFNEDSHFASAISCFQSCLEWDLDATGMWQKLFDAYFSWGIKKKSARLLRKAV
FT                   DVASRLCSLRPEAFLFWSDRGLALKCLAEATIDEAYKEIFLSESLLHYQRAWDLSGRLE
FT                   ILELWGQSHYLLAELQQSLFHYDEAYTLLTKVDLTLSSSRVKLILAAVLLGKGRLLQDT
FT                   DPAEEAREILEPLVEVYLEDENFLLLLGKVYLFLFWKNKNVCLGKLARTYLEKATSLGC
FT                   PEAYYTLGKFYAVIKDVNKAWGMVIRSAQYGVRITEAKWLNDPYLANLREIHAFREVVE
FT                   NQKGRLWLGNKTEMKRN"
FT   gene            complement(321982..323130)
FT                   /locus_tag="CpB0296"
FT   CDS_pept        complement(321982..323130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0296"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT195 - Chlamydia
FT                   trachomati"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98229"
FT                   /protein_id="AAP98229.1"
FT                   /translation="MSCFNLTSTNESLRPISPKASFPKQGWQSYFRSALRKHRSDTLSV
FT                   SVCKVNKYDANLFVRLTVIALAVVGVLILFSIMLASIQGTLVITSWPLVTAAILIPTIL
FT                   LTGGMYILHRLGKKVDVISGVCIPPFSRRCWVPISSSHTLEKFDEKHVSACSYLDISTL
FT                   SADGSGIAAVYQCPPLLFRAFPCFGIPCAMPFVALLRMIYNLIRFLVVPFYIIFRMIYE
FT                   HFFCKHLPEDDRFIYKDVAREMGRSLAAFLKAPFYASACMIGAFYSLLDPLAGRVLMGS
FT                   VERDWNDNVILARSVSLANEAHSLFRFEGGGGRKGLGQHAFYLMLCCQPQSVFLFDKGE
FT                   IVSGAHPSIQLPERRGLDTSGRYPHISVIPDSGNDSAKNFIV"
FT   gene            323226..324413
FT                   /locus_tag="CpB0297"
FT   CDS_pept        323226..324413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0297"
FT                   /product="amino acid (glutamate) transporter"
FT                   /note="similar to amino acid (glutamate) transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98230"
FT                   /protein_id="AAP98230.1"
FT                   /translation="MKKQRSHYTKNNLLLLLSILVGLGLGSVQSPWIVYSAECIANTFL
FT                   KFLRLLSIPLVFCALGSTITSIQNFNTMVTLGKRILYYTLLTTVIAASIGLLLFFLLRP
FT                   QMITQDALATTTKCNPLGYLDVLSDTLPENIFKPFLQGNVISAACLAVLLGTASLFLQE
FT                   KEKHFVNQFFNSFFSIFLNLARGGLKLLPIAMLGFSVILFKELKDQSNLTMFAKYLLCV
FT                   IGANLAQGFIVLPILLKINKVSPLKVAKAMSPALVTAFFSKSSAATLPLTMELAEDDLK
FT                   INKNLSRFSFPLCSVINMNGCAAFILITVLFVATSNGMIISPLMSLGWIFIATLAAIGN
FT                   AGVPMGCYFLTLSLLTSMNVPLSILGLILPFYTVIDMIETSLNVWSDCCVVSLAN"
FT   gene            324456..325940
FT                   /locus_tag="CpB0299"
FT   CDS_pept        324456..325940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0299"
FT                   /product="sodium-dependent amino acid transporter"
FT                   /note="AaaT; similar to sodium-dependent amino acid
FT                   transporter (AaaT) - Chlamydia psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98231"
FT                   /protein_id="AAP98231.1"
FT                   /translation="MNKKHASFSSRLGFIFSMIGIAVGAGNIWRFPRVAAQNGGGAFLI
FT                   LWLCFLFLWSIPLIIIELSIGKLTKKAPIGALIKTAGKKFAWAGGFITLVTTCILAYYS
FT                   TIVGWGLSYFYYAVSGKIHLGNDFAKLWTSHYQSSIPLWAHLTSLGLAYLVIRKGIVHG
FT                   IEKCNKILIPAFFLCTIALLLRAVTLPGAVQGIKQLFSCDKSCFSNYKVWIEALTQNAW
FT                   DTGAGWGLLLVYAGFASKKTGVVSNGALTAICNNLVSLIMGIIIFSTCASLDILGTTQL
FT                   QDGAGASSIGITFIYLPELFTRLPGGIYLTTLFSSIFFLAFSMAALSSMISMLFLLSQT
FT                   LAEFGIKPYISETLATIIAFVLGIPSALSLTFFSNQDTVWGVALIVNGLIFIYAALVYG
FT                   FPKLKKEVINAAPGDLRLNKAFDYIIKYLLPIEGILLLGWYFYEGLFPENGQWWNPISL
FT                   YSLGSLVLQWSLGLIILWKFNKQLYLRFSRYNHEIL"
FT   gene            complement(325925..326080)
FT                   /locus_tag="CpB0298"
FT   CDS_pept        complement(325925..326080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98232"
FT                   /protein_id="AAP98232.1"
FT                   /translation="MFFLSKNRLMPNILGQEKRYFQSLNIFFFPKCCDSTLNIQSRIID
FT                   WIYRIS"
FT   gene            326081..326611
FT                   /locus_tag="CpB0300"
FT   CDS_pept        326081..326611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0300"
FT                   /product="inclusion membrane protein B"
FT                   /note="similar to inclusion membrane protein B - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98233"
FT                   /protein_id="AAP98233.1"
FT                   /translation="MSAPIPTPQELSDQITCLNVQYQQVSELARENKGDIEGLKTLTAA
FT                   LTADAGIQPSADEIYSLQTAAALILSASEKPGSGPSGSTEGSVTVQSPCKFKKVLAVVL
FT                   TIIALIAIAVLIACIIAACGGFPLLLSALNLYTIGACVSLPIIASTSVALICLCTFVAN
FT                   SLIKPVITVRTTR"
FT   gene            326642..327253
FT                   /locus_tag="CpB0301"
FT   CDS_pept        326642..327253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0301"
FT                   /product="inclusion membrane protein C"
FT                   /note="similar to inclusion membrane protein C - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98234"
FT                   /protein_id="AAP98234.1"
FT                   /translation="MTSPIPFQSSGDASFLAEQPQQLPSTSESQLVTQLLTMMKHTQAL
FT                   SETVLQQQRDRLPTASIILQVGGAPTGGAGAPFQPGPADDHHHPIPPPVVPAQIETEIT
FT                   TIRSELQLMRSTLQQSTKGARTGVLVVTAILMTISLLAIIIIILAVLGFTGVLPQVALL
FT                   MQGETNLIWAMVSGSIICFIALIGTLGLILTNKNTPLPAS"
FT   gene            327363..330140
FT                   /locus_tag="CpB0302"
FT   CDS_pept        327363..330140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0302"
FT                   /product="amino acid transporter"
FT                   /note="similar to amino acid transporter - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98235"
FT                   /protein_id="AAP98235.1"
FT                   /translation="MQRVLRLLFNLHHGEEKRAFLFFLLGLVWGIGCYGTLSLAEGLFI
FT                   EKLGSAELPKIYLGSSLILCVLSSLILYNLFKKHISATALFLIPVSLSILCNFYLILSS
FT                   IFAIDPPRSPLFFYRIVIWSLTILSYTSFWGFVDQFFNLQDGKRHFCIFNAIIFLGDAI
FT                   GSGIIASLVHTIGIQGILILFTAALVLTFPIVFYVSKSLKSLSDDHDLFIDTGHPPPLS
FT                   KALKLCFYDKYTFYLLCFYFLMQLLAIATEFNYLKIFEIQFASKEEFELVAHIGKCSLW
FT                   ISLGNMCFALFAYSRIVKRLGVNNIILFAPLCFLSLFLFWTFKTTLSIAVLAMVVREGV
FT                   TYALDDNNLQLLIYGVPNKIRNQIRIVVESFIEPIGMLVWSLVCFLSSQQYVFCLIISL
FT                   IATILVCLVRSYYAKAILKNLSAQALQLTRSMQDWIKSMTVKQKRQVELFLLAHLKHPS
FT                   ERHQTFAFQHLLNLASRSVLPSLLAHMNKLSLPNKLKTIEMVKSSLWAKDFLTLELLKR
FT                   WTSIFPHPAIASAIHLYFAEHDLLHITHIAEDLYDTVGDRLLAAILTVRRQEAYGPYRD
FT                   LADKRLKELLNSDQPEDIVMGLTILKLEKNPQNFPILLDFLNTKNEDILIVTCKALHTS
FT                   VRANHKPYCPELLKRLRQCSHNDEASQYLLKTISIALDISFVKDLLMTTSQLKNTSRKY
FT                   AEAMIGELDKEVAPAFLQVLTDEGTHNRCRILAAKALCKIDNWLLKKHAYKIVKSKASK
FT                   ALFYSYHGHYIQKKYPTYNLSLLANTLNSNYYAEVNFMLSLLGILGSMEHSGVLIRALT
FT                   SKNQKIKAQALESLEKNCDSHLFSLLEPFVNQPGMCYSEKYYFKCGVIPLTLKELLNMM
FT                   ENSPSSLNKLTAQQLKEELSYCDPDFQSVNTIYNQEHEDFRTEESETLISFLSI"
FT   gene            330506..330919
FT                   /locus_tag="CpB0303"
FT   CDS_pept        330506..330919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0303"
FT                   /product="cAMP-dependent protein kinase type I regulatory
FT                   subunit"
FT                   /note="similar to cAMP-dependent protein kinase type I
FT                   regulatory subunit - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98236"
FT                   /protein_id="AAP98236.1"
FT                   /translation="MNLIDRAFLLKKTIIFQSLDMDLLLTIADKTETIIFKPGSNVFSI
FT                   GQPGFSFYIIVEGYITISKEKLESPLNLKPLDCFGEESLFNNKPREYNASANTQVRMLV
FT                   LSKGQILNIVEECPSVALSFLELYAKQIKFREP"
FT   gene            complement(331038..331277)
FT                   /locus_tag="CpB0304"
FT   CDS_pept        complement(331038..331277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0304"
FT                   /product="acyl carrier protein"
FT                   /note="similar to acyl carrier protein - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98237"
FT                   /db_xref="GOA:Q9Z8P3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P3"
FT                   /protein_id="AAP98237.1"
FT                   /translation="MSLEDDVIAIIVEQLGVDPKEVNENSSFIEDLNADSLDLTELIMT
FT                   LEEKFAFEISEEDAEKLRTVGDVFTYIKKRQAEQ"
FT   gene            complement(331433..332179)
FT                   /locus_tag="CpB0305"
FT   CDS_pept        complement(331433..332179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0305"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /note="similar to 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98238"
FT                   /db_xref="GOA:Q9Z8P2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P2"
FT                   /protein_id="AAP98238.1"
FT                   /translation="MDITLVGKKVIVTGGSRGIGLGIVKLFLENGADVEIWGLNEERGQ
FT                   AVIESLTGLGGEVSFARVDVSHNGGVKDCVQKFLDKHNKIDILVNNAGITRDNLLMRMS
FT                   EDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIVAKIGSAGQTNYAAAKAGI
FT                   IAFTKSLAKEVAARNIRVNCLAPGFIETDMTSVLNDNLKAEWLKSIPLGRAGTPEDVAR
FT                   VALFLASQLSSYMTAQTLVVDGGLTY"
FT   gene            complement(332185..333111)
FT                   /gene="fabD"
FT                   /locus_tag="CpB0306"
FT   CDS_pept        complement(332185..333111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="CpB0306"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="similar to malonyl CoA-acyl carrier protein
FT                   transacylase fabD - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98239"
FT                   /protein_id="AAP98239.1"
FT                   /translation="MKKRYAFLFPGQGSQYVGMGQDLYMEYPEVRELFDFANERLGFSL
FT                   TSIMFEGPEDLLMETVHSQLAIYLHSMAVVKVLSQRSSIQPSLVSGLSLGEYTALVASD
FT                   RISVLDGLELVRKRGQLMNEACNQSPGAMAALLGLPSEVIEENITSLGQGIWIANYNAP
FT                   KQLVVAGIAEKVDQAIELFRDLGCKKAVRLKVSGAFHTPLMQVAQDGLAPDIYALCMKD
FT                   SSLPLVSHVVGKSLVNTEEMRECLARQMTSPTLWYQSCYHIESEVDEFLELGPGKVLAG
FT                   LNRSIGISKPITSLGTFAQIEKFLSEV"
FT   gene            complement(333128..334135)
FT                   /gene="yjaX"
FT                   /locus_tag="CpB0307"
FT   CDS_pept        complement(333128..334135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjaX"
FT                   /locus_tag="CpB0307"
FT                   /product="3-oxoacyl-acyl-carrier protein synthase-like
FT                   protein"
FT                   /note="similar to Bacillus subtilis 3-oxoacyl- acyl-carrier
FT                   protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98240"
FT                   /db_xref="GOA:Q9Z8P0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8P0"
FT                   /protein_id="AAP98240.1"
FT                   /translation="MWFSVNKNKKAAIWATGSYLPEKVLSNADLEKMVDTSDEWIVTRT
FT                   GIKERRIAGPQEYTSLMGAIAAEKAIANAGLSKDQIDCIIFSTAAPDYIFPSSGALAQA
FT                   HLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAADKLSSFVDYTDRNTCV
FT                   LFGDGGAACVIGESRPGSLEINRLSLGADGKLGELLSLPAGGSRCPASKETLQSGKHFI
FT                   AMEGKEVFKHAVRRMETAAKHSIALAGIQEEDIDWFVPHQANERIIDALAKRFEIDESR
FT                   VFKSVHKYGNTAASSVGIALDELVHTESIKLDDYLLLVAFGGGLSWGAVVLKQV"
FT   gene            334230..334832
FT                   /gene="recR"
FT                   /locus_tag="CpB0308"
FT   CDS_pept        334230..334832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CpB0308"
FT                   /product="RecR"
FT                   /function="DNA repair and genetic recombination"
FT                   /note="similar to Bacillus subtilis RecR"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98241"
FT                   /db_xref="GOA:Q9Z8N9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N9"
FT                   /protein_id="AAP98241.1"
FT                   /translation="MTRYPDYLSKLIFFLRKLPGIGFKTAEKLAFELISWDSEQLKILG
FT                   NAFHNVASERSHCPLCFTLKESKEADCHFCREERDNQSLCIVASPKDVFFLERSKVFKG
FT                   RYHVLGSLLSPITGKHIENERLSILKSRIETLCPKEIILAIDATLEGDATALFLKQELQ
FT                   HFSVNISRLALGLPIGLSFDYVDSGTLARAFSGRHSY"
FT   gene            335191..337569
FT                   /locus_tag="CpB0309"
FT   CDS_pept        335191..337569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0309"
FT                   /product="putative omp85 analog"
FT                   /note="similar to probable omp85 analog - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98242"
FT                   /protein_id="AAP98242.1"
FT                   /translation="MGMLIMRNKVILQISILALIQTPLTLFSTEKVKEGHVVVDSITII
FT                   TEGENASNKHPLPKLKTRSGALFSQLDFDEDLRILAKEYDSVEPKVEFSEGKTNIALHL
FT                   IAKPSIRNIHISGNQVVPEHKILKTLQIYRNDLFEREKFLKGLDDLRTYYLKRGYFASS
FT                   VDYSLEHNQEKGHIDVLIKINEGPCGKIKQLTFSGISRSEKSDIQEFIQTKQHSTTTSW
FT                   FTGSGLYHPDIVEQDSLAITNYLHNNGYADAIVNSHYDLDDKGNILLYMDIDRGSRYTL
FT                   GHVHIQGFEVLPKRLIEKQSQVGPNDLYCPDKIWDGAHKIKQTYAKYGYINTNVDVLFI
FT                   PHATRPIYDVTYEVSEGSPYKVGLIKITGNTHTKSDVILHETSLFPGDTFNRLKLEDTE
FT                   QRLRNTGYFQSVSVYTVRSQLDPMGNADQYRDIFVEVKETTTGNLGLFLGFSSLDNLFG
FT                   GIELSESNFDLFGARNIFSKGFRCLRGGGEHLFLKANFGDKVTDYTLKWTKPHFLNTPW
FT                   ILGIELDKSINRALSKDYAVQTYGGNVSTTYILNEHLKYGLFYRGSQTSLHEKRKFLLG
FT                   PNIDSNKGFVSAAGVNLNYDSVDSPRTPTTGIRGGVTFEVSGLGGTYHFTKLSLNSSIY
FT                   RKLTRKGILKIKGEAQFIKPYSNTTAEGVPVSERFFLGGETTVRGYKSFIIGPKYSATE
FT                   PQGGLSSLLISEEFQYPLIRQPNISAFVFLDSGFVGLQEYKISLKDLRSSAGFGLRFDV
FT                   MNNVPVMLGFGWPFRPTETLNGEKIDVSQRFFFALGGMF"
FT   gene            337664..338179
FT                   /locus_tag="CpB0310"
FT   CDS_pept        337664..338179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0310"
FT                   /product="OmpH-like outer membrane protein"
FT                   /note="similar to ompH-like outer membrane protein -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98243"
FT                   /db_xref="GOA:Q9Z8N7"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N7"
FT                   /protein_id="AAP98243.1"
FT                   /translation="MKKLLFSTFLLVLGSTSAAHANLGYVNLKRCLEESDLGKKETEEL
FT                   EAMKQQFVKNAEKIEEELTSIYNKLQDEDYMESLSDSASEELRKKFEDLSGEYNAYQSQ
FT                   YYQSINQSNVKRIQKLIQEVKIAAESVRSKEKLEAILNEEAVLAIAPGTDKTTEIIAIL
FT                   NESFKKQN"
FT   gene            338201..339283
FT                   /locus_tag="CpB0311"
FT   CDS_pept        338201..339283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0311"
FT                   /product="UDP glucosamine N-acyltransferase"
FT                   /note="similar to UDP glucosamine N-acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98244"
FT                   /db_xref="GOA:Q9Z8N6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N6"
FT                   /protein_id="AAP98244.1"
FT                   /translation="MSEAPVYTLKQLAELLQVEVQGNIETPISGVEDISQAQPHHIAFL
FT                   DNEKYSSFLKNTKAGAIILSRSQAMQHAHLKKNFLITNESPSLTFQKCIELFIEPVTSG
FT                   FPGIHPTAVIHPTARIEKNVTIEPYVVISQHAHIGSDTYIGAGSVIGAHSVLGANCLIH
FT                   PKVVIRERVLMGNRVVVQPGAVLGSCGFGYITNAFGHHKPLKHLGYVIVGDDVEIGANT
FT                   TIDRGRFKNTVIHEGTKIDNQVQVAHHVEIGKHSIIVAQAGIAGSTKIGEHVIIGGQTG
FT                   ITGHISIADHVIMIAQTGVTKSITSPGIYGGAPARPYQETHRLIAKIRNLPKTEERLSK
FT                   LEKQVRDLSTPSLAEIPSEI"
FT   gene            complement(339332..340372)
FT                   /locus_tag="CpB0312"
FT   CDS_pept        complement(339332..340372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0312"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT244 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98245"
FT                   /protein_id="AAP98245.1"
FT                   /translation="MDVSRKINRHTQFYVDSIDGVIKNFDHKPSEDKSRDHEELEEKLL
FT                   TITKRIVASAQEFQNRKTDSKNYYLKKTQWLPFKNEELEQTKELFAMLTSMDKKIAQLF
FT                   FYSPGCSSDWVEFTEVICHLNDSIGLGGVLLCCGLFEQQCEHVVTVNKKLDLPLLLGTT
FT                   VVNSLRYYLTYRNISLLNCQSMSELGKELGDVLKQHGVAFTLIFKEIVDIDLLNYVKLI
FT                   QGLKRSGNIQARIYDNDVPTLPSVSSSPIALRYSLANTIRGLALHVDFSSLKFISPSIL
FT                   SNTEHTAKALNSGGECFIFSNLDEFNLGMKIVMQLLRTGKISPEILNKNIMKILMIKRR
FT                   VRSLYI"
FT   gene            340547..341575
FT                   /locus_tag="CpB0313"
FT   CDS_pept        340547..341575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0313"
FT                   /product="pyruvate dehydrogenase complex E1 alpha subunit"
FT                   /note="similar to pyruvate dehydrogenase complex E1 alpha
FT                   subunit - Thiobacillus ferrooxidans"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98246"
FT                   /protein_id="AAP98246.1"
FT                   /translation="MDSSAPYNIASQGTEKSTVERILDLYGPASCIKFLKQMVLIREFE
FT                   ARGEEAYLEGLVGGFYHSYAGQEAVATAAIANTGLDPWVFSSYRCHALAILLNIPLQEI
FT                   AAELLGKETGCALGRGGSMHMCGPNFPGGFGIVGGQIPLAAGAAFTIKYQEQKNRVSLC
FT                   FIGDGAVAQGVFHETLNFVSLHQLPLMLIIENNGWSMGTSLNRAVAKQPIAESQGSSYD
FT                   IRAVTVNGFDLFNSLLGFREAYRYMVDTESPVLVECLCSRFRGHSISDPNLYRSKEEMQ
FT                   CLFKKDPIVLAKDWLIRLEVLTEEEFQNIRQECKTAVLEAFSNAKLSSDPSVTTLEEGV
FT                   YA"
FT   gene            341568..342554
FT                   /locus_tag="CpB0314"
FT   CDS_pept        341568..342554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0314"
FT                   /product="pyruvate dehydrogenase E1 beta subunit"
FT                   /note="similar to pyruvate dehydrogenase E1 beta subunit -
FT                   Zea mays"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98247"
FT                   /protein_id="AAP98247.1"
FT                   /translation="MPKHKTLEIREALREAIDEEMSRDPNVCILGEEVGDYNGAYKVTK
FT                   GLLDKWGPKRVIDAPISEAAFSGIGIGAALSGLRPIIEFMSWNFSFVALDQIISHAAKM
FT                   HFMTGGKFSVPIVFRGPNGAAAQVSCQHSHCVESLYANIPGLIIIAPSNPYDAKGLLKS
FT                   AIRNNNPVLFLENELEYNLKGEVPTEEYLVPIGKAHRVQEGNDLTIITYSRMVSITKEA
FT                   CSLAKKRWGLSIEIIDLRTIKPLDISTILSSVRKTSRCIVIEEGHYFAGISSEIIALIT
FT                   EHVFDSLDAPPLRVCQKETPMPYSKILEQATLPNVNRILDTIEKVMR"
FT   gene            342559..343848
FT                   /locus_tag="CpB0315"
FT   CDS_pept        342559..343848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0315"
FT                   /product="dihydrolipoamide S-acetyltransferase"
FT                   /note="similar to dihydrolipoamide S-acetyltransferase -
FT                   Zymomonas mobilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98248"
FT                   /protein_id="AAP98248.1"
FT                   /translation="MISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAI
FT                   LEHTANEDGWIREILRHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEASPKG
FT                   SSEEVSPATTPQAASATFTAVTFKPEPPLSSPLVFKHVGTTNNLSPLARQLAKEKNIDV
FT                   SSIQGSGPGGRIVKKDLEKAPPKSIAGFGYPESPEVPPGSYHEENLSPIREVIAARLQA
FT                   AKISIPHFYVRQQVYASPLLNLLKELQAQGIKLSINDCIVRACALALKEFPSINSGFNS
FT                   VDNKIVRFDTIDISIAVAIPDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTE
FT                   YKGGSFCVSNLGMTGITEFTAIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSV
FT                   DHRVIDGYPAAMFMKRLQKILEAPAVLLLN"
FT   gene            complement(343926..346400)
FT                   /locus_tag="CpB0316"
FT   CDS_pept        complement(343926..346400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0316"
FT                   /product="glycogen phosphorylase"
FT                   /note="similar to glycogen phosphorylase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98249"
FT                   /db_xref="GOA:Q9Z8N1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8N1"
FT                   /protein_id="AAP98249.1"
FT                   /translation="MEDFSSFDKNKVSVDSMKRAILDRLYLSVVQSPESASPRDIFTAV
FT                   AKTVMEWLAKGWLKTQNGYYKNDVKRVYYLSMEFLLGRSLKSNLLNLGILDLVRKALKT
FT                   LNYDFDHLVEMESDAGLGNGGLGRLAACYLDSMATLAVPAYGYGIRYDYGIFDQRIVNG
FT                   YQEEAPDEWLRYGNPWEICRGEYLYPVRFYGRVIHYTDSRGKQVADLVDTQEVLAMAYD
FT                   IPIPGYGNDTVNSLRLWQAQSPRGFEFSYFNHGNYIQAIEDIALIENISRVLYPNDSIT
FT                   EGQELRLKQEYFLVSATIQDIIRRYTKTHICLDNLADKVVVQLNDTHPALGIAEMMHIL
FT                   VDREELPWDKAWEMTTVIFNYTNHTILPEALERWPLDLFSKLLPRHLEIIYEINSRWLE
FT                   KVGSRYPKNDDKRRSLSIVEEGYQKRINMANLAVVGSAKVNGVSSFHSQLIKDTLFKEF
FT                   YEFFPEKFINVTNGVTPRRWIALCNPRLSKLLNETIGDRYIIDLSHLSLIRSFAEDSGF
FT                   RDHWKGVKLKNKQDLTSRIYNEVGEIVDPNSLFDCHIKRIHEYKRQLMNILRVIYVYND
FT                   LKENPNQDVVPTTVIFSGKAAPGYVMAKLIIKLINSVADVVNQDSRVNDKLKVLFLPNY
FT                   RVSMAEHIIPGTDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEN
FT                   MFIFGLLEEQIVQLRREYCPQTICDKNPKIRQVLDLLEQGFFNSNDKDLFKPIVHRLLH
FT                   EGDPFFVLADLESYIAAHENVNKLFKEPDSWTKISIYNTAGMGFFSSDRAIQDYARDIW
FT                   HVPTKSCSGEGN"
FT   gene            346648..347013
FT                   /locus_tag="CpB0318"
FT   CDS_pept        346648..347013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0318"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein orf175 - Pseudomonas
FT                   stutzeri"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98250"
FT                   /protein_id="AAP98250.1"
FT                   /translation="MATVAQTPQTTQPQPSVSHKATHRYCSWVFFKPILVSLGLLLASL
FT                   TTLGLVIASGVTLSLGIGIVLAIQIVLAGIALVLAFNHIRQFKQARTAELNSMKMISAP
FT                   AAATVQKQKLEDRYSSK"
FT   gene            complement(347006..348388)
FT                   /gene="dnaA"
FT                   /locus_tag="CpB0317"
FT   CDS_pept        complement(347006..348388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CpB0317"
FT                   /product="replication initiation protein"
FT                   /note="similar to replication initiation protein dnaA -
FT                   Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98251"
FT                   /db_xref="GOA:Q9Z8M9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M9"
FT                   /protein_id="AAP98251.1"
FT                   /translation="MRAWEEFLLLQEKEIGTNTVDKWLRSLKVLCFDACNLYLEAQDSF
FT                   QITWFEEHIRHKVKSGLVNNNNKPIRVHVTSVDKAAPFYKEKQMQQEKTAYFTMHYGSV
FT                   NPEMTFSNFLVTPENDLPFRVLQEFTKSPDENGGVTFNPIYLFGPEGSGKTHLMQSAIS
FT                   VLRESGGKILYVSSDLFTEHLVSAIRSGEMQKFRSFYRNIDALFIEDIEVFSGKSATQE
FT                   EFFHTFNSLHSEGKLIVVSSSYAPVDLVAVEDRLISRFEWGVAIPIHPLVQEGLRSFLM
FT                   RQVERLSIRIQETALDFLIYALSSNVKTLLHALNLLAKRVMYKKLSHQLLYEDDVKTLL
FT                   KDVLEAAGSVRLTPLKIIRNVAQYYGVSQESILGRSQSREYVLPRQVAMYFCRQKLSLS
FT                   YVRIGDVFSRDHSTVISSIRLIEQKIEENSHDIHMAIQDISKNLNSLHKSLEFFPSEEM
FT                   II"
FT   gene            complement(348460..350832)
FT                   /locus_tag="CpB0319"
FT   CDS_pept        complement(348460..350832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0319"
FT                   /product="60kDa inner membrane protein"
FT                   /note="similar to bacterial 60kDa inner membrane protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98252"
FT                   /db_xref="GOA:Q7VQ46"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VQ46"
FT                   /protein_id="AAP98252.1"
FT                   /translation="MLFVSLIGIAFVGCQIFFGYNEFRSCKNLAEKQRKISEQTLAAVE
FT                   SVGLSVASWDTDVNGEEHKNNYAVRVGDKLFLLHNGEAAQSVYSSGESWSFVDHKCGFD
FT                   NIHLALYRQQGSSFNPTNTGKVFLPTNHEGLPVLVVEFRNNKEPLVFLGEYAQGRISNK
FT                   DSTIFGTALVFWRSGSDYIPLGLYDSREEKLVSLDLPITRAVIFGNDQDSAKSSDTANH
FT                   YVLFNDYMQIIVSEESGSIEGINLPFASTNNKSIVNEIGFDRDLASEKSPEALFPGLSS
FT                   KLPDGQQAKNSIGGYYPLLRRGLLSDSKKLLPLEYHALNVVSGRELATPVALRYRVLSY
FT                   TPHSIQLESLDRSVQKVYKLPENPEEKPYVFETAITLTKETEDVWVTSGVPEVEIMSNA
FT                   SAPTIKYRVIKKNKGSLDKVKLPKVKEPLAVRRGVYPQWILNSNGYFGIILTPLSEIAS
FT                   GYGSLYISGSTAPTRLSAISPKNQLYPVSKYPGYETLLPLPKDAGTHRFLVYAGPLAEP
FT                   TLKVLDKTITQEKGENPEYLDSISFRGVFAFITAPFAALLFIIMKFFKLVTGSWGISII
FT                   LLTVFLKLLLYPLNAWSIRSMRRMQILSPYIQQIQQKYKNEPKRAQMEIMGLYKTNKVN
FT                   PITGCLPLLIQLPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDVLFSWQTSIWFIGN
FT                   EFHLLPILLGIVMFLQQKVTSLHKKGPVTDQQKQQQVMGNMMAILFTAMFYNFPSGLNI
FT                   YWLSSMILGVVQQWITNKILDSKHLKNEVVLNNKKHR"
FT   gene            complement(350986..351852)
FT                   /locus_tag="CpB0320"
FT   CDS_pept        complement(350986..351852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0320"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="similar to prolipoprotein diacylglyceryl transferase
FT                   - Staphylococcus aureus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98253"
FT                   /db_xref="GOA:Q9K266"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K266"
FT                   /protein_id="AAP98253.1"
FT                   /translation="MAVIYWDRSKIVWSFEPWSLRLTWYGVFFTVGIFLACLSARYLAL
FT                   SYYGLKDHLSFSKSQLRVALENFFIYSILFIVPGARLAYVIFYGWSFYLQHPEEIIQIW
FT                   HGGLSSHGGVLGFLLWAAIFSWIYKKKISKLTFLFLTDLCGSVFGIAAFFIRLGNFWNQ
FT                   EIVGTPTSLPWGVVFSDPMQGVQGVPVHPVQLYEGISYLVVSGILYFLSYKRYLHLGKG
FT                   YVTSIACISVAFIRFFAEYVKSHQGKVLAEDCLLTIGQILSIPLFLFGVALLIICSLKA
FT                   RRHRSHI"
FT   gene            351938..352393
FT                   /locus_tag="CpB0321"
FT   CDS_pept        351938..352393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0321"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT101 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98254"
FT                   /protein_id="AAP98254.1"
FT                   /translation="MARNIKYFLILFPGILWISAGMKLLLKATAIALDPLSSFFTYCLL
FT                   SMVSWGLASLKHRYLLSKTIRKQLSLSSEFFSQKITWIAYIKQTFISRRFLIMVIMIAF
FT                   SLVLRRYISNPQALFVIRATVGYALIKTAIAYFSKLQNALMENPEGN"
FT   gene            352404..352772
FT                   /locus_tag="CpB0323"
FT   CDS_pept        352404..352772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0323"
FT                   /product="putative acyl-carrier protein synthase"
FT                   /note="similar to probable acyl-carrier protein synthase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98255"
FT                   /db_xref="GOA:Q9Z8M5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M5"
FT                   /protein_id="AAP98255.1"
FT                   /translation="MEIIHIGTDIIEISRIREAIATHGNRLLNRIFTEAEQKYCLEKTD
FT                   PIPSFAGRFAGKEAVAKALGTGIGSVVAWKDIEVFKVSHGPEVLLPSHVYAKIGISKVI
FT                   LSISHCKEYATATAIALA"
FT   gene            complement(352764..353699)
FT                   /locus_tag="CpB0322"
FT   CDS_pept        complement(352764..353699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0322"
FT                   /product="thioredoxin reductase"
FT                   /note="similar to thioredoxin reductase - Neurospora
FT                   crassa"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98256"
FT                   /db_xref="GOA:Q9Z8M4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M4"
FT                   /protein_id="AAP98256.1"
FT                   /translation="MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLM
FT                   TTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKTLAQDIISVDFSVRPFILKSKEETY
FT                   SCDACIIATGASAKRLEIPGAGNDEFWQKGVTACAVCDGASPIFKNKDLYVIGGGDSAL
FT                   EEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVD
FT                   IKNVQTQEITTREAAGVFFAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAA
FT                   GDVQDKYYRQAVTSAGSGCIAALDAERFLG"
FT   gene            354164..354334
FT                   /locus_tag="CpB0324"
FT   CDS_pept        354164..354334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98257"
FT                   /protein_id="AAP98257.1"
FT                   /translation="MTRHIYDNYHTYFIKSGNIEKLKKRPYTSLERKYRILRLIRLYRT
FT                   NRLLQGRSCLF"
FT   gene            354391..356133
FT                   /locus_tag="CpB0325"
FT   CDS_pept        354391..356133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0325"
FT                   /product="ribosomal protein S1"
FT                   /note="similar to ribosomal protein S1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98258"
FT                   /db_xref="GOA:Q9Z8M3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M3"
FT                   /protein_id="AAP98258.1"
FT                   /translation="MPKQAEYTWGSKKILDNIECLTEDVAEFKDLLYTAHRITSSEEES
FT                   DNEIQPGAILKGTVVDINKDFVVVDVGLKSEGVIPMSEFIDSSEGLVLGAEVEVYLDQA
FT                   EDEEGKVVLSREKATRQRQWEYILAHCEEGSIVKGQITRKVKGGLIVDIGMEAFLPGSQ
FT                   IDNKKIKNLDDYVGKVCEFKILKINVERRNIVVSRRELLEAERISKKAELIEQISIGEY
FT                   RKGVVKNITDFGVFLDLDGIDGLLHITDMTWKRIRHPSEMVELNQELEVIILSVDKEKG
FT                   RVALGLKQKEHNPWEDIEKKYPPGKRVLGKIVKLLPYGAFIEIEEGIEGLIHISEMSWV
FT                   KNIVDPSEVVNKGDEVEAIVLSIQKDEGKISLGLKQTERNPWDNIEEKYPIGLHVNAEI
FT                   KNLTNYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNSVEAVILSVDKESKKIT
FT                   LGVKQLSSNPWNEIEAMFPAGTVISGVVTKITAFGAFVELQNGIEGLIHVSELSDKPFA
FT                   KIEDIISIGENVSAKVIKLDPDHKKVSLSVKEYLADNAYDQDSRTELDFKDSQGPKERK
FT                   KKGK"
FT   gene            356234..357538
FT                   /locus_tag="CpB0326"
FT   CDS_pept        356234..357538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0326"
FT                   /product="transcription termination-antitermination factor"
FT                   /note="similar to transcription termination-antitermination
FT                   factor - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98259"
FT                   /protein_id="AAP98259.1"
FT                   /translation="MNKNLVAIFDYMEKEKGIQRSTIIGAIESALKIAAKKTLRDDANI
FT                   SVNINSRTGDIEVFCEKEIVEICQNPSKEIPLDKAREYDPDCQIGQYMDVPFVSDNFGR
FT                   IAAHAARQIIGQKLRHAERDVIYEEYRHRVNETLSGVVKRFAKGSNLIIDLGKVEAILP
FT                   TRFYPKTEKHKIGDKIYALLYEVQESENGGAEVILSRSHAEFVKQLFIQEVPELEEGSV
FT                   EIVKIAREAGYRTKLAVRSSDPKTDPVGAFVGMRGSRVKNIIRELNDEKIDIVNYSPVS
FT                   TELLQNLLYPIEIQKIAILEDDKVIAIVVNDADYATVIGKRGINARLISHILDYELEVQ
FT                   RMSEYNKLLEIQRLQLAEFDSPHLDQPLEMEGISKLVIQNLEHAGYDTIRRVLLASAND
FT                   LASVPGISLELAYKILEQVSKYGESKVDEKPEIED"
FT   gene            357477..360167
FT                   /locus_tag="CpB0327"
FT   CDS_pept        357477..360167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0327"
FT                   /product="translation initiation factor IF-2"
FT                   /note="similar to translation initiation factor IF-2 -
FT                   Bacillus stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98260"
FT                   /db_xref="GOA:Q9Z8M1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M1"
FT                   /protein_id="AAP98260.1"
FT                   /translation="MSKSANMEKVKLTKNLKLKIKNAQLTKAAGLDKLKQKLAQAGSSE
FT                   AKSSSEKPSAKEKSVKVALAATSTPTASAEQASPESTSRRIRAKNRSSFSSSEEESSAH
FT                   IPVDTSEPAPVSIADPEPELEVVDEVCDESPEVHPVAEVLPEQPVLPETPPQEKELEPK
FT                   PVKPAEPKSVVMIKSKFGPTGKHINHLLAKTFKAPAKEEKVVAGSKSTKPVASDKTGKP
FT                   GTSEGGEQNNREKQFNPANRSPASGPKRDAGKKNLTDFRDRSKKSDESLKAFTGRDRYG
FT                   LNEGGEEDRWRKKRVYKPKKHYDEASIQRPTHIKISLPITVKDLAAEMKLKASEVIQKL
FT                   FIHGMTYVVNDILDSETAVQFIGLEFGCTIDIDYSEQDKLCLSNDTVRDEIQSTDPSKL
FT                   VIRSPIVAFMGHVDHGKTTLIDSLRKSNVAATEAGAITQHMGAFCCSTPVGDITILDTP
FT                   GHEAFSAMRARGAEVCDIVVLVVAGDEGIKEQTLEAIEHAKAADIAIVVAINKCDKPNF
FT                   NSETIYRQLSEINLLPEAWGGSTVTVNTSAKTGEGLSELLEMLALQAEVLELKADPSAR
FT                   ARGLVIESELHKGLGPVATVLIQNGSLKLGEALVFNDCYGKVKTMHNEHNELMKEAGPS
FT                   IPVLITGLSDIPKAGDPFFVVKNEKTARDIIEARSAGQQRFALQQKKRPNFDSMLQNKK
FT                   TLKLMIKADVQGSIEALVSSISKIKSEKVDVEILTNSVGEISESDIRLAAASKAVLIGF
FT                   HTGIESHAEPLIKSLGVRVELFTVIYHAIDAIKEIMTSLLDPIAEEKDEGSAEIKEIFR
FT                   SSQVGSIYGCIVTEGIMTRNHKVRVLRNKEILWKGTLSSLKRVKEDVKEVRKGLECGIL
FT                   LEGYQQAQIGDVLQCYEVIYHPQKL"
FT   gene            360181..360543
FT                   /gene="rbfA"
FT                   /locus_tag="CpB0328"
FT   CDS_pept        360181..360543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CpB0328"
FT                   /product="ribosome-binding factor A"
FT                   /note="similar to ribosome-binding factor A rbfA - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98261"
FT                   /db_xref="GOA:Q9Z8M0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8M0"
FT                   /protein_id="AAP98261.1"
FT                   /translation="MTENRRIKRVNALLQEAIAKVILKDVKHPKISNLWITVTRVSLSK
FT                   DLHSARVYVSVMPHENTKEEALEALKVSAGFIAHRASKNVVLKYFPELHFYLDDIFSPQ
FT                   DYIENLLWQIQEKEKS"
FT   gene            360589..361296
FT                   /locus_tag="CpB0329"
FT   CDS_pept        360589..361296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0329"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /note="similar to tRNA pseudouridine 55 synthase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98262"
FT                   /db_xref="GOA:Q9Z8L9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L9"
FT                   /protein_id="AAP98262.1"
FT                   /translation="MDLAVELKEGILLVDKPQGRTSFSLIRALTKLIGVKKIGHAGTLD
FT                   PFATGVMVMLIGRKFTRLSDILLFEDKEYEAIAHLGTTTDSYDCDGKVVGRSKKIPSLE
FT                   EVLSAAEYFQGEIQQLPPMFSAKKVQGKKLYEYARKGLSIERHHSTVQVHLQITKYEYP
FT                   LLHFVVSCSKGTYIRSIAHELGTMLGCGAYLEQLRRLRSGRFSIDECIDGNLLDHPDFD
FT                   ISPYLRDAHGNSL"
FT   gene            361280..362200
FT                   /gene="ribC"
FT                   /locus_tag="CpB0331"
FT   CDS_pept        361280..362200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="CpB0331"
FT                   /product="riboflavin kinase"
FT                   /note="similar to riboflavin kinase/FAD synthase - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98263"
FT                   /protein_id="AAP98263.1"
FT                   /translation="MEIAYSLTSSFSVDSVTVGFFDGCHLGHSNLLSILTSYSGSSGVI
FT                   TFDSHPQTVLSLNHTKLINTKEERLQLLQTFPIDWLGVLTFDLNFANQSAEEFLTLLHR
FT                   NLKCKRLILGYDSCIGKEQQSNTEALDTIGKPLGIEVIKIPPYRMDNIVVSSKAIRQFL
FT                   SAGNLECAHRFLGHPYAISGKITEGSGIGGSLGFATINLPREESLIPLGVYACEIRYDS
FT                   TTCQGVMNLGTAPTFGRESLYAEAHIFSFAENLYGKEVSIIPRKFLREEKKFQSKETLI
FT                   RAIEKDILDAQDWFAKGSFNYEGTA"
FT   gene            complement(362178..363272)
FT                   /locus_tag="CpB0330"
FT   CDS_pept        complement(362178..363272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0330"
FT                   /product="putative GTP-binding protein"
FT                   /note="similar to probable GTP-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98264"
FT                   /protein_id="AAP98264.1"
FT                   /translation="MSHTECGIVGLPNVGKSGLFNALTGAQVASCNYPFCTIDPNVGIV
FT                   PVIDERLEALAKISNSQKIIYADMKFVDIAGLVKGASDGAGLGNRFLSHIRETHAIAHV
FT                   VRCFDDPDVTHVSGKVNPVEDIEVINLELIFSDFSSAKNIHSKLEKLAKGKREVGALLP
FT                   LFDTIIAHLEKGLPLRTLELTPEQIVALKPYPFLTMKPMFYIANVDESSLPDMDNDYVA
FT                   AVREVAAKENSKVVPICVRIEEEIVSLPIEERLEFLMSLGLEKSGLHRLVRAAYDTLGL
FT                   ISYFTTGPQESRAWTVVRGSSAWEAAGEIHTDIQKGFIRAEVITFEDMIECQGRAAARE
FT                   LGKLHIEGRDYIVQDGDTMLFLHN"
FT   gene            363663..364745
FT                   /locus_tag="CpB0332"
FT   CDS_pept        363663..364745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0332"
FT                   /product="YopU"
FT                   /note="type III secretion protein; similar to YopU type III
FT                   secretion protein - Chlamydia psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98265"
FT                   /protein_id="AAP98265.1"
FT                   /translation="MGEKTEKATPKRLRDARKKGQVAKSQDFPSAVTFIVSMFTAFSLS
FT                   TFFFKHLGGFLVSMLSQAPTRHDPVITLFYLKNCLMLILTASLPLLGAVAVVGVIVGFL
FT                   IVGPTFSTEVFKPDIKKFNPIENIKQKFKIKTLIELIKSILKIFGAALILYITLKSKVS
FT                   LIIETAGVSPIITAQIFKEIFYKAVTSIGIFFLIVAILDLVYQRHNFAKELKMEKFEVK
FT                   QEFKDTEGNPEIKGRRRQIAQEIAYEDSSSQVKHASTVVSNPKDIAVAIGYMPEKYKAP
FT                   WIIAMGINLRAKRILDEAEKYGIPIMRNVPLAHQLLDEGKELKFIPESTYEAIGEILLY
FT                   ITSLNAQNPNNKNTNQPDHL"
FT   gene            364745..366877
FT                   /gene="lcrD"
FT                   /locus_tag="CpB0333"
FT   CDS_pept        364745..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcrD"
FT                   /locus_tag="CpB0333"
FT                   /product="low calcium response D"
FT                   /note="similar to low calcium response D lcrD protein -
FT                   Yersinia enterocolitica"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98266"
FT                   /protein_id="AAP98266.1"
FT                   /translation="MNKLLNFVSRTLGGDTALNMINKSSDLILALWMMGVVLMIIIPLP
FT                   PPIVDLMITINLSISVFLLMVALYIPSALQLSVFPSLLLITTMFRLGINISSSRQILLK
FT                   AYAGHVIQAFGDFVVGGNYVVGFIIFLIITIIQFIVVTKGAERVAEVAARFRLDAMPGK
FT                   QMAIDADLRAGMIDATQARDKRAQIQKESELYGAMDGAMKFIKGDVIAGIVISLINIVG
FT                   GLTIGVAMHGMDLAQAAHVYTLLSIGDGLVSQIPSLLIALTAGIVTTRVSSDKNTNLGK
FT                   EISTQLVKEPRALLLAGAATLGVGFFKGFPLWSFSILALIFVALGILLLTKKSAAGKKG
FT                   GGSGASTTVGAAGDGAATVGDNPDDYSLTLPVILELGKDLSKLIQHKTKSGQSFVDDMI
FT                   PKMRQALYQDIGIRYPGIHVRTDSPSLEGYDYMILLNEVPYVRGKIPPHHVLTNEVEDN
FT                   LSRYNLPFITYKNAAGLPSAWVSEDAKAILEKAAIKYWTPLEVIILHLSYFFHKSSQEF
FT                   LGIQEVRSMIEFMERSFPDLVKEVTRLIPLQKLTEIFKRLVQEQISIKDLRTILESLSE
FT                   WAQTEKDTVLLTEYVRSSLKLYISFKFSQGQSAISVYLLDPEIEEMIRGAIKQTSAGSY
FT                   LALDPDSVNLILKSMRNTITPTPAGGQPPVLLTAIDVRRYVRKLIETEFPDIAVISYQE
FT                   ILPEIRIQPLGRIQIF"
FT   gene            366906..368105
FT                   /gene="copN"
FT                   /locus_tag="CpB0334"
FT   CDS_pept        366906..368105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copN"
FT                   /locus_tag="CpB0334"
FT                   /product="CopN"
FT                   /note="similar to CopN - Chlamydia psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98267"
FT                   /protein_id="AAP98267.1"
FT                   /translation="MAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVVASQEGSEMNMI
FT                   QQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDTDLADKYASGN
FT                   SEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTPPSQGKLKEA
FT                   LIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDTHTCDQLLS
FT                   MLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVLTSYDYFE
FT                   SRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIGDDVDSV
FT                   TGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPKPYPWS
FT                   "
FT   gene            368122..368565
FT                   /gene="scc1"
FT                   /locus_tag="CpB0335"
FT   CDS_pept        368122..368565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scc1"
FT                   /locus_tag="CpB0335"
FT                   /product="Scc1"
FT                   /note="putative chaperone of type III secretory pathway;
FT                   similar to putative chaperone of type III secretory pathway
FT                   scc1 - Chlamydia psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98268"
FT                   /protein_id="AAP98268.1"
FT                   /translation="MQNQYEQLLESLAPLLNTTLAPDKNNSCLIRFSDTHVPVQIEEDG
FT                   NSGDLAVSTLLGTLPENVFRERIFKAALSVNGSFQSSIKGILGYGEVTQQLYLSDILSM
FT                   NYLNGEKLFEYLKLFSLHAKIWMESLRTGNLPDLHVLGIYYVA"
FT   gene            368562..370142
FT                   /locus_tag="CpB0336"
FT   CDS_pept        368562..370142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0336"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="similar to 4-alpha-glucanotransferase - Clostridium
FT                   butyricum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98269"
FT                   /db_xref="GOA:Q9Z8L2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L2"
FT                   /protein_id="AAP98269.1"
FT                   /translation="MNVLKYTKHSPSAHAWKLIGTSPKHGIYLPLFSIHTKNSCGIGEF
FT                   LDLIPLISWCQKQGFSVIQLLPLNDTGEDTSPYNSISSVALNPLFLSLSSLPNIDTIPE
FT                   VAKKLQDMHELCSTPSVSYTQVKEKKWAFLREYYQKCCKSSLEGNSNFSEFLESERYWL
FT                   YPYGTFRAIKHHMHGEPINNWPKSLTDQENFPDLTKKFHDEVLFFSYLQFLCYQQLCEV
FT                   KAYADQHHVLLKGDLPILISKDSCDVWYFRDYFSSSRSVGAPPDLYNSEGQNWHLPIYN
FT                   FSQLAKDDYIWWKERLRYAQNFYSVYRLDHIIGFFRLWIWDSSGRGRFIPDNPKDYIKQ
FT                   GTEILSTMLGASSMLPIGEDLGIIPQDVKTTLTHLGICGTRIPRWERNWESDSAFIPLK
FT                   DYNPLSVTTLSTHDSDTFAQWWLNSPKEAKQFAKFLHLPFQKTLTTETQIDILKLSHES
FT                   ASIFHINLFNDYLALCPDLVSKNLQRERINTPGTISKKNWSYRVRPSLEELAIHKKFNG
FT                   YIEKILTGL"
FT   gene            370359..370628
FT                   /locus_tag="CpB0337"
FT   CDS_pept        370359..370628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0337"
FT                   /product="ribosomal protein L28"
FT                   /note="similar to ribosomal protein L28 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98270"
FT                   /db_xref="GOA:Q9Z8L1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L1"
FT                   /protein_id="AAP98270.1"
FT                   /translation="MSRKCPLTGKRPRRGYSYTLRGIAKKKKGIGLKVTGKTKRRFFPN
FT                   MLTKRLWSTEENRFLKLKISASALRHIDKLGLEKVLERAKSKNF"
FT   gene            370655..372409
FT                   /locus_tag="CpB0338"
FT   CDS_pept        370655..372409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0338"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT085 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98271"
FT                   /db_xref="GOA:Q9Z8L0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8L0"
FT                   /protein_id="AAP98271.1"
FT                   /translation="MSFLRRHISLFRSQKQLIDVFAPVSPNLELAEIHRRVIEDQGPAL
FT                   LFHNVIGSSFPVLTNLFGTKHRVDQLFSQAPDNLIARVAHLISSTPKLSSLWKSRDLLK
FT                   RISSLGLKKARFRRFPFVSMSSVNLDHLPLLTSWPEDGGAFLTLPLVYTESPTLTTPNL
FT                   GMYRVQRFNQNTMGLHFQIQKGGGMHLYEAEQKKQNLPVSVFLSGNPFLTLSAIAPLPE
FT                   NVSELLFATFLQGAKLLYKKTNDHPHPLLYDAEFILVGESPAGKRRPEGPFGDHFGYYS
FT                   LQHDFPEFHCHKIYHRKDAIYPATVVGKPYQEDFYIGNKLQEYLSPLFPLVMPGVRRLK
FT                   SYGESGFHALTAAVVKERYWRESLTTALRILGEGQLSLTKFLMVTDQEVPLDRFSVVLE
FT                   TILERLQPDRDLIIFSETANDTLDYTGPSLNKGSKGIFMGIGKAIRDLPHGYQGGKIHG
FT                   VQDIAPFCRGCLVLETSLEDRCIKSLLHHPDLKSWPLIILADNLRETIQSEKDFLWRTF
FT                   TRCAPANDLHALHSHFATHRPNYNFPFVIDALMKPSYPKEVEVDPSTKQKVSERWHAYF
FT                   PNKETFYI"
FT   gene            372502..373563
FT                   /locus_tag="CpB0339"
FT   CDS_pept        372502..373563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0339"
FT                   /product="putative phopholipase D"
FT                   /note="leader (33) peptide; similar to probable
FT                   phopholipase D, leader (33) peptide - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98272"
FT                   /protein_id="AAP98272.1"
FT                   /translation="MNKRQKDKLKICVIISTLILVGIFARAPRGDTFKTFLKSEEAIIY
FT                   SNQCNKDMRKILCDAIEHADEEIFLRIYNLSEPKIQQSLTRQAQAKNKVTIYYQKFKIP
FT                   QILKQASNVTLVEQPPAGRKLMHQKALSIDKKDAWLGSANYTNLSLRLDNNLILGMHSS
FT                   ELCDLIITNTSGDFSIKDQTGKYFVLPQDRKIAIQAVLEKIQTAQKTIQVAMFALTHSE
FT                   IIQALHQAKQRGIHVDIIIDRSHSKLTFKQLRQLNINKDFVSINTAPCTLHHKFAVIDN
FT                   KTLLAGSINWSKGRFSLNDESLIILENLTKQQNQKLRMIWKDLAKHSEHPTVDDEEKEI
FT                   IEKSLPVEEQEAA"
FT   gene            complement(373613..374089)
FT                   /locus_tag="CpB0340"
FT   CDS_pept        complement(373613..374089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0340"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT083 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98273"
FT                   /protein_id="AAP98273.1"
FT                   /translation="MRIIRFDPYGALSAQSIAKDSRQNSPLVEKISEEIATNEAIRLAL
FT                   LAIGDREQEEKKQRHRYKLLGQKQAKVLLSQLRHVHLDFKKLYCDSKKKEDQEKDEKNK
FT                   QKRSIKVTKKKKGISLGAAASQAIAAAAEAWVIARNKGVLETASTLFYQKDEEA"
FT   gene            complement(374112..375851)
FT                   /locus_tag="CpB0341"
FT   CDS_pept        complement(374112..375851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0341"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT082 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98274"
FT                   /protein_id="AAP98274.1"
FT                   /translation="MAVSGGGGVQPSSDPGKWNPALQGEQAEGPSPLKESIFSETKQAS
FT                   SAAKQESLVRSGSTGMYATESQINKAKYRKAQDRSSTSPKSKLKGTFSKMRASVQGFMS
FT                   GFGSRASRVSAKRASDSGEGTSLLPTEMDVALKKGNRISPEMQGFFLDASGMGGSSSDI
FT                   SQLSLEALKSSAFSGARSLSLSSSESSSVASFGSFQKAIEPMSEEKVNAWTVARLGGEM
FT                   VSSLLDPNVETSSLVRRAMATGNEGMIDLSDLGQEEVSTAMTSPRAVEGKVKVSSSDSP
FT                   EANPTGIPNSNTLERAEKEAEKQESREQLSEDQMMLARAMAGLLTGAAPQEVLSNSVWS
FT                   GPSTVFPPPKFSGTLPTQRSGDKSKHKSPGIEKSTNHTNFSPLREGTVKSAEVKSLPHP
FT                   ESMYRFPKDSIVSREEPEAVVKESTAFKNPENSSQNFLPIAVESVFPKESGTGGALGSD
FT                   AVSSSYHFLAQRGVSLLAPLPRATDDYKEKLEAHKGPGGPPDPLIYQYRNVAVEPPIVL
FT                   RSPQPFSGSSRLSVQGKPEAASVHDDGGGGNSGGFSGDQRRGSSGQKASRQEKKGKKLS
FT                   TDI"
FT   gene            complement(376211..376504)
FT                   /gene="ltuB"
FT                   /locus_tag="CpB0342"
FT   CDS_pept        complement(376211..376504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltuB"
FT                   /locus_tag="CpB0342"
FT                   /product="LtuB"
FT                   /note="similar to LtuB - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98275"
FT                   /db_xref="InterPro:IPR020502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K5"
FT                   /protein_id="AAP98275.1"
FT                   /translation="MGKPKKSRTDRALAQEIQKKSTEVLKKPARIKAKNRRKFLIAKEQ
FT                   KTLKHRAQEYDQLVRSLLDSQKKDTDKVLIFNYENGFVFTDKDHFSKYSIRL"
FT   gene            376725..377240
FT                   /locus_tag="CpB0343"
FT   CDS_pept        376725..377240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0343"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT079 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98276"
FT                   /protein_id="AAP98276.1"
FT                   /translation="MSVHITPRKCFILCILSMFTLPTLFPKAHLILFSPYIVLCFYCFS
FT                   KDKGLVLALGCGVLSDLALGSRGVFLLLYPLTALITHKAHLIFSKESKAALVIVNMIFY
FT                   GVFLLLTIPMCALFGHEVRWSIDVLMIPLKCSFLDNLIFTSVIYILPCAINSGIHKMIS
FT                   FFRRLVCY"
FT   gene            377231..378091
FT                   /locus_tag="CpB0344"
FT   CDS_pept        377231..378091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0344"
FT                   /product="methylene-tetrahydrofolate dehydrogenase"
FT                   /note="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98277"
FT                   /db_xref="GOA:Q9Z8K3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K3"
FT                   /protein_id="AAP98277.1"
FT                   /translation="MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVG
FT                   MKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLNQDPSIHGILVQLPLPKHLDSEVIL
FT                   QAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIPLRGRHAAIVGRSN
FT                   IVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPH
FT                   AVIVDVGTTRVPADNAKGYTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRC
FT                   YQNFS"
FT   gene            378064..379008
FT                   /gene="apbE"
FT                   /locus_tag="CpB0346"
FT   CDS_pept        378064..379008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="CpB0346"
FT                   /product="thiamine biosynthesis lipoprotein precursor"
FT                   /note="similar to thiamine biosynthesis lipoprotein
FT                   precursor - Salmonella typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98278"
FT                   /db_xref="GOA:Q9Z8K2"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K2"
FT                   /protein_id="AAP98278.1"
FT                   /translation="MAMLPKFFLVLLCLGLCSCSQKTTTIEGEQMTIFYRIVLGTSLSA
FT                   KEKASLSQQIDRCFHKIDSIYNNWNPYSELSIINRAPADVPITLSVELSEFLDQVDTLY
FT                   KLSEGRFDPTVGPLKTLWLLHLKSQTLPPKDVWEQHYKDMGWQHLEFQSNTKTLIKKNP
FT                   HVQIDLCGVVKGYAVDCLNEICNTFCPNNYVEWGGEIKTSGHHPSGRPWRIFSEAAGTI
FT                   LDIDDMAIATSGNHIQKWCVEGKIYTHILDTRTGKPLELSSYPIQSVSVVHPSCAYADA
FT                   IATVLMTFDSKIEAKQWAEEHHILTYINDGASS"
FT   gene            complement(378986..379483)
FT                   /gene="smpB"
FT                   /locus_tag="CpB0345"
FT   CDS_pept        complement(378986..379483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="CpB0345"
FT                   /product="SmpB"
FT                   /note="similar to small protein smpB family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98279"
FT                   /db_xref="GOA:Q9Z8K1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K1"
FT                   /protein_id="AAP98279.1"
FT                   /translation="MLYWFLSPIMGEDLMAQKEIVSNRKALRNYEVIETLEAGIVLTGT
FT                   EIKSLRDHGGNLGDAYVIVSKGEGWLLNASIAPYRFGNIYNHEERRKRKLLLHRYELRK
FT                   LEGKIAQKGMTLIPLGMLLSRGYVKVRLGCCRGKKAYDKRRTIIEREKEREVAAAMKRR
FT                   HH"
FT   gene            379692..380792
FT                   /locus_tag="CpB0347"
FT   CDS_pept        379692..380792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0347"
FT                   /product="DNA-directed DNA polymerase III beta chain"
FT                   /note="similar to DNA-directed DNA polymerase III, beta
FT                   chain - Salmonella typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98280"
FT                   /db_xref="GOA:Q9Z8K0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8K0"
FT                   /protein_id="AAP98280.1"
FT                   /translation="MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFT
FT                   ATDLTVSTRCVTKAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSC
FT                   FRLLSMEKEDFPMLPDIQNALRFSLPAEQLKTMLQRTSFAVSREESRYVLTGVLLAIAN
FT                   GVATIVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEATIFLDQDKI
FT                   AVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQVALFTNESSHSVK
FT                   FSFLPGELTLTANCTKVGEGKVSMAVNYSGELLEIAFNPFFFLDILKHSKDELVSLGIS
FT                   DSYNPGIITDSASGLFVIMPMRLHDD"
FT   misc_feature    380834..381912
FT                   /note="similar to Bacillus subilis RecF; contains
FT                   frameshift"
FT   gene            382036..383013
FT                   /locus_tag="CpB0351"
FT   CDS_pept        382036..383013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0351"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT073 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98281"
FT                   /protein_id="AAP98281.1"
FT                   /translation="MKKFLLTILFLAVGNPLFSETSVIQTLPSGIGGLKETSKQKESVV
FT                   CVHAFLRSYTSLKPIARVLEKEHYDVFIWNYETRKFTLEKHAEHLNRLLKKIAELKPGV
FT                   PINFVTHSIGGVIVRVALAHPDCPEEAKKGKAILMAPPNAGSTLARRYRCVKFVQFVFG
FT                   GKLGRQLLTYCPTKMLNVGKLPSSLDVLILSGNRHSKFLPFRLPYENDGKVCTIETKLD
FT                   TPHKAYVIHTSHTYIITNRKSLYLMKEFLKEGNTTPIIEHVPEAALEQTVMEDKQKNSR
FT                   LKPYPNQDIYVIHCFGSRPYNLYGFPKKWSLNQKNEINPEKLEK"
FT   gene            complement(382970..384835)
FT                   /locus_tag="CpB0350"
FT   CDS_pept        complement(382970..384835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0350"
FT                   /product="putative metalloproteinase"
FT                   /note="similar to probable metalloproteinase - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98282"
FT                   /db_xref="GOA:Q9K275"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K275"
FT                   /protein_id="AAP98282.1"
FT                   /translation="MTIIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPA
FT                   LFKKRIGGIEYRIGCIPFGGYVRIRGMERTKEKGEKGKIDSVYDIPQGFFSKSPWKRIL
FT                   VLVAGPLANILLAVLAFSILYMNGGRSKNYSDCSKVVGWVHPVLQAEGLLPGDEILTCN
FT                   GKPYVGDKDMLTTSLLEGHLNLEIKRPGYLTVPSKEFAIDVEFDPTKFGVPCSGASYLL
FT                   YGNQVPLTKNSPMENSELRPNDRFVWMDGTLLFSMAQISQILNESYAFVKVARNDKIFF
FT                   SRQPRVLASVLHYTPYLRNELIDTQYEAGLKGKWSSLYTLPYVINSYGYIEGELTAIDP
FT                   ESPLPQPQERLQLGDRILAIDGTPVSGSVDILRLVQNHRVSIIVQQMSPQELEEVNSRD
FT                   ADKRFIASYHSEDLLQILNHLGESHPVEVAGPYRLLDPVQPRPWIDVYSSESLDKQLEV
FT                   AKKIKNKDKQRYYLERLDAEKQKPSLGISLKDLKVRYNPSPVVMLSNITKESLITLKAL
FT                   VTGHLSPQWLSGPVGIVQVLHTGWSVGFSEVLFWIGLISMNLAVLNLLPIPVLDGGYIL
FT                   LCLWEIVTRRRLNMKIVERILVPFTFLLIIFFIFLTFQDLFRFFG"
FT   gene            complement(384848..385987)
FT                   /locus_tag="CpB0352"
FT   CDS_pept        complement(384848..385987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0352"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT071 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98283"
FT                   /db_xref="GOA:Q9Z8J8"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J8"
FT                   /protein_id="AAP98283.1"
FT                   /translation="MKHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQ
FT                   QLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEAL
FT                   PAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIE
FT                   GIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEA
FT                   YWLFGLENIEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPR
FT                   DGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSSGSFFNAANEVLVRRFLCEEISW
FT                   CDILRKLTTLMECHKVYACHSLEDILEVDGEARALAQEI"
FT   gene            complement(386116..387090)
FT                   /locus_tag="CpB0353"
FT   CDS_pept        complement(386116..387090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0353"
FT                   /product="putative integral membrane protein"
FT                   /note="similar to probable integral membrane protein -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98284"
FT                   /db_xref="GOA:Q9Z8J7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J7"
FT                   /protein_id="AAP98284.1"
FT                   /translation="MALGPSPYYGVSFFQFFSVFFSRLFSGSLFTGSLYIDDIQIIVFL
FT                   AISCSGAFAGTFLVLRKMAMYANAVSHTVLFGLVCVCLFTHQLTTLSLGTLTLAAMATA
FT                   MLTGFLIYFIRNTFKVSEESSTALVFSLLFSLSLVLLVFMTKNAHIGTELVLGNADSLT
FT                   KEDIFPVTIVILANAVITIFAFRSLVCSSFDSVFASSLGIPIRLVDYLIIFQLSACLVG
FT                   AFKAVGVLMALAFLIIPSLIAKVIAKSIRSLMAWSLVFSIGTAFLAPASSRAILSAYDL
FT                   GLSTSGISVVFLTMMYIVVKFISYFRGYFSKNFEKISEKSSQY"
FT   gene            complement(387090..388445)
FT                   /locus_tag="CpB0354"
FT   CDS_pept        complement(387090..388445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0354"
FT                   /product="putative integral membrane protein"
FT                   /note="similar to probable integral membrane protein -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98285"
FT                   /db_xref="GOA:Q9Z8J6"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J6"
FT                   /protein_id="AAP98285.1"
FT                   /translation="MLIMLSCVFSDTIFLSSFLAVTLICMTTALWGTILLISKQPLLSE
FT                   SLSHASYPGLLVGALMAQYVFSLQASIFWIVLFGCAASVFGYGIIVFLGKVCKLHKDSA
FT                   LCFVLVVFFAIGVILASYVKESSPTLYNRINAYLYGQAATLGFLEATLAAIVFCASLFA
FT                   LWWWYRQIVVTTFDKDFAVTCGLKTVLYEALSLIFISLVIVSGVRSVGIVLISAMFVAP
FT                   SLGARQLSDRLSTILILSAFFGGISGALGSYISVAFTCRAIIGQQAVPVTLPTGPLVVI
FT                   CAGLLAGLCLLFSPKSGWVIRFVRRKHFSFSKDQEHLLKVFWHISHNRLENISVRDFVC
FT                   SYKYQEYFGPKPFPRWRVQILEWRGYVKKEQDYYRLTKKGRSEALRLVRAHRLWESYLV
FT                   NSLDFSKESVHELAEEIEHVLTEELDHTLTEILNDPCYDPHRQIIPNKKKEV"
FT   gene            complement(388439..389218)
FT                   /locus_tag="CpB0355"
FT   CDS_pept        complement(388439..389218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0355"
FT                   /product="ABC transporter"
FT                   /note="similar to ABC transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98286"
FT                   /db_xref="GOA:Q9Z8J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J5"
FT                   /protein_id="AAP98286.1"
FT                   /translation="MNVKDETFWSVHNLCVNYEHAAVLYHISFSLGKGSLTAILGPNGA
FT                   GKSTLLKASLGLIKPSSGTVYFFNQKFKKVRQRIAYMPQRASVDWDFPMTVLDLALMGC
FT                   YSYKGMWGRISSDDRREAFHILERVGLESVADRQIGQLSGGQQQRAFLARALMQKADLY
FT                   LMDELFSAIDMASFKTSVGVLQELRDQGKTIVVVHHDLSHVRQLFDHVVLLNKRLICCG
FT                   PTDECLNGDTIFQTYGCEIELLEQTLKLSRGKQFGSC"
FT   gene            complement(389202..390173)
FT                   /locus_tag="CpB0356"
FT   CDS_pept        complement(389202..390173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0356"
FT                   /product="periplasmic substrate binding protein TroA"
FT                   /note="similar to periplasmic substrate binding protein
FT                   TroA - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98287"
FT                   /db_xref="GOA:Q9Z8J4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J4"
FT                   /protein_id="AAP98287.1"
FT                   /translation="MGYIFKVMRWIFCFVACGITFGCTNSGFQNANSRPCILSMNRMIH
FT                   DCVERVVGNRLATAVLIKGSLDPHAYEMVKGDKDKIAGSAVIFCNGLGLEHTLSLRKHL
FT                   ENNPNSVKLGERLIARGAFVPLEEDGICDPHIWMDLSIWKEAVIEITEVLIEKFPEWSA
FT                   EFKANSEELVCEMSILDSWAKQCLSTIPENLRYLVSGHNAFSYFTRRYLATPEEVASGA
FT                   WRSRCISPEGLSPEAQISVRDIMAVVDYINEHDVSVVFPEDTLNQDALKKIVSSLKKSH
FT                   LVRLAQKPLYSDNVDDNYFSTFKHNVCLITEELGGVALECQR"
FT   gene            390301..390504
FT                   /locus_tag="CpB0357"
FT   CDS_pept        390301..390504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98288"
FT                   /protein_id="AAP98288.1"
FT                   /translation="MKKQSTRKTSSIQNIFYPARNTTNRNERNIFVQDSFKKIRKPVCF
FT                   IRKQNVIEKIFFTLRFLCFEFC"
FT   gene            390681..391187
FT                   /locus_tag="CpB0358"
FT   CDS_pept        390681..391187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0358"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT066 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98289"
FT                   /protein_id="AAP98289.1"
FT                   /translation="MAVEQSHIKEEIEKLIGKAIKRVCGNKENDLCRYLPGPSGGYMHH
FT                   FTLKKMKSAAPEQLLKMLKTFILESETPRTINPKPRAPRGSKKRRDFINFTKTDIERVL
FT                   ELARQVGDKDLLARFSPKKPLTSLKRELIRSIRNGIVSVELWNAYVEAVKAVSSPNLEV
FT                   TSPFV"
FT   gene            391388..392935
FT                   /locus_tag="CpB0359"
FT   CDS_pept        391388..392935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0359"
FT                   /product="ATP/ADP-transporter"
FT                   /note="similar to ATP/ADP-transporter - Solanum tuberosum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98290"
FT                   /db_xref="GOA:Q9Z8J2"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8J2"
FT                   /protein_id="AAP98290.1"
FT                   /translation="MTKTEEKPFGKLRSFLWPIHTHELKKVLPMFLMFFCITFNYTVLR
FT                   DTKDTLIVGAPGSGAEAIPFIKFWLVVPCAIIFMLIYAKLSNILSKQALFYAVGTPFLI
FT                   FFALFPTVIYPLRDVLHPTEFADRLQAILPPGLLGLVAILRNWTFAAFYVLAELWGSVM
FT                   LSLMFWGFANEITKIHEAKRFYALFGIGANISLLASGRAIVWASKLRASVSEGVDPWGI
FT                   SLRLLMAMTIVSGLVLMASYWWINKNVLTDPRFYNPEEMQKGKKGAKPKMNMKDSFLYL
FT                   ARSPYILLLALLVIAYGICINLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLI
FT                   MLFVGGNVIRKFGWLTGALVTPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVV
FT                   VGAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGL
FT                   LVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLFLAQSALKEQEVAQEDSAPASS"
FT   gene            393053..394333
FT                   /locus_tag="CpB0360"
FT   CDS_pept        393053..394333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98291"
FT                   /protein_id="AAP98291.1"
FT                   /translation="MRHSGCTMKCSPLTLVPHIFLKNDCECHRSCSLKIRTIARLILGL
FT                   VLALVSALSFVFLAAPISYAIGGTLALAAIVILIITLVVALLAKSKVLPIPNELQKIIY
FT                   NRYPKEVFYFVKTHSLTVNELKIFINCWKSGTDLPPNLHKKAEAFGIDILKSIDLTLFP
FT                   EFEEILLQNCPLYWLSHFIDKTESVAGEIGLNKTQKVYGLLGPLAFHKGYTTIFHSYTR
FT                   PLLTLISESQYKFLYSKASKNQWDSPSVKKTCEEIFKELPHNMIFRKDVQGISQFLFLF
FT                   FSHGITWEQAQMIQLINPDNWKMLCQFDKAGGHCSMATFGGFLNTETNMFDPVSSNYEP
FT                   TVNFMTWKELRVLLEKVKESPMHPASALVQKICVNTTHHQNLLKRWQFVRNTSSQWTSS
FT                   LPQYAFHAQTYKLEKKIESSLPIRSSL"
FT   gene            394393..394638
FT                   /locus_tag="CpB0361"
FT   CDS_pept        394393..394638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98292"
FT                   /protein_id="AAP98292.1"
FT                   /translation="MRFRNIKKSLIFIKRIRYSQSGKEQKGARPFFKKSITSSLVILLL
FT                   EAIFNENFSSIIQNNFNKNFKNKNISINRIFVKFTI"
FT   gene            394667..396010
FT                   /locus_tag="CpB0362"
FT   CDS_pept        394667..396010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98293"
FT                   /protein_id="AAP98293.1"
FT                   /translation="MSNITSPVIQNNRSCNYYFELKNSTTIHIVISAILLCGALIAFLC
FT                   VAAPVSYILSGALLGLGLLIALIGVILGIKKITPMISSKEQVFPQELVNRIRAHYPKFV
FT                   SDFVSEAKPNLKDLISFIDLLNQLHSEVGSSTNYNVSEELQQKIDTFEGIARLKNEVRT
FT                   ASLKRLESAASSRPLFPSLPKILQKVFPFFWLGEFISAGSKVVELHRVKKIGGSLEEDL
FT                   SDYIKPEMLPTYWLIPLDFRPTNSSILNLHTLVLARVLTRDVFQHLKYAALNGEWNLNH
FT                   SDLNTMKQQLFAKYHAAYQSYKHLSQPSLQEDEFYNLLLCIFKHRYSWKQMSLIKTVPA
FT                   DLWENLCCLTLDHTGRPQDMEFASLIGTLYTQGLIHKESEAFLSSLTLLSLDQFKTIRR
FT                   QSTNIAMFLENLATHNSTFRSLPPITVHPLKRSVFSQPEEDESSLLIG"
FT   gene            complement(396088..397389)
FT                   /locus_tag="CpB0363"
FT   CDS_pept        complement(396088..397389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98294"
FT                   /protein_id="AAP98294.1"
FT                   /translation="MSMTIVPHALFKNHCECHSTFPLSSRTIVRIAIASLFCIGALAAL
FT                   GCLAPPVSYIVGSVLAFIAFVILSLVILALIFGEKKLPPTPRIIPDRFTHVIDEAYGLS
FT                   ISAFVREQQVTLAEFRQFSTALLCNISPEEKIKQLPSELRSKVESFGISRLAGDLEKNN
FT                   WPIFEDLLSQTCPLYWLQKFISAGDPQVCRDLGVPRECYGYYWLGPLGYSTAKATIFCK
FT                   ETHHILQQLTKEDVLLLKNKALQEKWDTGEVKAIVERIYTTYTARGTLKTEAGGLTKET
FT                   ISKELLLLSLHGYSFDQLQLITQLPRDAWDWLCFVDNSTAYNLQLCALVGALSSQNLLD
FT                   ESSIDFDVNLGLYVIQDLKEAVQAFSASDEPKKELGKFLLRHLSSVSKRLESVLRQGLH
FT                   RIALEHGNARARVYDVNFVTGARIHRKTSIFFKD"
FT   gene            complement(397606..397959)
FT                   /locus_tag="CpB0364"
FT   CDS_pept        complement(397606..397959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98295"
FT                   /protein_id="AAP98295.1"
FT                   /translation="MQLFQYMNESGWDWLCDFDSQGEGFQLSRLVGLLHSSWALYEAKE
FT                   QFYLPEVSLLTWEELIEMQLLSKPTKHGVAKDLCNVFEKHFQRFRQYLGSLDLNQRFEN
FT                   TFLNYPKYHLDRE"
FT   gene            complement(397966..398817)
FT                   /locus_tag="CpB0365"
FT   CDS_pept        complement(397966..398817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98296"
FT                   /protein_id="AAP98296.1"
FT                   /translation="MVNIQPVYRNTQVNYSQATQFSVCQPALSLIIVSVVAAVLAIVAL
FT                   VCSQSLLSIELGTALVLVSLILFASAMFMIYKMRQEPKELLIPKKIMELIQEHYPSIVV
FT                   DFIRDQEVSIYEIHHLISILNKTNVFDKAPVYLQEKLLQFGIEKFKDVHPSKLPNFEEI
FT                   LLQHCPLHWLGRLVYPMVSDVTPGTYGYYWCGPLGLYENAPSLFERRSLLLLKKISFGE
FT                   FALLEDGLKKNTWSSSELVQIRQNLFTRYYADKEEVDEAELNADYEQFDSLLHLIFSHK
FT                   LS"
FT   gene            complement(399075..399251)
FT                   /locus_tag="CpB0366"
FT   CDS_pept        complement(399075..399251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98297"
FT                   /protein_id="AAP98297.1"
FT                   /translation="MLSVSMKLIPTQDSIERETDSKRDKKIFTIYICSSKVLAGHFFSH
FT                   LDKHNKIHESIGV"
FT   gene            399327..399497
FT                   /locus_tag="CpB0367"
FT   CDS_pept        399327..399497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98298"
FT                   /protein_id="AAP98298.1"
FT                   /translation="MVSTSHLLYFHLSKAKDDRMIILLIKRCSPQKYLRSWSLSEGAFS
FT                   MQLYETRNKPR"
FT   gene            399512..401320
FT                   /locus_tag="CpB0368"
FT   CDS_pept        399512..401320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0368"
FT                   /product="GTPases of the lepA"
FT                   /note="similar to GTPases of the lepA family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98299"
FT                   /db_xref="GOA:Q9Z8I4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I4"
FT                   /protein_id="AAP98299.1"
FT                   /translation="MKEYKIENIRNFSIIAHIDHGKSTIADRLLESTSTVEEREMREQL
FT                   LDSMDLERERGITIKAHPVTMTYLYEGEVYQLNLIDTPGHVDFSYEVSRSLSACEGALL
FT                   IVDAAQGVQAQSLANVYLALERDLEIIPVLNKIDLPAADPVRIAQQIEDYIGLDTTNII
FT                   ACSAKTGQGIPAILKAIIDLVPPPKAPAETELKALVFDSHYDPYVGIMVYVRIISGELK
FT                   KGDRITFMAAKGSSFEVLGIGAFLPKATFIEGSLRPGQVGFFIANLKKVKDVKIGDTVT
FT                   KTKHPAKTPLEGFKEINPVVFAGIYPIDSSDFDTLKDALGRLQLNDSALTIEQESSHSL
FT                   GFGFRCGFLGLLHLEIIFERIIREFDLDIIATAPSVIYKVVLKNGKVLDIDNPSGYPDP
FT                   AIIEHVEEPWVHVNIITPQEYLSNIMNLCLDKRGICVKTEMLDQHRLVLAYELPLNEIV
FT                   SDFNDKLKSVTKGYGSFDYRLGDYRKGSIIKLEVLINEEPIDAFSCLVHRDKAESRGRS
FT                   ICEKLVDVIPQQLFKIPIQAAINKKVIARETIRALSKNVTAKCYGGDITRKRKLWEKQK
FT                   KGKKRMKEFGKVSIPNTAFIEVLKLD"
FT   gene            complement(401419..402858)
FT                   /locus_tag="CpB0369"
FT   CDS_pept        complement(401419..402858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0369"
FT                   /product="phosphogluconate dehydrogenase"
FT                   /note="similar to phosphogluconate dehydrogenase
FT                   (decarboxylating) - Actinobacillus actinomycetemcomitans"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98300"
FT                   /db_xref="GOA:Q9Z8I3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I3"
FT                   /protein_id="AAP98300.1"
FT                   /translation="MQTNIGLIGLAVMGKNLVLNMIDHGFSVSVYNRTPEKTRDFLKEY
FT                   PNHRELVGFESLEDFVNSLERPRKIMLMIQAGKPVDQSIHALLPFLEPGDVIIDGGNSY
FT                   FKDSERRCKELQEKGILFLGVGISGGEEGARHGPSIMPGGNPEAWPLVAPIFQSIAAKV
FT                   QGRPCCSWVGTGGAGHYVKAVHNGIEYGDIQLICEAYGILRDFLKLSATAVATILKEWN
FT                   TLELESYLIRIASEVLALKDPEGIPVIDTILDVVGQKGTGKWTAIDALNSGVPLSLIIG
FT                   AVLARFLSSWKEIREQAARNYPGTPLIFEMPHDPSVFIQDVFHALYASKIISYAQGFML
FT                   LGEASKEYNWGLDLGEIALMWRGGCIIQSAFLDVIHKGFAANPENTSLIFQEYFRGALR
FT                   HAEMGWRRTVVTAIGAGLPIPCLAAAITFYDGYRTASSSMSLAQGLRDYFGAHTYERND
FT                   RPRGEFYHTDWVHTKTTERVK"
FT   gene            complement(402879..404147)
FT                   /locus_tag="CpB0370"
FT   CDS_pept        complement(402879..404147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0370"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="similar to tyrosyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98301"
FT                   /db_xref="GOA:Q9Z8I2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8I2"
FT                   /protein_id="AAP98301.1"
FT                   /translation="MAILNYVRSLMQSWLQSLQERNILENFTAGLESVEGPIAAYLGFD
FT                   PTAPALHIGHWIGICFLKRLAALGITPIALVGGATGMVGDPSGKQSERSLLQTSEVFDN
FT                   SQKITACLQRYLPGVTLVNNADWLQEISLIDFLRDIGKHFRLGQMLVKDTIKQRVHSDE
FT                   GISYTEFSYLILQSYDFYHLFKNYGTILQCGGSDQWGNITSGIDFIRRKGLGQAYGLTY
FT                   PLLTNAQGKKIGKTESGTVWLDSDLTSPFELYQYLLRLPDDTIPKIARTLTLLSNEEIQ
FT                   DIDRRVQTDPVAVKEFVAQDILSAIHGDLGLEEALSVTRSMHPGNLSSLSEKDFHELFA
FT                   GGMGASLDKSEVLGKRWLDLFLVLGLCKSKGEIRRLIEQKGVYINNVPIANEHSVCEEQ
FT                   DICYGHYVLLAQGKKRKLVLYLN"
FT   gene            complement(404270..404452)
FT                   /locus_tag="CpB0371"
FT   CDS_pept        complement(404270..404452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98302"
FT                   /protein_id="AAP98302.1"
FT                   /translation="MQPAIVKIAPTIKRRMRGSHSLIRSARVEVGRGALLVVAFRLVAA
FT                   FSIDGTPIGDVDIAT"
FT   gene            complement(404552..405325)
FT                   /locus_tag="CpB0372"
FT   CDS_pept        complement(404552..405325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0372"
FT                   /product="transcription initiation factor sigmaD protein"
FT                   /note="similar to transcription initiation factor sigmaD
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98303"
FT                   /protein_id="AAP98303.1"
FT                   /translation="MKTQQTQNIIEVWNFYWETQEIEYRDSLIEFYLPLVKSVVHRLIS
FT                   GMPSHVKTEDLYASGVEGLVRAVERYNPERSRRFEGYAVFLIKAAIIDDLRKQDWVPRS
FT                   VHQKANKLSGAMDSLRQSLGKEPTDLELCEYLNISQQELSGWFVSARPALIVSLNEEWP
FT                   SQSDEGAGMALEERIPDERAETGYDVVDKQEFSLCLANAIQELEEKERKVMALYYYEEL
FT                   VLKEIGKVLGVSESRVSQIHSKALLKLRAALSAFR"
FT   gene            complement(405440..407188)
FT                   /locus_tag="CpB0373"
FT   CDS_pept        complement(405440..407188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0373"
FT                   /product="flagellar secretion protein"
FT                   /note="similar to flagellar secretion protein -
FT                   Helicobacter pylori"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98304"
FT                   /protein_id="AAP98304.1"
FT                   /translation="MSGKKDGVRGMIFVPLSILVLIFLPLPQILLDFGLCISFALSLLT
FT                   VCWVFTLNSSNSAKLFPPFFLYLCLLRLGLNLASTRWIVSSGTASSLIVSLGSFFSLGS
FT                   LWAATFACLLLFFVNFLMVSKGSERIAEVRSRFFLEALPAKQMALDSDLVSGRASYKAV
FT                   KKQKNALIEEGDFFSAMEGVFRFVKGDAIISCILLLVNVVSVTCLYYTSGYALEQMWFT
FT                   VLGDALVSQVPALLTSCAAATLISKIDKEESLLNYLFEYYKQLRQHFRVVSLLIFSLCC
FT                   IPSSPKFPIVLLASLLWLAYRKEEPASEDSCIERAFSYVEGACPKEQESQFYQVYRAAS
FT                   EEVFEDLGVRLPVLTSLRIEERPWLRVFGQNVYLDEMTPEAVLPFLRNIAHEALNAEVV
FT                   QKYLEESERVFGIAVEDIVPKKISLSSLVVLSRLLVRERVSLKLFPKILEAVAVYQNSG
FT                   DSLEILAEKVRKSLGYWIGRSLWDQKQTLEVITIDFHVEELINSSYSKSNPVMQENVIR
FT                   RVDSLLERSVFKDFRAIVTSCETRFEMKKMLDPHFPDLLVLSHDELPKEIPISFLGIVS
FT                   DEVLVP"
FT   gene            407349..407423
FT                   /locus_tag="CpBt13"
FT   tRNA            407349..407423
FT                   /locus_tag="CpBt13"
FT                   /product="tRNA-Pro"
FT                   /note="TGG"
FT   gene            407466..407741
FT                   /locus_tag="CpB0374"
FT   CDS_pept        407466..407741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0374"
FT                   /product="ferredoxin IV"
FT                   /note="similar to ferredoxin IV - Rhodobacter capsulatus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98305"
FT                   /protein_id="AAP98305.1"
FT                   /translation="MAKLVITSDDEQQEFELEDNSEIAEPCESMGIPFACTEGVCGTCV
FT                   IEVLEGRENLSEFTEPEYDFLGEPEDSNERLACQCRIKGGCVKVTF"
FT   gene            408013..409047
FT                   /locus_tag="CpB0375"
FT   CDS_pept        408013..409047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98306"
FT                   /protein_id="AAP98306.1"
FT                   /translation="MNSLIMATISPISLTVDHPLVDTKKKSCSNFDKIQSRILLITAIF
FT                   AVLVTIGTLLIGLLLNIPVIYFLTGISFIAVVLSNFILYKRATTLLKPRACGKHKEIKP
FT                   KRVSTNLQYSSISIAINRSKENWEHQPKDLQNLPAPSALLTDNPYEIWKAKHSLFSLVS
FT                   LLPGGNPEHLLISASENLGKTLLIEETSQNAPISSYVDTTPSPKSLLNEAIQETRVEIN
FT                   TELPAGDSGERLYWQPDFRGRVFLPQIPTTPEAIYQYYYALYVTYIQTAINTNTQIIQI
FT                   PLYSLREHLYSRELPPQSRMQQSLAMITAVKYMAELHPEYPLTIACVERSLAQLPQESI
FT                   EDLS"
FT   gene            409199..409351
FT                   /locus_tag="CpB0376"
FT   CDS_pept        409199..409351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98307"
FT                   /protein_id="AAP98307.1"
FT                   /translation="MTQFKKNQNSPSIIEKTLSRLIQIKYVIFYARILRYSCFNKRYCN
FT                   TSLLS"
FT   gene            409476..409943
FT                   /locus_tag="CpB0377"
FT   CDS_pept        409476..409943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98308"
FT                   /protein_id="AAP98308.1"
FT                   /translation="MGYLPVSATDVLFESPAAPLINSANTQNQKLIELKGKQQAESSPR
FT                   TITSVILEVLLVIGCCLIVLSLLAIRPALQFTLETGHPAAIAVLAVSGTILLVAVIILF
FT                   CFLAAVPFAAKKTYKYVKTVDDYASWHSHQQTPTLGTIFSGIVYAESQAQL"
FT   gene            complement(410209..410430)
FT                   /locus_tag="CpB0378"
FT   CDS_pept        complement(410209..410430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98309"
FT                   /protein_id="AAP98309.1"
FT                   /translation="MPHRVFSPLGSKGWRLWFYGERFYPSHGIQRLLRSTILLEILMGG
FT                   EDMCISWAWVTEDIRFTFEGPYIIFRGQ"
FT   gene            410602..411339
FT                   /locus_tag="CpB0379"
FT   CDS_pept        410602..411339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0379"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT058 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98310"
FT                   /protein_id="AAP98310.1"
FT                   /translation="MTKTTSIPDVHENQSHLSVDERLISESPVLTKKEVIAKIIKLTAL
FT                   ILALAIAVGTAVVAGVLGMPLMAIATGAALLAAVVLSCLLLRRREPSKPTEELLGPQKH
FT                   VPKDIAAQVQPSVPLDYQKLLRNEWTLVNTLSEINISWTLQDPNQRYYVWEHQGAPITL
FT                   VATTGDIAKPRLKTSGRVMIVNAANSNMQSGGSGTNAALSAATHPTCWNNTRTSGGKIN
FT                   TGKGLSVGECRSAPWINRDWTNK"
FT   gene            411269..411610
FT                   /locus_tag="CpB0380"
FT   CDS_pept        411269..411610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98311"
FT                   /protein_id="AAP98311.1"
FT                   /translation="MAKDYLWVNAAQHPGSIETGRINDTNPGEAHFLAQLLGPKYEGEL
FT                   KAHPEKLSNVIKKAYLNCFDEALNNQATVVQVPLISSSIYSPGGKLELEPVNQTKPNSS
FT                   AYKLYHIRT"
FT   gene            411851..413065
FT                   /locus_tag="CpB0381"
FT   CDS_pept        411851..413065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0381"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT058 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98312"
FT                   /protein_id="AAP98312.1"
FT                   /translation="MTDSNPLPSYTDASLYRTPAKHSYPIRLPLNRTDRIEKILKIVTL
FT                   TLALACALGFSIAAGILAMPIFSAVVVITLAIAAVSLYSLLKKPKLYEILPQIEPESEQ
FT                   SSLSPSPQPPEQQDLPLQIDPLPDPESLPEVSLADLTTPPEELTAITVTPGYEALLEQN
FT                   WDLLPSLAAVDPSFTTETPQQPCFIWKLKDSKLIFISTSGDIAVPRIKTQGRVMIVNAA
FT                   NENISREGGGTNKALSLATSLQCWNASRLPRAHSRSGSQLQPGECRSAKWENSDHTSND
FT                   HVPGKAHFLAQLLGPEAAKCNNDPKQAFEVSKKAFHNLFQEAEIIGVDVIQLPLIGCNL
FT                   FAPSRLLNLGKTRAEWIEAIKLALITSLQDFGWEQDNQEEQKIIILTDKDQPPIIPPRF
FT                   DLTTP"
FT   gene            413300..414415
FT                   /locus_tag="CpB0382"
FT   CDS_pept        413300..414415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0382"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT058 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98313"
FT                   /protein_id="AAP98313.1"
FT                   /translation="MSTTEPNLTNVNLTMLISSESMPTQLASHKLKGLDLVAFILIIGI
FT                   AVSSGTAAIILGIPLLFILTALAVLAFSILLYFLLREPKSPISVTHQPTPIIKDTDLPP
FT                   VPPLALTPVPTEAVLEEPPLPSPRTHQTLLQENWDRIPDLQANTDMPFIAADNQTGYAW
FT                   HLKNSNLTLISTLGPIEKPRYKTQGIVMIVNAATPNMANNVKGTSLALAKATSVRCWEN
FT                   SKKSPDPLRSKQPLQLGECRSAKWENLNGTTNAGKAGLPQFLGQLLGPKASDYNYNPND
FT                   AFTFCRQAYLNCLNEAKRRKTTVVQLPLLSSHFPGSPKDEETTSLRLQWIDGVKLALID
FT                   ALQTFGSEAENQNQPWVIILTTLARHPLITP"
FT   gene            414647..415006
FT                   /locus_tag="CpB0383"
FT   CDS_pept        414647..415006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98314"
FT                   /protein_id="AAP98314.1"
FT                   /translation="MPVSSAPLPTSHRPSSGNLGLMEPNSKALKAKHQDKTTKTIKLLV
FT                   KILVAILVIEVLGIIAAFFIPGTPPICLIILGGLILTTVLCVLLLVIKLALVNKTEGTT
FT                   AEQQIKRKLSSKSIS"
FT   gene            415187..415504
FT                   /locus_tag="CpB0384"
FT   CDS_pept        415187..415504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98315"
FT                   /protein_id="AAP98315.1"
FT                   /translation="MSSPVVTGTSSASPVEQTKLGEFLERLSGSGRCIKIAFAASTALL
FT                   LLNTFVSGIVAIAMIFVATSVGAYFTVIGPLFLLSLILLAIMLISMYKITHPSQNTPIS
FT                   N"
FT   gene            415880..417721
FT                   /gene="aarC"
FT                   /locus_tag="CpB0385"
FT   CDS_pept        415880..417721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aarC"
FT                   /locus_tag="CpB0385"
FT                   /product="AarC"
FT                   /note="similar to aarC protein - Providencia stuartii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98316"
FT                   /db_xref="GOA:Q9Z8H0"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8H0"
FT                   /protein_id="AAP98316.1"
FT                   /translation="MTLITPAINSSRRKTHTVRIGNLYIGSDHSIKTQSMTTTLTTDID
FT                   STVEQIYALAEHNCDIVRVTVQGIKEAQACEKIKERLIALGLNIPLVADIHFFPQAAML
FT                   VADFADKVRINPGNYIDKRNMFKGTKIYTEASYAQSLLRLEEKFAPLVEKCKRLGKAMR
FT                   IGVNHGSLSERIMQKYGDTIEGMVASAIEYIAVCEKLNYRDVVFSMKSSNPKIMVTAYR
FT                   QLAKDLDARGWLYPLHLGVTEAGMGVDGIIKSAVGIGTLLAEGLGDTIRCSLTGCPTTE
FT                   IPVCDSLLRHTKIYLDLPEKKNPFSLQHSENFVSAAEKPAKTTLWGDVYGVFLKLYPHH
FT                   LTDFTPEELLEHLGVNPVTKEKAFTTPEGVVVPPELKDAPITDVLREHFLVFHHHQVPC
FT                   LYEHNEEIWDSPAVHQAPFVHFHASDPFIHTSRDFFEKQGHQGKPTKLVFSRDFDNKEE
FT                   AAISIATEFGALLLDGLGEAVVLDLPNLPLQDVLKIAFGTLQNAGVRLVKTEYISCPMC
FT                   GRTLFDLEEVTTRIRKRTQHLPGLKIAIMGCIVNGPGEMADADFGFVGSKTGMIDLYVK
FT                   HTCVKAHIPMEDAEEELIRLLQEHGVWKDPEETKLTV"
FT   gene            417778..418464
FT                   /locus_tag="CpB0386"
FT   CDS_pept        417778..418464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0386"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT056 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98317"
FT                   /protein_id="AAP98317.1"
FT                   /translation="MPIRHGVFSKQKDAEGTVFAAKNPEIASALQSPKYCDLHQRHGTS
FT                   VRCVTPTSPTYQPADGLCTQSPLLSLHIRHSDCQAAIFYDREHHAIANVHSGWRGLLGN
FT                   IYAVTVGTMKKLFHTKPQDLFVAIGPSIGPDYAIYPDYATLFPRSFLPFMNPKNHFDLR
FT                   AIARKQLTNLGISKDRIFISDLCTYTEHDAFFSSRYLAHHPDPNLTGQHSKNRNNVTAV
FT                   LLLPRD"
FT   gene            418621..419118
FT                   /locus_tag="CpB0387"
FT   CDS_pept        418621..419118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98318"
FT                   /protein_id="AAP98318.1"
FT                   /translation="MKLGASTNHKVHEPVKPKKAQLAEIEANKTQATEGTLRSKSLALQ
FT                   IARAVLYILFAALMLAAGITFVTFLALGFPLIQAYSIAGIITLVGLAIGLVLLILSLLP
FT                   KEDEEADALSRNALLPLTIIVIEQQPITPKPEIPYSYLTKLALLTSLFLTLRRSSSQRK
FT                   TH"
FT   gene            419354..419797
FT                   /locus_tag="CpB0388"
FT   CDS_pept        419354..419797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98319"
FT                   /protein_id="AAP98319.1"
FT                   /translation="MKTKMNSRKKAGQWAIFNSPTPGVSSTLVLAWTPWGYYDKDVQDI
FT                   LERKDPMSSSLSEKDSKEFLKNLFVDLLENGFTSVHIHAEEAFTPLDHTGKPHFKRDNV
FT                   YLPGKLLGALNEAAVQANVSADTQFTLFLTQDECNPFHDKKRG"
FT   gene            complement(419844..420938)
FT                   /locus_tag="CpB0389"
FT   CDS_pept        complement(419844..420938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0389"
FT                   /product="dihydrolipoamide S-succinyltransferase"
FT                   /note="similar to dihydrolipoamide S-succinyltransferase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98320"
FT                   /protein_id="AAP98320.1"
FT                   /translation="MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVN
FT                   QLIYAPVSGRIFWEVSEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICFPQSG
FT                   VRQSPPENKTFIPLRDQMDQGSQGLSAGDRGETRERMTSIRKTISRRLLSALHESAMLT
FT                   TFNEVYMTPLFHLRKEKQEEFLSRYGVKLGFMSFFVKAVLEALKAYPRVNAYIDGEEIV
FT                   YRHYYDISIAVGIDRGLVVPVIRDCDKLSNGEIEQKLADLALRAREGLLAIAELEGGGF
FT                   TITNGGVYGSLLSTPIINPPQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLID
FT                   GKEAVGFLVKVKEGLENPASLLDL"
FT   gene            complement(420942..423668)
FT                   /locus_tag="CpB0390"
FT   CDS_pept        complement(420942..423668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0390"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /note="similar to 2-oxoglutarate dehydrogenase, E1 subunit
FT                   - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98321"
FT                   /protein_id="AAP98321.1"
FT                   /translation="MDSEFVGQVYSSDMDWIESMYQRFMNHETLDPSWKYFFEGYQLGQ
FT                   AASPSEASTKISGNETIAMLQEQKSQFLCTIYRYYGYLQSQISTLAPTTDSRFIQEKIA
FT                   KIDLDEQVPSAGLLPKAQVSVRELIEALKKCYCGSLTLETLTCTPELQEFVWNLMEKRQ
FT                   VERFAEQLLRSYKDLCKATFFEEFLQIKFTGQKRFSLEGGETLVPMLEHLVHYGSALGI
FT                   SNYVLGMAHRGRLNVLTNVLGKPYRYVFMEFEDDPAARGLESVGDVKYHKGYVLKSHQK
FT                   DRETTFVMLPNASHLESVDPIVEGVVAALQHQGHAGKEQSSLAILVHGDAAFSGQGVVY
FT                   ETLQLSRVPGYSTEGTLHIVVNNYIGFTAVPRESRSTPYCTDIAKMLGIPVFRVNSEDV
FT                   VACIEAIEYALQVRERFSCDVIIDLCCYRKYGHNESDDPSVTAPLLYDQIKRKKSIREL
FT                   FRQYLLEGQFADISEETLASIEKEIQESLNREFQVLKGTDPEPFPKKECHHCDRLNNGE
FT                   LILHDCDVSLDRETLFHMSSRLCGFPDNFHPHPKIKTLLEKRMKMAEGGVGYDWAMAEE
FT                   LAFASLLIEGYNLRLSGQDSIRGTFSQRHLVWSDTVTGDTYSPLYHLSAEQGSVEMYNS
FT                   PLSEYAILGFEYGYAQQALKTLVLWEAQFGDFANGAQIIFDQYISSGIQKWDLHSDIVL
FT                   LLPHGYEGQGPEHSSSRIERYLQLAANWNFQVVLPSTPVQYFRILREHAKRDLSLPLVI
FT                   FTPKLLLRYPQCVSSIEEFTEPGGFRAILEDADPNYDASILVLCSGKIYYDYAEMLPQD
FT                   RRKDFSCLRIESLYPLALEDLVSLIDKYSHLKHFVWLQEESKNMGAYDYMFMALQDILP
FT                   EKLLYIGRPRSSSTASGSAKLSRQELVTCMETLFSLR"
FT   gene            423822..424268
FT                   /locus_tag="CpB0391"
FT   CDS_pept        423822..424268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0391"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT053 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98322"
FT                   /protein_id="AAP98322.1"
FT                   /translation="MKSERLKKLESELHDLTQWMQLGLVPKKEISRHQEEIRILEHKIY
FT                   EEKERLQLLKENGEIEEYVTPRRSPAKTVYPDGPSMSDIEFVEPTETEIDIDPGETVEL
FT                   ELTDEGREDGAVEVDYSHEDDEDPFSDRNRWRRGGIIDPDANEW"
FT   gene            424234..425379
FT                   /locus_tag="CpB0392"
FT   CDS_pept        424234..425379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0392"
FT                   /product="coproporphyrinogen oxidase III
FT                   oxygen-independent"
FT                   /note="similar to coproporphyrinogen oxidase III,
FT                   oxygen-independent - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98323"
FT                   /protein_id="AAP98323.1"
FT                   /translation="MVSLIPMLMNGKAPLALYIHIPFCTKKCRYCSFYTIPYKSESVSL
FT                   YCNAVIQEGLRKLAPIQETHFIETVFFGGGTPSLVSPLDLKRILKELAPHAREITLEAN
FT                   PENLTVSYLRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNHGFSNL
FT                   SIDLIYGLPTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFYKHRKILVPTIAQEE
FT                   ILAEMSLLAENLLLSQGFQRYELASYAKPDYPAKHNLYYWTDRPFLGLGVSASQYLHGE
FT                   RSKNYSHISHYLRAVRKNLPTQETSEILPKKERIKEALALRLRLLEGADLAEFPSTLIS
FT                   MLTQDVKLQNLFSVHGQCLALNRQGRLFHDTIAEEIMGYSF"
FT   gene            complement(425534..427312)
FT                   /locus_tag="CpB0393"
FT   CDS_pept        complement(425534..427312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0393"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT326 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98324"
FT                   /protein_id="AAP98324.1"
FT                   /translation="MMTAPTESRSSPPTLLEETEPLSPNPIPADIQIPRITISPPSLDV
FT                   STVASSAEDISVFIAGGPRSSSSASVASDVYELVCLCGGDEDPEPPDSEVRTLYVNGSW
FT                   QTHQEAVQELLYISEVRGEAVRLLYNDGSGMSPWPISPCRTLPTLDHPLCQALLTVWEQ
FT                   FFSAPENQNREFLVIFYGDASPYIQQALTQSRHSPRIVVVGISPTVFIQGDFRVHNYRV
FT                   SGDFFSSLDCRGTRAENTTILPYSSGLEGVFLPSIRCPSFTWAVRFGEQCLVANRGEDV
FT                   EDRGGLSQDAERSQLPHSERDLAVVIDSTDPSSMSRLVEWLNQGSPSSDMEINPYPQRC
FT                   PDVALSALYAISRVSGLAQEWILASVHEGLDLQICYSLILMHTTFAVRYFFLLFTNYPQ
FT                   SRERFRTARIVAQSLYLPSILVLVFDCGNVLRKLWMPQEILRAIFISASTISGSIVFVE
FT                   CTRWMGRGLRHRVQQFVQQRVIGSGLPVGTVRASYRDRAGFIIGFLQTVHGGLYLPVSI
FT                   MVLNQIAIQVPRILVRPNNTAVYDLHNKSAEENWSSGDVLAVGQTLNFILCAFVLFVNL
FT                   WFFVKSVLRHSRRRRR"
FT   gene            complement(427533..428249)
FT                   /locus_tag="CpB0394"
FT   CDS_pept        complement(427533..428249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0394"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yraL - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98325"
FT                   /protein_id="AAP98325.1"
FT                   /translation="MTLYLLPNTLGTRAVETLPSVIGELVHRLDGLIVESDRGGRAFLS
FT                   LWKIPEVHKFPLAILSKHARLPKAWDFYLEPIVKHGENWGLISDAGLPCIADPGASLVR
FT                   RARALGIPVQAFSGPCSITLALMLSGLPSQSFTFLGYLPQSPKERVKSIKKAATSKEVS
FT                   TSVCIETPYRNVYTFESLLDTLPSYAELCVASDLSGPSELVLTRQVQSWRTTEDLGSVK
FT                   QSITKVPTIFLFHIPN"
FT   gene            complement(428246..429193)
FT                   /locus_tag="CpB0395"
FT   CDS_pept        complement(428246..429193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0395"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT047 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98326"
FT                   /protein_id="AAP98326.1"
FT                   /translation="MTLPMQKSLTSFDDFSQAYAEKVPAIALIGSALEDDKDALIELLV
FT                   SESFKELGGQGLMPATLMSWTETFALFQEHETLGIIHAEKFPLATKEFLSRYARNPQPH
FT                   LTILIFTTKQECFRELSKALPSALSLSLFGEWPADRQKRIIRLLLQRAERVGISCSQSL
FT                   ASLFLRALASTSLPDILSEFDKLLCSVGKKTSLDHSDIKELVVKKEKASLWKFRDSLLK
FT                   RDPVEGHQQLHFLLEDGEDPLGIITFLRTQCLYGLRSIEEGSKENKHRMFVLYGKERLH
FT                   QALNSLFYAETLIKNNVQDPIVAVETLVIRMVNL"
FT   gene            complement(429359..429877)
FT                   /locus_tag="CpB0396"
FT   CDS_pept        complement(429359..429877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0396"
FT                   /product="putative histone-like protein 2"
FT                   /note="similar to probable histone-like protein 2 -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98327"
FT                   /db_xref="GOA:Q9Z8F9"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F9"
FT                   /protein_id="AAP98327.1"
FT                   /translation="MIGAQKKQSGKKTASRAVRKPAKKVAAKRTVKKATVRKTAVKKPA
FT                   VRKTAAKKTVAKKTTAKRTVRKTVAKKPAVKKVAAKRVVKKTVAKKTTAKRAVRKTVAK
FT                   KPVARKTTVAKGSPKKAAACALACHKNHKHTSSCKRVCSSTATRKHGSKSRVRTAHGWR
FT                   HQLIKMMSR"
FT   gene            complement(430019..431518)
FT                   /locus_tag="CpB0397"
FT   CDS_pept        complement(430019..431518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0397"
FT                   /product="leucyl aminopeptidase"
FT                   /note="similar to leucyl aminopeptidase - Rickettsia
FT                   prowazekii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98328"
FT                   /db_xref="GOA:Q9Z8F8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F8"
FT                   /protein_id="AAP98328.1"
FT                   /translation="MVLFHAQASGRNRVKADAIVLPFWHFKDAKNAASFEAEFEPSYLP
FT                   ALENFQGKTGEIELLYSSPKAKEKRIVLLGLGKNEELTSDVVFQTYATLTRVLRKAKCS
FT                   TVNIILPTISELRLSAEEFLVGLSSGILSLNYDYPRYNKVDRNLETPLSKVTVIGIVPK
FT                   MADAIFRKEAAIFEGVYLTRDLVNRNADEITPKKLAEVALNLGKEFPSIDTKVLGKDAI
FT                   AKEKMGLLLAVSKGSCVDPHFIVVRYQGRPKSKDHTVLIGKGVTFDSGGLDLKPGKSML
FT                   TMKEDMAGGATVLGILSALAVLELPINVTGIIPATENAIDGASYKMGDVYVGMSGLSVE
FT                   ICSTDAEGRLILADAITYALKYCKPTRIIDFATLTGAMVVSLGEEVAGFFSNNDVLAED
FT                   LLEASAETSEPLWRLPLVKKYDKTLHSDIADMKNLGSNRAGAITAALFLQRFLEESSVA
FT                   WAHLDIAGTAYHEKEEDRYPKYASGFGVRSILYYLENSLSK"
FT   gene            complement(431543..432025)
FT                   /locus_tag="CpB0398"
FT   CDS_pept        complement(431543..432025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0398"
FT                   /product="putative ssDNA binding protein"
FT                   /note="similar to probable ssDNA binding protein -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98329"
FT                   /db_xref="GOA:Q9Z8F7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F7"
FT                   /protein_id="AAP98329.1"
FT                   /translation="MMFGHFAGYLGADPEERMTSKGKRVITLRLGVKTRVGMKDETVWC
FT                   KCNIWHNRYDKMLPYLKKGSGVIVAGDISVESYMSKDGSPQSSLVISVDSLKFSPFGRN
FT                   EGSRSPSLEDNHQQVGYESVSVGFEGEALDAEAIKDKDMYAGYGQEQQYVCEDVPF"
FT   gene            complement(432196..432696)
FT                   /locus_tag="CpB0399"
FT   CDS_pept        complement(432196..432696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0399"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT043 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98330"
FT                   /protein_id="AAP98330.1"
FT                   /translation="MSRQNAEENLKNFAKELKLPDVAFDQNNTCILFVDGEFSLHLTYE
FT                   EHSDRLYVYAPLLDGLPDNTQRKLALYEKLLEGSMLGGQMAGGGVGVATKEQLILMHCV
FT                   LDMKYAETNLLKAFAQLFIETVVKWRTVCADICAGREPSVDTMPQMPQGGGGMQPPPTG
FT                   IRA"
FT   gene            432829..434823
FT                   /locus_tag="CpB0401"
FT   CDS_pept        432829..434823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0401"
FT                   /product="glycogen hydrolase (debranching)"
FT                   /note="similar to glycogen hydrolase (debranching) - Oryza
FT                   sativa"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98331"
FT                   /protein_id="AAP98331.1"
FT                   /translation="MEKVSSYPSVPLPLGASKISPNRYRFALYASQATEVILALTDENS
FT                   EVIEVPLYPDTHRTGAIWHIEIEGISDQSSYAFRVHGPKKHGMQYSFKEYLADPYAKNI
FT                   HSPQSFGSRKKQGDYAFCYLKEEPFPWDGDQPLHLPKEEMIIYEMHVRSFTQSSSSRVH
FT                   APGTFLGIIEKIDHLHKLGINAVELLPIFEFDETAHPFRNSKFPYLCNYWGYAPLNFFS
FT                   PCRRYAYASDPCAPSREFKTLVKTLHQEGIEVILDVVFNHTGLQGTTCSLPWIDTPSYY
FT                   ILDAQGHFTNYSGCGNTLNTNRAPTTQWILDILRYWVEEMHVDGFRFDLASVFSRGPSG
FT                   SPLQFAPVLEAISFDPLLASTKIIAEPWDAGGLYQVGYFPTLSPRWSEWNGPYRDNVKA
FT                   FLNGDQNLIGTFASRISGSQDIYPHGSPTNSINYVSCHDGFTLCDTVTYNHKHNEANGE
FT                   DNRDGTDANYSYNFGTEGKTEDPGILEVRERQLRNFFLTLMVSQGIPMIQSGDEYAHTA
FT                   EGNNNRWALDSNANYFLWDQLTAKPTLMHFLCDLIAFRKKYKTLFNRGFLSNKEISWVD
FT                   AMGNPMTWRPGNFLAFKIKSPKAHVYVAFHVGAQDQLATLPKASSNFLPYQIVAESQQG
FT                   FVPQNVATPTVSLQPHTTLIAISHAKEVT"
FT   gene            complement(434816..435634)
FT                   /locus_tag="CpB0400"
FT   CDS_pept        complement(434816..435634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0400"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT041 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98332"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F4"
FT                   /protein_id="AAP98332.1"
FT                   /translation="MKLLKNVLLGLFFSMSISGFSEVKVSDTFVKQDTVVEPKIRVLLS
FT                   NESTTALIEAKGPYRIYGDNVLLDTAIQGQRCVVHALYEGIRWGEFYPGLQCLKIEPVD
FT                   DTASLFFNGIQYQGSLYVHRKDNHCIMVSNEVTIEDYLKSVLSIKYLEELDKEALSACI
FT                   ILERTALYEKLLARNPQNFWHVKAEEEGYAGFGVTKQFYGVEEAIDWTARLVVDSPQGL
FT                   IIDAQGLLQSNVDRLAIEGFNARQILEKFYKDVDFVVIESWNEELDGEIR"
FT   gene            complement(435631..436644)
FT                   /gene="ruvB"
FT                   /locus_tag="CpB0402"
FT   CDS_pept        complement(435631..436644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="CpB0402"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="similar to Holliday junction DNA helicase ruvB
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98333"
FT                   /db_xref="GOA:Q9Z8F3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F3"
FT                   /protein_id="AAP98333.1"
FT                   /translation="MTHQVAVLHQDKKFDVSLRPKGLEEFYGQHHLKERLDLFLCAALQ
FT                   RGEVPGHCLFFGPPGLGKTSLAHIVAYTVGKGLVLASGPQLIKPSDLLGLLTSLQEGDV
FT                   FFIDEIHRMGKVAEEYLYSAMEDFKVDITIDSGPGARSVRVDLAPFTLVGATTRSGMLS
FT                   EPLRARFAFSARLSYYSDQDLKEILVRSSHLLGIEADSSALLEIAKRSRGTPRLANHLL
FT                   RWVRDFAQIREGNCINGDVAEKALAMLLIDDWGLNEIDIKLLTTIIDYYQGGPVGIKTL
FT                   SVAVGEDIKTLEDVYEPFLILKGFIKKTPRGRMVTQLAYDHLKRHAKNLLSLGEGQ"
FT   gene            complement(437007..437192)
FT                   /locus_tag="CpB0403"
FT   CDS_pept        complement(437007..437192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98334"
FT                   /protein_id="AAP98334.1"
FT                   /translation="MYKQEKPIPKATILSRNLEVMLDNPKGKRQTLFLGRTSGRSALYS
FT                   YSRRILVLLNAFMRGP"
FT   gene            437314..437886
FT                   /locus_tag="CpB0404"
FT   CDS_pept        437314..437886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0404"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="similar to bacterial deoxycytidine triphosphate
FT                   deaminase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98335"
FT                   /db_xref="GOA:Q9Z8F1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8F1"
FT                   /protein_id="AAP98335.1"
FT                   /translation="MSIKEDKWIREMALNADMIHPFVNGQVNVNEETGEKLISYGLSSY
FT                   GYDLRLSREFKVFTNVYNSVVDPKCFTEDIFISITDDVCIVPPNSFALARSVEYFRIPR
FT                   NVLTMCIGKSTYARCGIIVNVTPFEPEWEGHVTIEISNTTPLPAKIYANEGIAQVLFFE
FT                   SSTTCEVSYADRKGKYQKQQGITVPCV"
FT   gene            437780..438226
FT                   /locus_tag="CpB0405"
FT   CDS_pept        437780..438226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0405"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT038 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98336"
FT                   /protein_id="AAP98336.1"
FT                   /translation="MPRSYSLSLVRPARFLMQTEKESIKSNKASPYLVSKVSVRKKNWG
FT                   FRLLEEVMIKSWWVIFSILIGGFVYDRAIQELRTEELRLQSKVSSLCQDILSAQEKQRQ
FT                   LQLHLQHWQDSAAIEAALIQRLGLIPKGYKKLCVSPKQQSENKD"
FT   gene            438236..439471
FT                   /locus_tag="CpB0406"
FT   CDS_pept        438236..439471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0406"
FT                   /product="hemolysin"
FT                   /note="similar to probable hemolysin family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98337"
FT                   /protein_id="AAP98337.1"
FT                   /translation="MIPTMLMFFIICFTLCSGFISLSQIALFSLPTSLISHYKRSKSKK
FT                   QQRVATLLLHPHHLLITLIFCDIGLNIAIQNCFAILFGDAASWWFTVGLPLAITLILGE
FT                   ILPKAVALPFNTQIASSVAPLILCVTKIFKPLLHWGIVGINYVVQWILSKQQIDIIQPQ
FT                   ELKEVLQSCKDFGVVNQEESRLLYGYLSLSDCSVKERMQPRQDILFYDIQTPLENLYLL
FT                   FSKQHCSRVPICNDNLQNLLGICTARSLLLHDKPLQSSDDLLPLLKKPYYMPETISAKM
FT                   ALCQMAAEDETLGMIIDEYGSIEGLITQEDLFEIVAGEIVDQRDNKILYTTSGADVIIA
FT                   SGTLELREFSEIFDINLPTNNNIATIGGWLIEQIGTIPTTGMKLSWNNLLFQVLDAAPN
FT                   RIRRVYIRKLYD"
FT   gene            439464..440678
FT                   /locus_tag="CpB0407"
FT   CDS_pept        439464..440678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0407"
FT                   /product="hemolysin"
FT                   /note="similar to probable hemolysin family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98338"
FT                   /protein_id="AAP98338.1"
FT                   /translation="MTNSALFWIGVNIICIVLQGFYSMMEMACVSFNRVRLQYYLTKDH
FT                   KKARYINFLIRRPYRLFGTVMLGVNIALQVGSESSRNCYRALGITPDYAPFTQIFIVVI
FT                   FAELLPLTISRKIPEKLALWGAPILYYSHYIFYPLIQLIGSLTEGLYYLLNIRKEKLNS
FT                   TLSRDEFQKALETHHEEQDFNTIATNIFSLSATCADQVCQPLEQVTMLPSSANVKDFCR
FT                   TIKNTDINFIPVYHKARKNVIGIAHPKDFVNKALDEPLINNLHSPWFITAKSKLIRILK
FT                   EFRDNRSSVAVVLNASGEPIGILSLNAIFKILFNTTNIAHLKPKTISVIERTFPGNSRI
FT                   KDLQKELDIQFPQYPVETLAQLVLQLLDSPAEVGTSVIINNLLLEVKEMSLSGIKTVSI
FT                   KNLLS"
FT   gene            complement(440738..441853)
FT                   /gene="nifS"
FT                   /locus_tag="CpB0408"
FT   CDS_pept        complement(440738..441853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="CpB0408"
FT                   /product="nitrogen fixation protein"
FT                   /note="similar to nitrogen fixation nifS protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98339"
FT                   /protein_id="AAP98339.1"
FT                   /translation="MIYLDNNAMTPPERGLLEFLQKTFLIEGTYANPSSVHQLGKKSRQ
FT                   LVLEASHWMQKVLSFQGRVLYTSGATESLNLAIASLPKDSHVITSGSEHPAILEPLKHS
FT                   SLSVSYLNPEEGRCVLTIEQIERAVTPKTSAIILGWVNSETGAKADIAAIAHFAQERQL
FT                   QFIVDATANVGKERIVLPSGVTMAAFSGHKFHALSGIGALLVSPGVKLHPQLWGGGQQG
FT                   GLRAGTENLWGIASLLYIFKYLDLHQERISQEILTHRNGFEKAIKARIPDVHIHCADQP
FT                   RANNVSAIAFPPLEGEVLQIALDIEGVACGYGSACSSGATAPFKSLVSMGVDEELTLAT
FT                   LRFSFSHLLLQEDVERAVGIIEKVVERLKNS"
FT   gene            complement(441878..442615)
FT                   /locus_tag="CpB0409"
FT   CDS_pept        complement(441878..442615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0409"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yloO - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98340"
FT                   /protein_id="AAP98340.1"
FT                   /translation="MDFDYFGLSDIGRVRARNEDFWQVNLMSQVVAIADGVGGRLGGDI
FT                   ASQEAVTSLMELIDEQQSKLMGYEDDQYKETLKKILLEVNGVVYEHGQMEEHLQGMGTT
FT                   LSFIQFRKDRAWLFHVGDSRIYRIREGELRRLTEDHSLENQLKNRYGLPKQSDKVYSYR
FT                   HILTNVLGSRPYVMPDIRNLPCEKEDLYCLCSDGLTNMVPDIDIRDILNQPATLEERGN
FT                   ALISLANTRGGDDNATVVLVRIQ"
FT   gene            complement(442679..442843)
FT                   /locus_tag="CpB0410"
FT   CDS_pept        complement(442679..442843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98341"
FT                   /protein_id="AAP98341.1"
FT                   /translation="MLFSLFILRLIDPSSLALGRLFIKFFFVINDHATINLAINYDFVR
FT                   KIQFFIIMI"
FT   gene            complement(442954..443160)
FT                   /locus_tag="CpB0411"
FT   CDS_pept        complement(442954..443160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98342"
FT                   /protein_id="AAP98342.1"
FT                   /translation="MVTFSLGINVHPGRNTTGAEITEKINHFMTTSAKRILLFSICIGS
FT                   SSIYSNFYFIIIKTMMKRFLVNF"
FT   gene            443268..444026
FT                   /locus_tag="CpB0412"
FT   CDS_pept        443268..444026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0412"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT253 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98343"
FT                   /protein_id="AAP98343.1"
FT                   /translation="MRVLNGKSLNCESIDLKSKNFPRARIFCKISNLRTVTMRKMLVLL
FT                   ASLGLLSPTLSSCTHLGSSGSYHPKLYTSGSKTKGVIAMLPVFHRPGKSLEPLPWNLQG
FT                   EFTEEISKRFYASEKVFLIKHNASPQTVSQFYAPIANRLPETIIEQFLPAEFIVATELL
FT                   EQKTGKEAGVDSVTASVRVRVFDIRHHKIALIYQEIIECSQPLTTLVNDYHRYGWNSKH
FT                   FDSTPMGLMHSRLFREVVARVEGYVCANYS"
FT   gene            444036..444809
FT                   /locus_tag="CpB0413"
FT   CDS_pept        444036..444809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0413"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT254 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98344"
FT                   /protein_id="AAP98344.1"
FT                   /translation="MSKFILLLSLGVAALASKNFFIWPAPSGKTPLKLRQVLFGGALLV
FT                   FSSLVALSVSSQTAELLSTMTGISLAFAFLFYLLFLPKDITRAILFSGERPVKTSWRAL
FT                   GSAIRMWIIIIPVTQLIGIMMSKFLTLVLPMQEIHTQEVTQEVQNSLPITGHYISMILN
FT                   LGVLTPFGEEVFFRGILQTFLKNKMTRIAAVLCSSIIFSFIHIEHSLGSWVFVPVLFVF
FT                   SLSAGFLYEKDRHILSPIALHGLFNLTSLLFLGIK"
FT   gene            complement(444992..445384)
FT                   /locus_tag="CpB0414"
FT   CDS_pept        complement(444992..445384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0414"
FT                   /product="beta-lactamase regulatory protein homolog"
FT                   /note="similar to beta-lactamase regulatory protein homolog
FT                   - Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98345"
FT                   /protein_id="AAP98345.1"
FT                   /translation="MRDHAFSKLIGTVRAMVVEGRCPWSLQQSLVSMVEHILGECQEFH
FT                   EAVLQGKTVQEVGSEAGDVLTLVLILCFLLEREGVLASEDVANEAMEKLRRRAPYIFAE
FT                   DYKPVSIEEADRLWELAKHREKNEST"
FT   gene            complement(445385..446494)
FT                   /locus_tag="CpB0415"
FT   CDS_pept        complement(445385..446494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0415"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="similar to A/G-specific adenine glycosylase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98346"
FT                   /protein_id="AAP98346.1"
FT                   /translation="MTKIAFSEKAKNFPVEALKKWFEKNKRSLPWRDNPTPYSVWVSEV
FT                   MLQQTRAEVVIDYFNQWMERFPTIESLAAAKEEDVIKLWEGLGYYSRARHLLEGARMVM
FT                   EEFHGKIPDDAISLAQIRGVGPYTVHAILAFAFKRRAAAVDGNVLRVLSRIFLIETSID
FT                   LESTRTWVSRIAQALLPHKSPEVIAEALIELGACICKKVPQCHRCPVRQACGAWRENKQ
FT                   FVLPVRHARKKVIFLHRLVAIVLYDGSLVVEKRRPKEMMAGLYEFPYIEVEPEEGLQDI
FT                   EGFTKKMELSLESPLEFLGNLKEQRHAFTNHKVHLCPIIFKATSLPQFGELHLLSDIDH
FT                   LAFSSGHKKIKDALLIYLGDVRSRESIGV"
FT   gene            446515..447213
FT                   /gene="sfhB"
FT                   /locus_tag="CpB0416"
FT   CDS_pept        446515..447213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfhB"
FT                   /locus_tag="CpB0416"
FT                   /product="pseudouridine synthetase"
FT                   /note="similar to pseudouridine synthetase sfhB -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98347"
FT                   /protein_id="AAP98347.1"
FT                   /translation="MQLSNDKRAALQYFMENFSWLATQVSRLSSFLRSQLPNHSKQEIL
FT                   ASIRQHRCRVNGFIERFESYKVQPGDRVSLSLIPSTKQQPSILWEDDYSIIYEKPPHLT
FT                   TEQMAHMTRFFTVHRLDKGTSGCLLMGKSKQAATELMKLFKQRKIHKQYIAFVFGHPKK
FT                   KFGTVKSYTAPVYRRCGAVIFGAAGPSQGEPIKSAYKWDCWVILLSEMSTTDLKNSLPR
FT                   SSALSSMLTP"
FT   gene            complement(447368..448333)
FT                   /locus_tag="CpB0417"
FT   CDS_pept        complement(447368..448333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0417"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT105 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98348"
FT                   /protein_id="AAP98348.1"
FT                   /translation="MAACDRCSMDFCEILKSQSMDLWADAASCVDGLLQDPFWSTAIAS
FT                   GIAKSSLQETEFECESKVMVLSSWGEQGAQVCSPFNLERICMSFPSLKVFSLKKNGCEN
FT                   MGIQLSASCMNLLMSIFFVATNGGSTPIWITKENLMALVALVLSHYQCYFVPATGDPQR
FT                   GNILGNPEVNAILARGMGMRVDLERKRGGESSSSRYLELAARCFENSLTKTSLLSDANN
FT                   VQERDKCLLQMSTSLMHTAGLNLQRPPVPTPSGVTAHPQPQPDPVVTSQPSLLGARERS
FT                   PVSSRGRFPVVLPLSVISPRSHPGRVERRDLEDEEEEVMF"
FT   gene            complement(448463..449209)
FT                   /locus_tag="CpB0418"
FT   CDS_pept        complement(448463..449209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98349"
FT                   /protein_id="AAP98349.1"
FT                   /translation="MTNPLGKFPSPQNPQVVTIAPSSTTPQAVSSAVQGFLQTGGAASS
FT                   TATTTTASGASALGLSPDQVQALLTNLLNVGQPSVGQPSTSAGTSGASSSSASMQQQLL
FT                   QLILDKTTGSGGSSVSSEQLQQLLSLVSQMTTSQGGSGGTQAGQAASVLLNLLSATGSA
FT                   AANPLGTAASLAQIIYAAVTSPGAKKTSEFCYNYCGETCQGNCGCPTCGCPDGQCGCGG
FT                   FGRFFCGVWKNCCGIGEGSQEPAIPL"
FT   gene            complement(449281..449451)
FT                   /locus_tag="CpB0419"
FT   CDS_pept        complement(449281..449451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98350"
FT                   /protein_id="AAP98350.1"
FT                   /translation="MKLIGRRVTNLSIIKKTFWCLNRGDPASNVNRNVNSLNFFLYIFY
FT                   RISKLLTPAYC"
FT   gene            449469..450368
FT                   /locus_tag="CpB0421"
FT   CDS_pept        449469..450368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0421"
FT                   /product="enoyl-acyl-carrier protein reductase"
FT                   /note="similar to enoyl-acyl-carrier protein reductase -
FT                   Nicotiana tabacum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98351"
FT                   /protein_id="AAP98351.1"
FT                   /translation="MLKIDLTGKVAFVAGIGDDQGYGWGIAKLLAEAGATIIVGTWVPI
FT                   YKIFSQSWELGKFNESRKLSNGTLLEIAKIYPMDASFDSPEDVPEDIAENKRYKGITGF
FT                   TISEVAEQVKKDFGHIDILVHSLANSPEISKSLLETSRKGYLAALSASSYSFVSLLSHF
FT                   GSIMNRGGSTISLTYLASMRAVPGYGGGMSSAKAALESDTKTLAWEAGRRWGIRVNTIS
FT                   AGPLASRAGKAIGFIERMVDYYQEWAPIPEAMNAEQVGAVAAFLASPLASAITGETLYV
FT                   DHGANVMGIGPEMFPKDS"
FT   gene            complement(450355..451227)
FT                   /locus_tag="CpB0420"
FT   CDS_pept        complement(450355..451227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0420"
FT                   /product="putative had hydrolase/phosphatase"
FT                   /note="similar to probable had hydrolase/phosphatase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98352"
FT                   /protein_id="AAP98352.1"
FT                   /translation="MTDIDGTITHQSHHLDKKVYERLYALHQAGWKLFFLTGRYYKYAA
FT                   RLFSDFDAPYLLGCQNGASVWSSTSSNLLYSKSLPSDLLCILQDCMEGATALFSVESGA
FT                   PYGDHYYRFSPTPIAQDLHEYVDPRYFPNAKEREILFETRSLKDDYAFPSFAAAKVFGL
FT                   RDEVIRIQKELERQEALTSVATMTLMRWPFDFRYAILFLTDKSVSKGKALDRVVNILYD
FT                   GKKPFVMASGDDANDLDLIERGDFKIVMSSAPEEMHVHADFLAPPADKNGILSAWEAGV
FT                   RYYDDLMSL"
FT   gene            complement(451227..451418)
FT                   /locus_tag="CpB0422"
FT   CDS_pept        complement(451227..451418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98353"
FT                   /protein_id="AAP98353.1"
FT                   /translation="MIWVIHRLLYTLLGCARSTEPKLLSFIDKTTAVCRWMQRIFSSCL
FT                   RNSLAALNKTMVMLWKSY"
FT   gene            complement(451415..451711)
FT                   /locus_tag="CpB0423"
FT   CDS_pept        complement(451415..451711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98354"
FT                   /protein_id="AAP98354.1"
FT                   /translation="MLPGNISCTEMGSWIVSARASSSESLKTKEKRLKNMCKTRDHLYK
FT                   IIVVARFVSNYIQVIMKYSFSRCYINYSTMISKYRLNRNHVYSCKYRLESSPR"
FT   gene            451605..452084
FT                   /locus_tag="CpB0424"
FT   CDS_pept        451605..452084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0424"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT102 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98355"
FT                   /protein_id="AAP98355.1"
FT                   /translation="MFFNLFSLVFKLSDELALAETIQEPISVHEMFPGSMKLEMFKMLG
FT                   SLILLLTIFGFGVWAFKKFVRSRSHGFGGSSQIKILERRSLTPKTSIYLIRVVNKTLVI
FT                   AETPEKITLLTEFPPDTDINHLLQENNKQSSSSATSDFLSKAIQKIQKKQQTNQD"
FT   gene            452145..452630
FT                   /locus_tag="CpB0425"
FT   CDS_pept        452145..452630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0425"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT260 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98356"
FT                   /protein_id="AAP98356.1"
FT                   /translation="MTTWTLNQNNLTKFLKSSDEEPFLERESGLTYINIQANGNELPLF
FT                   FVIRSEGEILQLICYLPYQLHESHKASTARLLHLLNRDIDIPGFGMDEEQGLIFYRLVL
FT                   PCLNGEIHDTLLRIYIDTIKLVCDSFSHAIGLISSGNMNLDELRRQALQEQQEKRNE"
FT   gene            452638..453336
FT                   /locus_tag="CpB0426"
FT   CDS_pept        452638..453336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0426"
FT                   /product="DNA-directed DNA polymerase III alpha chain"
FT                   /note="similar to DNA-directed DNA polymerase III, alpha
FT                   chain - Staphylococcus aureus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98357"
FT                   /protein_id="AAP98357.1"
FT                   /translation="MDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPI
FT                   PDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGEDSILVAHNNDGFDFPLLGKECRRHS
FT                   LEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKVFTSLI
FT                   GDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPENKDIK
FT                   AAIALLHQPT"
FT   gene            453333..454112
FT                   /locus_tag="CpB0427"
FT   CDS_pept        453333..454112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0427"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT262 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98358"
FT                   /protein_id="AAP98358.1"
FT                   /translation="MILTAAFSPCPNDIFLFRSFLKDPQFRPLLNQVTIADIETLNTLA
FT                   LQRRLSLMKMSAALFPLVSDYYNLMDVGNTLGYNSGPIVLSLDPECSLDTLATPGEMTT
FT                   AHALCKLYYPKAKLIPMPYDKILSAILQGKVDGGALIHEERFSYDLQLTLRADFGELWR
FT                   RKTIFPLPLGCLAIAKYVPMATVDALTAALRKSLICSLKDPITAGAKAVEYSKNKNVTV
FT                   IHRFIGTYINKETFQLSKTGKKALHMLWKANECCQYT"
FT   gene            454090..454749
FT                   /locus_tag="CpB0429"
FT   CDS_pept        454090..454749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0429"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT263 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98359"
FT                   /protein_id="AAP98359.1"
FT                   /translation="MNAVNTPKKILCIVADYREISPLIEQLDFTQINEHLYSYRCTDYH
FT                   LDLYIVHVWGSTAVLNALQSYCQAYTDYDLWINPGFVGACSPEIPLGQCYTIEKIANLT
FT                   TDTPPVLSEDPPYIFDALPDSLPKSSLVTSPVLYHYGFHKTFKLLDMEGYAIASQAAEH
FT                   HIPCSFLKITSDYTVPGDCPFSRLEEVSQKLTQTLVELLPELMERAIPPKLLLPCP"
FT   gene            complement(454724..456703)
FT                   /gene="hetA"
FT                   /locus_tag="CpB0428"
FT   CDS_pept        complement(454724..456703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hetA"
FT                   /locus_tag="CpB0428"
FT                   /product="HetA"
FT                   /note="similar to Anabaena sp. ABC transporter; ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98360"
FT                   /protein_id="AAP98360.1"
FT                   /translation="MKLLLKAVLRHKNHLVILGCSLLAILGLTFSSQMEIFSLGMIAKT
FT                   GPDAFLLFGRKESGKLVKVSELSQKDILENWQAISKDSETLTVSDATTYIAEHGKSTAS
FT                   LTSKLSKFVRNYIDVSRFRGLAIFLICVAIFKAVTLFFQRFLGQVVAIRVSRDLRQDYF
FT                   KALQQLPMTFFHDHDIGNLSNRVMTDSASIALAVNSLMINYIQAPITFILTLGVCLSIS
FT                   WKFSILVCVAFPIFILPIVVIARKIKNLAKRIQKSQDSFSSVLYDFLAGVMTVKVFRTE
FT                   KFAFTKYCEHNNKISALEEKSAAYGLLPRPLLHTIASLFFAFVVVIGIYKFAIPPEELI
FT                   VFCGLLYLIYDPIKKFGDENTSIMRGCAAAERFYEVLNHPDLHSQKEREIEFLGLSNTI
FT                   TFENVSFGYQEDKHILKNLSFTLHKGEALGIVGPTGSGKTTLVKLLPRLYEVSQGKILI
FT                   DSLPITEYNKGSLRNHIACVLQNPFLFYDTVWNNLTCGKDMEEEAVLEALKRAYADEFI
FT                   LKLPKGVHSVLEESGKNLSGGQQQRLAIARALLKNASILILDEATSALDAISENYIKNI
FT                   IGELKGQCTQIIIAHKLTTLEHVDRVLYIENGQKIAEGTKEELLQTCPEFLKMWELSGT
FT                   KEYNRVFVPDHKLVANPTDMAITT"
FT   gene            complement(456669..457643)
FT                   /locus_tag="CpB0430"
FT   CDS_pept        complement(456669..457643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0430"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /note="similar to acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha - Synechococcus sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98361"
FT                   /db_xref="GOA:Q9Z8C9"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C9"
FT                   /protein_id="AAP98361.1"
FT                   /translation="MELLPHEKQVVEYEKAIAEFKEKNKKNSLLSSSEIQKLEKRLDKL
FT                   KEKIYSDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGFVKIQ
FT                   GQRFVLIGQEKGCDTASRLHRNFGMLCPEGFRKALRLGKLAEKFGLPVVFLVDTPGAYP
FT                   GLTAEERGQGWAIAKNLFELSRLATPVIIVVIGEGCSGGALGMAVGDSVAMLEHSYYSV
FT                   ISPEGCASILWKDPKKNSEAASMLKMHGENLKQFGIIDTVIKEPIGGAHHDPALVYSNV
FT                   REFIIQEWLRLKDLAIEELLEKRYEKFRSIGLYETTSESGPEA"
FT   gene            complement(457718..458998)
FT                   /locus_tag="CpB0431"
FT   CDS_pept        complement(457718..458998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0431"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT266 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98362"
FT                   /protein_id="AAP98362.1"
FT                   /translation="MTLIFVIIIVWCNAFLIKLCVIMGLQSRLQHCIEVSQNSNFDSQV
FT                   KQFIYACQDKTLRQSVLKIFRYHPLLKIHDIARAVYLLMALEEGEDLGLSFLNVQQYPS
FT                   GAVELFSCGGFPWKGLPYPAEHAEFGLLLLQIAEFYEESQAYVSKMSHFQQALFDHQGS
FT                   VFPSLWSQENSRLLKEKTTLSQSFLFQLGMQIHPEYSLEDPALGFWMQRTRSSSAFVAA
FT                   SGCQSSLGAYSSGDVGVIAYGPCSGDISDCYYFGCCGIAKEFVCQKSHQTTEISFLTST
FT                   GKPHPRNTGFSYLRDSYVHLPIRCKITISDKQYRVHAALAEATSAMTFSIFCKGKNCQV
FT                   VDGPRLRSCSLDSYKGPGNDIMILGENDAINIVSASPYMEIFALQGKEKFWNADFLINI
FT                   PYKEEGVMLIFEKKVTSEKGRFFTKMN"
FT   gene            complement(459054..459356)
FT                   /locus_tag="CpB0432"
FT   CDS_pept        complement(459054..459356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0432"
FT                   /product="integration host factor beta chain"
FT                   /note="similar to integration host factor beta chain -
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98363"
FT                   /db_xref="GOA:Q9Z8C7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C7"
FT                   /protein_id="AAP98363.1"
FT                   /translation="MATMTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVKGDRL
FT                   EFRDFGVLQVVERKPKVGRNPKNAAVPIHIPARRAVKFTPGKRMKRLIETPNKHS"
FT   gene            459642..459715
FT                   /locus_tag="CpBt14"
FT   tRNA            459642..459715
FT                   /locus_tag="CpBt14"
FT                   /product="tRNA-Arg"
FT                   /note="CCT"
FT   gene            complement(459741..460535)
FT                   /locus_tag="CpB0433"
FT   CDS_pept        complement(459741..460535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0433"
FT                   /product="N-acetylmuramoyl-L-alanine amidase 50K precursor"
FT                   /note="LytC; similar to N-acetylmuramoyl-L-alanine amidase
FT                   50K (lytC) precursor - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98364"
FT                   /protein_id="AAP98364.1"
FT                   /translation="MKLTKYLNTKQLRSMISRLFVRYSLPMSKQLSFFALCVLGSHPIF
FT                   AQTPNPPQRVRRSEVIFIDPGHGGKDQGTASKELHYEEKSLTLSLALTVQSYLKRMGYK
FT                   PQLTRSSDVYVDLGKRVALSNRGQGDVFISIHCNHSSNAAAFGTEVYFYNGKVGSPTRN
FT                   RMSEVLGKNILAAMEKNGILKSRGLKTANFVVIRDTSMPAVLVETGFLSNSRERAALQD
FT                   ARYRMHVAKGIAEGVHNFLSGPSFQKPKQNIAKIRKPQIQAN"
FT   gene            complement(460450..461901)
FT                   /locus_tag="CpB0434"
FT   CDS_pept        complement(460450..461901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0434"
FT                   /product="N-acetylmuramoylalanylglutamyl DAP ligase"
FT                   /note="similar to N-acetylmuramoylalanylglutamyl DAP ligase
FT                   - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98365"
FT                   /db_xref="GOA:Q9Z8C5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C5"
FT                   /protein_id="AAP98365.1"
FT                   /translation="MDLKELLHGVQAKIYGKVRPLEVRNLTRDSRCVSVGDIFIAHKGQ
FT                   RYDGNDFAVDALANGAIAIASSLYNPFLSVVQIITPNLEELEAELSAKYYEYPSSKLHT
FT                   IGVTGTNGKTTVTCLIKALLDSYQKPSGLLGTIEHILGEGVIKDGFTTPTPALLQKYLA
FT                   TMVRQNRDAVVMEVSSIGLASGRVAYTNFDTAVLTNITLDHLDFHGTFETYVAAKAKLF
FT                   SLVPPSGMVVINTDSPYASQCIESAKAPVITYGIESAADYRATDIQLSSSGTKYTLVYG
FT                   DQKIACSSSFIGKYNVYNLLAAISTVHASLRCDLEDLLEKIGLCQPPPGRLDPVLMGPC
FT                   PVYIDYAHTPDALDNVLTGLHELLPEGGRLIVVFGCGGDRDRSKRKLMAQVVERYGFAV
FT                   VTSDNPRSEPPEDIVNEICDGFYSKNYFIEIDRKQAITYALSIASDRDIVLIAGKGHEA
FT                   YQIFKHQTVAFDDKQTVCEVLASYV"
FT   gene            complement(462374..464335)
FT                   /locus_tag="CpB0435"
FT   CDS_pept        complement(462374..464335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0435"
FT                   /product="penicillin-binding protein 2"
FT                   /note="similar to Neisseria meningitidis penicillin-binding
FT                   protein 2; transglycolase; transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98366"
FT                   /protein_id="AAP98366.1"
FT                   /translation="MSYRKRSTLIVLGVFALYALLVLRYYKIQICEGDHWAAEALGQHE
FT                   FCVRDPFRRGTFFANTTVRKGDKDLQQPFAVDITKFHLCADPLAIPECHRDEIIQGILQ
FT                   FIEGQTYDDLSLKLDKKSRYCKLYPLLDVSVHDRLSLWWKGYATKHRLPTNALFFITDY
FT                   QRSYPFGKLLGQVLHTLREIKDEKTGKAFPTGGMEAYFNHILEGDVGERKLLRSPLNRL
FT                   DTNRVIKLPKDGSDIYLTINPVIQTIAEEELERGVLEAKAQGGRLILMNSQTGEILALA
FT                   QYPFFDPTNYKEYFNNKERIEHTKVSFVSDVFEPGSIMKPLTVAIALQANEEASLKSQK
FT                   KIFDPEEPIDVTRTLFPGRKGSPLKDISRNSQLNMYMAIQKSSNVYVAQLADRIIQSLG
FT                   VAWYQQKLLALGFGRKTGIELPSEASGLVPSPHRFHINGSLEWSLSTPYSLAMGYNILA
FT                   TGIQMVQAYAILANGGYAVRPTLVKKIVSASGEEYHLPTKEKTRLFSEEITREVVRAMR
FT                   FTTLPGGSGFRASPKHHSSAGKTGTTEKMIHGKYDKRRHIASFIGFTPVESSEGNFPPL
FT                   VMLVSIDDPEYGLRADGTKNYMGGRCAAPIFSRVADRTLLYLGILPDKKLRNCDEEAAA
FT                   LKRLYEEWNRSPKQGGTR"
FT   gene            complement(464322..464609)
FT                   /locus_tag="CpB0436"
FT   CDS_pept        complement(464322..464609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0436"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT271 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98367"
FT                   /protein_id="AAP98367.1"
FT                   /translation="MNKSRFLRLCCCLCFCGSLFYFYINKQNSLTKLRLEIPCLSVRLR
FT                   QLEQQNISLRFLIDKIERPDHLMEIAALPEYQYLEYPSEESISLLSYELP"
FT   gene            complement(464606..465499)
FT                   /locus_tag="CpB0437"
FT   CDS_pept        complement(464606..465499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0437"
FT                   /product="predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="similar to predicted S-adenosylmethionine-dependent
FT                   methyltransferase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98368"
FT                   /db_xref="GOA:Q9Z8C2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C2"
FT                   /protein_id="AAP98368.1"
FT                   /translation="MSERAHIPVLVEECLALFAQRPPQTFRDVTLGAGGHAYAFLEAYP
FT                   SLTCYDGSDRDLQALAIAEKRLETFQDRVSFSHASFEDLANQPTPRLYDGVLADLGVSS
FT                   MQLDTLSRGFSFQGEKEELDMRMDQTQELSASDVLNSLKEEELGRIFREYGEEPQWKSA
FT                   AKAVVHFRKHKKILSIQDVKEALLGVFPHYRFHRKIHPLTLIFQALRVYVNGEDRQLKS
FT                   LLTSAISWLAPQGRLVIISFCSSEDRPVKWFFKEAEASGLGKVITKKVIQPTYQEVRRN
FT                   PRSRSAKLRCFEKASQ"
FT   gene            465743..466288
FT                   /locus_tag="CpB0438"
FT   CDS_pept        465743..466288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0438"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT273 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98369"
FT                   /db_xref="InterPro:IPR035407"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8C1"
FT                   /protein_id="AAP98369.1"
FT                   /translation="MVEIFNYSTSIYEQHASNNRIVSDFRKEIQMEGISIRDVAKHAQI
FT                   LDMNPKPSALTSLLQTNQKSHWACFSPPNNFYKQRFSTPYLAPSLGSPDQQDEDIEKIS
FT                   SFLKVLTRGKFSYRSQITPFLSYKDKEEEEDEDPEEDDDDPRVQQGKVLLKALDLGVKS
FT                   TNVMIDYVISRIFQFVQG"
FT   gene            466292..466720
FT                   /locus_tag="CpB0439"
FT   CDS_pept        466292..466720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0439"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT274 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98370"
FT                   /protein_id="AAP98370.1"
FT                   /translation="MLDNEWKAILGWGDDELEELRISGYSFLRQGHYSKAILFFEALVI
FT                   LDPLSIYDHQTLGGLYLQIGENSQALAVLDQALRMQGDHLPTLLNKTKALFCLGRIEEA
FT                   TAIATYLSSCPIPAIANDAEALLMSYSKATKKNAALVR"
FT   gene            467113..468465
FT                   /locus_tag="CpB0440"
FT   CDS_pept        467113..468465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0440"
FT                   /product="replication initiation protein dnaA"
FT                   /note="similar to replication initiation protein dnaA -
FT                   Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98371"
FT                   /db_xref="GOA:Q9Z8B9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B9"
FT                   /protein_id="AAP98371.1"
FT                   /translation="MLTCNECTTWEQFLNYVKTRCSKTAFENWISPIQVLEETQEKIRL
FT                   EVPNIFVQNYLLDNYKRDLCSFVPLDVHGEPALEFVVAEHKKPSAPVASQKESNEGISE
FT                   VFEETKDFELKLNLSYRFDNFIEGPSNQFVKSAAVGIAGKPGRSYNPLFIHGGVGLGKT
FT                   HLLHAVGHYVREHHKNLRIHCITTEAFINDLVYHLKSKSVDKMKNFYRSLDLLLVDDIQ
FT                   FLQNRQNFEEEFCNTFETLINLSKQIVITSDKPPSQLKLSERIIARMEWGLVAHVGIPD
FT                   LETRVAILQHKAEQKGLLIPNEMAFYIADHIYGNVRQLEGAINKLTAYCRLFGKSLTET
FT                   TVRETLKELFRSPTKQKISVETILKSVATVFQVKLNDLKGNSRSKDLVLARQIAMYLAK
FT                   TLITDSLVAIGAAFGKTHSTVLYACKTIEHKLQNDETLKRQVNLCKNHIVG"
FT   gene            468481..469068
FT                   /locus_tag="CpB0442"
FT   CDS_pept        468481..469068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0442"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT276 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98372"
FT                   /protein_id="AAP98372.1"
FT                   /translation="MFRRTGKGPFEDVQTLYEEETSSPSSYSPYSRSERPETPPSLFDN
FT                   PKASEARPLNHNLTEESSLPQWSSTPRTESLLPLEEPETTLGEGVTFKGELAFERLLRI
FT                   DGTFEGILVSKGKIIIGPKGVVKADIQLQEAIIEGVVEGNITVSGKVELRGGAIIKGDI
FT                   QANTLCVDEGVRILGYLAIAGITDHSERERDL"
FT   gene            complement(469034..469612)
FT                   /locus_tag="CpB0441"
FT   CDS_pept        complement(469034..469612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0441"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT277 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98373"
FT                   /protein_id="AAP98373.1"
FT                   /translation="MVLFSLLFPKLCYGCQAPGAYFCSNCLEKLLVEDREGRCLHCFRY
FT                   LGSSETRLCSQCSPSSQLQAFSLYLPSQTALSVYARACEGKRPALQFFSKSIAFELASL
FT                   DETPSCIAYITSTISRKIVVEVAKLEKLLRIPLWPWLPKKRQIEKLPKGEGICFLSAYP
FT                   LSQKWMQTIVGGSASPLVSISLFLSQNDQ"
FT   gene            469708..471219
FT                   /gene="nrqB"
FT                   /locus_tag="CpB0443"
FT   CDS_pept        469708..471219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrqB"
FT                   /locus_tag="CpB0443"
FT                   /product="NADH dehydrogenase (ubiquinone) chain"
FT                   /note="similar to NADH dehydrogenase (ubiquinone) chain
FT                   nrqB - Vibrio alginolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98374"
FT                   /db_xref="GOA:Q9Z8B6"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B6"
FT                   /protein_id="AAP98374.1"
FT                   /translation="MLKKFINSLWKLCQQDKYQRFTPIVDAIDTFCYEPIETPSKPPFI
FT                   RDSVDVKRWMMLVVIALFPATFVAIWNSGLQSIVYSSGNPVLMEQFLHISGFGSYLSFV
FT                   YKEIHIVPILWEGLKIFIPLLTISYVVGGTCEVLFAVVRGHKIAEGLLVTGILYPLTLP
FT                   PTIPYWMAALGIAFGIVVSKELFGGTGMNILNPALSGRAFLFFTFPAKMSGDVWVGSNP
FT                   GVIKDSLMKMNSSTGKVLIDGFSQSTCLQTLNSTPPSVKRLHVDAIAANMLHIPHVPTQ
FT                   DVIHSQFSLWTETHPGWVLDNLTLTQLQTFVTAPVAEGGLGLLPTQFDSAYAITDVIYG
FT                   IGKFSAGNLFWGNIIGSLGETSTFACLLGAIFLIVTGIASWRTMAAFGIGAFLTGWLFK
FT                   FISVLIVGQNGAWAPARFFIPAYRQLFLGGLAFGLVFMATDPVSSPTMKLGKWIYGFFI
FT                   GFMTIVIRLINPAYPEGVMLAILLGNVFAPLIDYFAVRKYRKRGV"
FT   gene            471223..472185
FT                   /locus_tag="CpB0444"
FT   CDS_pept        471223..472185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0444"
FT                   /product="Na+-translocating NADH-ubiquinone oxidoreductase
FT                   gamma chain"
FT                   /note="similar to Na+-translocating NADH-ubiquinone
FT                   oxidoreductase gamma chain - Vibrio alginolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98375"
FT                   /db_xref="GOA:Q9Z8B5"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B5"
FT                   /protein_id="AAP98375.1"
FT                   /translation="MSKGSSKHTVRINQTWYIVSFILGLSLFAGVLLSTIYYVLSPIQE
FT                   QAATFDRNKQMLLAAHILDFKGRFQIQEKKEWVPATFDKKTQLLEVATKKVSEVSYPEL
FT                   ELYAERFVRPLLTDAQGKVFSFEEKNLNPIEFFEKYQESPPCQQSPLPFYVILENTSRT
FT                   ENMSGADVAKDLSTVQALIFPISGFGLWGPIHGYLGVKNDGDTVLGTAWYQQGETPGLG
FT                   ANITNPEWQEQFYGKKIFLQDSSGTTNFATTDLGLEVVKGSVRTTLGDSPKALSAIDGI
FT                   SGATLTCNGVTEAYVQSLACYRQLLINFSNLTHEKKTGE"
FT   gene            472182..472823
FT                   /gene="nqrD"
FT                   /locus_tag="CpB0445"
FT   CDS_pept        472182..472823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="CpB0445"
FT                   /product="NADH dehydrogenase (ubiquinone) protein"
FT                   /note="similar to NADH dehydrogenase (ubiquinone) nqrD
FT                   protein - Vibrio alginolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98376"
FT                   /db_xref="GOA:Q9Z8B4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B4"
FT                   /protein_id="AAP98376.1"
FT                   /translation="MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMG
FT                   IAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIISLFVIVIDQFLKAFFFDISKTLSVF
FT                   VGLIITNCIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTLMGF
FT                   RIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR"
FT   gene            472827..473597
FT                   /gene="nqr5"
FT                   /locus_tag="CpB0446"
FT   CDS_pept        472827..473597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqr5"
FT                   /locus_tag="CpB0446"
FT                   /product="Na+-translocating NADH-quinone reductase"
FT                   /note="similar to Na+-translocating NADH-quinone reductase
FT                   nqr5 - Vibrio alginolyticus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98377"
FT                   /db_xref="GOA:Q9Z8B3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B3"
FT                   /protein_id="AAP98377.1"
FT                   /translation="MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTA
FT                   NGLGMSVALVLTVTGSINWFVHAFITGPKALTWISPSLASVNLGFLELIIFIVVIAAFT
FT                   QILELLLEKVSRNLYLSLGIFLPLIAVNCAILGGVLFGITRSYPFIPMMIFSLGAGCGW
FT                   WLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAP
FT                   LETEVVENTTNPLKESSSKHQPSISKARTQRRSL"
FT   gene            complement(473649..473984)
FT                   /locus_tag="CpB0447"
FT   CDS_pept        complement(473649..473984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98378"
FT                   /protein_id="AAP98378.1"
FT                   /translation="MTTLPKYVPRSRQNPDTLTFLKRYSSVLLHSENSLSYRIFAKVLA
FT                   ILLTSLAVAFAVTLFSCEGSQLRLCALYIGIALAICVLLTIVVYCIASKIATACKKPPS
FT                   ISRIEIV"
FT   gene            complement(474012..474317)
FT                   /locus_tag="CpB0448"
FT   CDS_pept        complement(474012..474317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98379"
FT                   /protein_id="AAP98379.1"
FT                   /translation="MDPASPVAPHVLQDHVQLSSEELSALSSGVSRVKKLTIAIMVLSL
FT                   IAISLVACGLFLTGSAPLQLSIWIAASCITLSMLVCACWRYKISNALEKTKVAHES"
FT   gene            complement(474427..474777)
FT                   /locus_tag="CpB0449"
FT   CDS_pept        complement(474427..474777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0449"
FT                   /product="glycine cleavage system protein H"
FT                   /note="similar to glycine cleavage system protein H -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98380"
FT                   /db_xref="GOA:Q9Z8B0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017514"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8B0"
FT                   /protein_id="AAP98380.1"
FT                   /translation="MMWYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSL
FT                   CKEGEVLVILESSKSAIEVLSPVSGEVIDINLDLVDNPQKINEAPEGEGWLAVVRLDQD
FT                   WDPSNLSLMDEE"
FT   gene            complement(474774..476852)
FT                   /locus_tag="CpB0450"
FT   CDS_pept        complement(474774..476852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0450"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT283 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98381"
FT                   /protein_id="AAP98381.1"
FT                   /translation="MLSFFYKHQKKFIGIVIAVVCVSGTGVGWGRFSRKGSAESTSRRT
FT                   VFTTASGKRYVEKDFMAMKKFFAHEAYPFTGNPRAWNFINEGLLTDYFLTTRVGEKLFL
FT                   KVYHPGEKIFSKEKAYQPYRRFDAPFISSEEVWKSSAPQLLEILKVFQQIENPISKEGF
FT                   LARAKLFLEERRFPHYVLRQMLEYRRQMFALPPDEALSRGKDLRLFGYQTIQDWFGDAY
FT                   LSAAVELLIRFIDEQKKVLPRPSKQEARDDFYDKAKHAYTKISKNKEFSLGFEEFVNSY
FT                   FQFLEISESEFFNMYRDILLCKRALLLLQGGVSFDFQPLTTFFVQGKDSIQVEFFRLPK
FT                   EYSFKTKQELKAFEVYLKLVSLPKSDSLDVPNEILPIATIKAKEPRLVGRRFSIDYKRV
FT                   ALQDLAATVPMVEVLHWQQNSEHFQEILQQFPDVETCQSYKDFQHLKPALRDKISLFTR
FT                   KEILRARPERILQSLQQVPKQSQEVLLSAGKNSALPGISDGQQLAKVLLENEVLDLYSQ
FT                   DAETYYTIIVNSSFEKEEVLPYREVLKRDLASQLLTSHGHLVDMERLESALRTRYPGEE
FT                   GASLWQRRLWKVVENHRLGRHLEGSFSWSLDRSLKTFSRGDKELPQEFDRIFSMKVGDY
FT                   SSVFMSPNEGPCYYQCLSHLLYDRPASVDKLFLAKSQLDEELLGSYMERFIEQGVVR"
FT   gene            complement(476973..478403)
FT                   /locus_tag="CpB0451"
FT   CDS_pept        complement(476973..478403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0451"
FT                   /product="putative phospholipase D"
FT                   /note="similar to probable phospholipase D - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98382"
FT                   /protein_id="AAP98382.1"
FT                   /translation="MMSRLRFRLAALGIFFILLVPNSVSAKTIVASDKEKVGVLVYDNS
FT                   VEAFQQILDCIDHANFYVELCPCMTGGRTLKEMVDHLEARMDLVPELCSYIIIQPTFTD
FT                   AEDQKLLKALKERHPNRFFYVFTGCPPSTSILAPNVIEMHIKLSIIDGKYCILGGTNFE
FT                   EFMCTPGDEVPEKVDNPRLFVSGVRRPLAFRDQDIMLRSTAFGLQLREEYHKQFAMWDY
FT                   YAHHMWFIDNPEQFAGACPPLTLEQAEETVFPGFDKHEDLVLVDSSKIRIVLGGPHDKQ
FT                   PNPVTQEYLKLIQGARSSVKLAHMYFIPKDELLNALVDVSHNHGVHLSLITNGCHELSP
FT                   AITGPYAWGNRINYFALLYGKRYPLWKKWFCEKLKPYERVSIYEFAIWETQLHKKCMII
FT                   DDEIFVIGSYNFGKKSDAFDYESIVVIESPEVAAKANKVFNKDIGLSIPVSHGDIFSWY
FT                   FHSVHHTLGHLQLTYMPA"
FT   gene            complement(478400..479119)
FT                   /locus_tag="CpB0452"
FT   CDS_pept        complement(478400..479119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0452"
FT                   /product="putative lipoate protein ligase"
FT                   /note="similar to probable lipoate protein ligase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98383"
FT                   /protein_id="AAP98383.1"
FT                   /translation="MKVRIVDSGKSSAASHMAKDRDLLESLQDGELILHLYEWENPCSL
FT                   TYGHFMRPEKFLLSNYADLGLDAAVRPTGGGFVFHKGDYAFSVLMSATHPSYSSSVLEN
FT                   YHTVNSFVAKVLEKVFRIQGMLAPEDENSSSRDSGNFCMAKTSKYDVLFGDKKIGGAAQ
FT                   RKVQQGFLHQGSLFLSGSSSEFYQRFLKPEVLEEIIEQIQIHAFFPLGLEAADEVLQEA
FT                   RQQVKEAFIKLFCGEGL"
FT   gene            479317..481854
FT                   /gene="clpC"
FT                   /locus_tag="CpB0454"
FT   CDS_pept        479317..481854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="CpB0454"
FT                   /product="class III stress response-related ATPase"
FT                   /note="similar to class III stress response-related ATPase
FT                   clpC - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98384"
FT                   /db_xref="GOA:Q9Z8A6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A6"
FT                   /protein_id="AAP98384.1"
FT                   /translation="MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVA
FT                   VNVLRNLGIDFDTARQEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASLLEHNYV
FT                   GTEHLLLGILHQSDSVALQVLENLHIDPREVRKEILKELETFNLQLPPSSSSSSSSSRS
FT                   NPSSSKSPLGHSLGSDKNEKLSALKAYGYDLTEMVRESKLDPVIGRSSEVERLILILCR
FT                   RRKNNPVLIGEAGVGKTAIVEGLAQKIILNEVPDALRKKRLITLDLALMIAGTKYRGQF
FT                   EERIKAVMDEVRKHGNILLFIDELHTIVGAGAAEGAIDASNILKPALARGEIQCIGATT
FT                   IDEYRKHIEKDAALERRFQKIVVHPPSVDETIEILRGLKKKYEEHHNVFITEEALKAAA
FT                   TLSDQYVHGRFLPDKAIDLLDEAGARVRVNTMGQPTDLMKLEAEIENTKLAKEQAIGTQ
FT                   EYEKAAGLRDEEKKLRERLQSMKQEWENHKEEHQVPVDEEAVAQVVSLQTGIPSARLTE
FT                   AESEKLLKLEDTLRRKVIGQNDAVTSICRAIRRSRTGIKDPNRPTGSFLFLGPTGVGKS
FT                   LLAQQIAIEMFGGEDALIQVDMSEYMEKFAATKMMGSPPGYVGHEEGGHLTEQVRRRPY
FT                   CVVLFDEIEKAHPDIMDLMLQILEQGRLTDSFGRKVDFRHAIIIMTSNLGADLIRKSGE
FT                   IGFGLKSHMDYKVIQEKIEHAMKKHLKPEFINRLDESVIFRPLEKESLSEIIHLEINKL
FT                   DSRLKNYQMALNIPDSVISFLVTKGHSPEMGARPLRRVIEQYLEDPLAELLLKESCRQE
FT                   ARKLRATLVENRVAFEREEEEQEAALPSPHLES"
FT   gene            complement(481832..482917)
FT                   /locus_tag="CpB0453"
FT   CDS_pept        complement(481832..482917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0453"
FT                   /product="putative p-loop ATPase"
FT                   /note="similar to probable p-loop ATPase - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98385"
FT                   /db_xref="GOA:Q9Z8A5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A5"
FT                   /protein_id="AAP98385.1"
FT                   /translation="MQQTVIVAMSGGVDSSVVAYLFKKFTNYKVIGLFMKNWEEDSEGG
FT                   LCSSTKDYEDVERVCLQLDIPYYTVSFAKEYRERVFARFLKEYSLGYTPNPDILCNREI
FT                   KFDLLQKKVQELGGDYLATGHYCRLNTELQETQLLRGCDPQKDQSYFLSGTPKSALHNV
FT                   LFPLGEMNKTEVRAIAAQAALPTAEKKDSTGICFIGKRPFKEFLEKFLPNKTGNVIDWD
FT                   TKEIVGQHQGAHYYTIGQRRGLDLGGSEKPCYVVGKNIEENSIYIVRGEDHPQLYLREL
FT                   TARELNWFTPPKSGCHCSAKVRYRSPDEACTIDYSSGDEVKVRFSQPVKAVTPGQTIAF
FT                   YQGDTCLGSGVIDVPMIPSEG"
FT   gene            483141..483581
FT                   /locus_tag="CpB0455"
FT   CDS_pept        483141..483581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98386"
FT                   /protein_id="AAP98386.1"
FT                   /translation="MGEKGNVFLTHSIPMHIAAITILVIVAPAGIAIICLGCYSQSILL
FT                   IAVGIVLTILTLLCLQALVGFIKFIRQLPQQLHTTVQFIREKIRPESSLQLVTNAQRKT
FT                   TQDTLKLYEELCDLSQKEFKLQSTLYQKRFELSHKNEKTNQN"
FT   gene            483606..484244
FT                   /locus_tag="CpB0456"
FT   CDS_pept        483606..484244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98387"
FT                   /db_xref="GOA:Q9Z8A3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A3"
FT                   /protein_id="AAP98387.1"
FT                   /translation="MATSVAPSPVPESSPLSHATEVLNLPNAYITQPHPIPAAPWETFR
FT                   SKLSTKHTLCFALTLLLTLGGTISAGYAGYTGNWIICGIGLGIIVLTLILALLLAIPLK
FT                   NKQTGTKLIDEISQDISSIGSGFVQRYGLMFSTIKSVHLPELTTQNQEKTRILNEIEAK
FT                   KESIQNLELKITECQNKLAQKQPKRKSSQKSFMRSIKHLSKNPVILFDC"
FT   gene            484392..485342
FT                   /locus_tag="CpB0457"
FT   CDS_pept        484392..485342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0457"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT007 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A2"
FT                   /protein_id="AAP98388.1"
FT                   /translation="MFKLLFHIAAFAGHVLSTPIFIVQDACGIDEEACKNPPPRPFSAQ
FT                   VQYLKVNDAKFKKLPHQTIGYRQYDGTFLCTLPITEHSGLLFSTGYIGADIQWKSSLPI
FT                   SETDPNGLGWATFQDTSFYNYVLLSLGAYTLSLKNWQWSIILSGLVDPKNIEMGYGLYQ
FT                   GVLSGKYQATEKLSAIFGVINETGLHQEKAWPLVGVSYKATDQLTLNCIYPVNFSIDYR
FT                   STSVCNLGLAYRLTRFRKKLHKNHLISSRGIFEYQGREIEANVKLTPWPGSFIKGFYGW
FT                   SIGNDISIADDHNNNKTSHTFKTSAFFGGSAVMNF"
FT   gene            485514..486032
FT                   /locus_tag="CpB0458"
FT   CDS_pept        485514..486032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0458"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT006 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98389"
FT                   /db_xref="GOA:Q9Z8A1"
FT                   /db_xref="InterPro:IPR035358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A1"
FT                   /protein_id="AAP98389.1"
FT                   /translation="MGFKNICKQGSQLYLNGIFPERILARKLKNCAKSYPRTALTIEVL
FT                   VSSVLGALKVILIPCASTYAALTLPLRALFNAIKTKSCQHLASYAMAWLLHILTIAVII
FT                   GLVFSLVFIPPPVVFISLGLLMSVTTSVTLFQVHKNLFPPYEPPPSRPHTPPPFADEYV
FT                   PLISESYFD"
FT   gene            486230..487483
FT                   /locus_tag="CpB0459"
FT   CDS_pept        486230..487483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0459"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT005 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98390"
FT                   /db_xref="GOA:Q9Z8A0"
FT                   /db_xref="InterPro:IPR035355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z8A0"
FT                   /protein_id="AAP98390.1"
FT                   /translation="MSQPPINPLGQPQVPAAASPSGQPSVVKRLKTSSTGLFKRFITVP
FT                   DKYPKMRYVYDTGIIALAAIAILSILLTASGNSLVLYALAPALALGALGVTLLISDILD
FT                   SPKAKKIGEAITAIVVPIIVLAIAAGLIAGAFVASSGTMLVFANPMFVMGLITVGLYFM
FT                   SLNKLTLDYFRREHLLRMEKKTQETAEPILVTPSADDAKKIAVEKKKDLSASARMEEHE
FT                   ASQRQDARHRRIGREAQGSFFYSSRNPEHRRSFGSLSRFKTKPSDAASTRPASISPPFK
FT                   DDFQPYHFKDLRSSSFGSGASSAFTPIMPASSRSPNFSTGTVLHPEPVYPKGGKEPSIP
FT                   RVSSSSRRSPRDRQDKQQQQQNQDEEQKQQSKKKSGKSNQSLKTPPPDGKSTANLSPSN
FT                   PFSDGYDEREKRKHRKNK"
FT   gene            487788..492011
FT                   /locus_tag="CpB0460"
FT   CDS_pept        487788..492011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0460"
FT                   /product="Omp11"
FT                   /note="similar to outer membrane protein omp11 - Chlamydia
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98391"
FT                   /db_xref="GOA:Q9Z899"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z899"
FT                   /protein_id="AAP98391.1"
FT                   /translation="MKYSLPWLLTSSALVFSLHPLMAANTDLSSSDNYENGSSGSAAFT
FT                   AKETSDASGTTYTLTSDVSITNVSAITPADKSCFTNTGGALSFVGADHSLVLQTIALTH
FT                   DGAAINNTNTALSFSGFSSLLIDSAPATGTSGGKGAICVTNTEGGTATFTDNASVTLQK
FT                   NTSEKDGAAVSAYSIDLAKTTTAALLDQNTSTKNGGALCSTANTTVQGNSGTVTFSSNT
FT                   ATDKGGGIYSKEKDSTLDANTGVVTFKSNTAKTGGAWSSDDNLALTGNTQVLFQENKTT
FT                   GSAAQANNPEGCGGAICCYLATATDKTGLAISQNQEMSFTSNTTTANGGAIYATKCTLD
FT                   GNTTLTFDQNTATAGCGGAIYTETEDFSLKGSTGTVTFSTNTAKTGGALYSKGNSSLTG
FT                   NTNLLFSGNKATGPSNSSANQEGCGGAILAFIDSGSVSDKTGLSIANNQEVSLTSNAAT
FT                   VSGGAIYATKCTLTGNGSLTFDGNTAGTSGGAIYTETEDFTLTGSTGTVTFSTNTAKTG
FT                   GALYSKGNNSLSGNTNLLFSGNKATGPSNSSANQEGCGGAILSFLESASVSTKKGLWIE
FT                   DNENVSLSGNTATVSGGAIYATKCALHGNTTLTFDGNTAETAGGAIYTETEDFTLTGST
FT                   GTVTFSTNTAKTAGALHTKGNTSFTKNKALVFSGNSATATATTTTDQEGCGGAILCNIS
FT                   ESDIATKSLTLTENESLSFINNTAKRSGGGIYAPKCVISGSESINFDGNTAETSGGAIY
FT                   SKNLSITANGPVSFTNNSGGKGGAIYIADSGELSLEAIDGDITFSGNRATEGTSTPNSI
FT                   HLGAGAKITKLAAAPGHTIYFYDPITMEAPASGGTIEELVINPVVKAIVPPPQPKNGPI
FT                   ASVPVVPVAPANPNTGTIVFSSGKLPSQDASIPANTTTILNQKINLAGGNVVLKEGATL
FT                   QVYSFTQQPDSTVFMDAGTTLETTTTNNTDGSIDLKNLSVNLDALDGKRMITIAVNSTS
FT                   GGLKISGDLKFHNNEGSFYDNPGLKANLNLPFLDLSSTSGTVNLDDFNPIPSSMAAPDY
FT                   GYQGSWTLVPKVGAGGKVTLVAEWQALGYTPKPELRATLVPNSLWNAYVNIHSIQQEIA
FT                   TAMSDAPSHPGIWIGGIGNAFHQDKQKENAGFRLISRGYIVGGSMTTPQEYTFAVAFSQ
FT                   LFGKSKDYVVSDIKSQVYAGSLCAQSSYVIPLHSSLRRHVLSKVLPELPGETPLVLHGQ
FT                   VSYGRNHHNMTTKLANNTQGKSDWDSHSFAVEVGGSLPVDLNYRYLTSYSPYVKLQVVS
FT                   VNQKGFQEVAADPRIFDASHLVNVSIPMGLTFKHESAKPPSALLLTLGYAVDAYRDHPH
FT                   CLTSLTNGTSWSTFATNLSRQAFFAEASGHLKLLHGLDCFASGSCELRSSSRSYNANCG
FT                   TRYSF"
FT   gene            complement(492027..492191)
FT                   /locus_tag="CpB0461"
FT   CDS_pept        complement(492027..492191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98392"
FT                   /protein_id="AAP98392.1"
FT                   /translation="MIDAENQNPKDGGSFTSLHTDPKNLFDEEGMPSPSDTLQCDLNNV
FT                   FIFIKSMFF"
FT   gene            492273..495083
FT                   /locus_tag="CpB0462"
FT   CDS_pept        492273..495083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0462"
FT                   /product="Omp5"
FT                   /note="similar to outer membrane protein omp5 - Chlamydia
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98393"
FT                   /db_xref="GOA:Q9Z898"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z898"
FT                   /protein_id="AAP98393.1"
FT                   /translation="MKSSVSWLFFSSIPLFSSLSIVAAEVTLDSSNNSYDGSNGTTFTV
FT                   FSTTDAAAGTTYSLLSDVSFQNAGALGIPLASGCFLEAGGDLTFQGNQHALKFAFINAG
FT                   SSAGTVASTSAADKNLLFNDFSRLSIISCPSLLLSPTGQCALKSVGNLSLTGNSQIIFT
FT                   QNFSSDNGGVINTKNFLLSGTSQFASFSRNQAFTGKQGGVVYATGTITIENSPGIVSFS
FT                   QNLAKGSGGALYSTDNCSITDNFQVIFDGNSAWEAAQAQGGAICCTTTDKTVTLTGNKN
FT                   LSFTNNTALTYGGAISGLKVSISAGGPTLFQSNISGSSAGQGGGGAINIASAGELALSA
FT                   TSGDITFNNNQVTNGSTSTRNAINIIDTAKVTSIRAATGQSIYFYDPITNPGTAASTDT
FT                   LNLNLADANSEIEYGGAIVFSGEKLSPTEKAIAANVTSTIRQPAVLARGDLVLRDGVTV
FT                   TFKDLTQSPGSRILMDGGTTLSAKEANLSLNGLAVNLSSLDGTNKAALKTEAADKNISL
FT                   SGTIALIDTEGSFYENHNLKSASTYPLLELTTAGANGTITLGALSTLTLQEPETHYGYQ
FT                   GNWQLSWANATSSKIGSINWTRTGYIPSPERKSNLPLNSLWGNFIDIRSINQLIETKSS
FT                   GEPFERELWLSGIANFFYRDSMPTRHGFRHISGGYALGITATTPAEDQLTFAFCQLFAR
FT                   DRNHITGKNHGDTYGASLYFHHTEGLFDIANFLWGKATRAPWVLSEISQIIPLSFDAKF
FT                   SYLHTDNHMKTYYTDNSIIKGSWRNDAFCADLGASLPFVISVPYLLKEVEPFVKVQYIY
FT                   AHQQDFYERHAEGRAFNKSELINVEIPIGVTFERDSKSEKGTYDLTLMYILDAYRRNPK
FT                   CQTSLIASDANWMAYGTNLARQGFSVRAANHFQVNPHMEIFGQFAFEVRSSSRNYNTNL
FT                   GSKFCF"
FT   gene            495127..497919
FT                   /locus_tag="CpB0463"
FT   CDS_pept        495127..497919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0463"
FT                   /product="outer membrane protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98394"
FT                   /db_xref="GOA:Q9Z393"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z393"
FT                   /protein_id="AAP98394.1"
FT                   /translation="MKIPLHKLLISSTLVTPILLSIATYGADASLSPTDSFDGAGGSTF
FT                   TPKSTADANGTNYVLSGNVYINDAGKGTALTGCCFTETTGDLTFTGKGYSFSFNTVDAG
FT                   SNAGAAASTTADKALTFTGFSNLSFIAAPGTTVASGKSTLSSAGALNLTDNGTILFSQN
FT                   VSNEANNNGGAITAKTLSISGNTSSITFTSNSAKKLGGAIYSSAAASISGNTGQLVFMN
FT                   NKGETGGGALGFEASSSITQNSSLFFSGNTATDAAGKGGAIYCEKTGETPTLTISGNKS
FT                   LTFAENSSVTQGGAICAHGLDLSAAGPTLFSNNRCGNTAAGKGGAIAIADSGSLSLSAN
FT                   QGDITFLGNTLTSTSAPTSTRNAIYLGSSAKITNLRAAQGQSIYFYDPIASNTTGASDV
FT                   LTINQPDSNSPLDYSGTIVFSGEKLSADEAKAADNFTSILKQPLALASGTLALKGNVEL
FT                   DVNGFTQTEGSTLLMQPGTKLKADTEAISLTKLVVDLSALEGNKSVSIETAGANKTITL
FT                   TSPLVFQDSSGNFYESHTINQAFTQPLVVFTAATAASDIYIDALLTSPVQTPEPHYGYQ
FT                   GHWEATWADTSTAKSGTMTWVTTGYNPNPERRASVVPDSLWASFTDIRTLQQIMTSQAN
FT                   SIYQQRGLWASGTANFFHKDKSGTNQAFRHKSYGYIVGGSAEDFSENIFSVAFCQLFGK
FT                   DKDLFIVENTSHNYLASLYLQHRAFLGGLPMPSFGSITDMLKDIPLILNAQLSYSYTKN
FT                   DMDTRYTSYPEAQGSWTNNSGALELGGSLALYLPKEAPFFQGYFPFLKFQAVYSRQQNF
FT                   KESGAEARAFDDGDLVNCSIPVGIRLEKISEDEKNNFEISLAYIGDVYRKNPRSRTSLM
FT                   VSGASWTSLCKNLARQAFLASAGSHLTLSPHVELSGEAAYELRGSAHIYNVDCGLRYSF
FT                   "
FT   gene            498069..500855
FT                   /locus_tag="CpB0464"
FT   CDS_pept        498069..500855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0464"
FT                   /product="outer membrane protein 10"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98395"
FT                   /db_xref="GOA:Q9Z398"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z398"
FT                   /protein_id="AAP98395.1"
FT                   /translation="MKSSLHWFLISSSLALPLSLNFSAFAAVVEINLGPTNSFSGPGTY
FT                   TPPAQTTNADGTIYNLTGDVSITNAGSPTALTASCFKETTGNLSFQGHGYQFLLQNIDA
FT                   GANCTFTNTAANKLLSFSGFSYLSLIQTTNATTGTGAIKSTGACSIQSNYSCYFGQNFS
FT                   NDNGGALQGSSISLSLNPNLTFAKNKATQKGGALYSTGGITINNTLNSASFSENTAANN
FT                   GGAIYTEASSFISSNKAISFINNSVTATSATGGAIYCSSTSAPKPVLTLSDNGELNFIG
FT                   NTAITSGGAIYTDNLVLSSGGPTLFKNNSAIDTAAPLGGAIAIADSGSLSLSALGGDIT
FT                   FEGNTVVKGASSSQTTTRNSINIGNTNAKIVQLRASQGNTIYFYDPITTSITAALSDAL
FT                   NLNGPDLAGNPAYQGTIVFSGEKLSEAEAAEADNLKSTIQQPLTLAGGQLSLKSGVTLV
FT                   AKSFSQSPGSTLLMDAGTTLETADGITINNLVLNVDSLKETKKATLKATQASQTVTLSG
FT                   SLSLVDPSGNVYEDVSWNNPQVFSCLTLTADDPANIHITDLAADPLEKNPIHWGYQGNW
FT                   ALSWQEDTATKSKAATLTWTKTGYNPNPERRGTLVANTLWGSFVDVRSIQQLVATKVRQ
FT                   SQETRGIWCEGISNFFHKDSTKINKGFRHISAGYVVGATTTLASDNLITAAFCQLFGKD
FT                   RDHFINKNRASAYAASLHLQHLATLSSPSLLRYLPGSESEQPVLFDAQISYIYSKNTMK
FT                   TYYTQAPKGESSWYNDGCALELASSLPHTALSHEGLFHAYFPFIKVEASYIHQDSFKER
FT                   NTTLVRSFDSGDLINVSVPIGITFERFSRNERASYEATVIYVADVYRKNPDCTTALLIN
FT                   NTSWKTTGTNLSRQAGIGRAGIFYAFSPNLEVTSNLSMEIRGSSRSYNADLGGKFQF"
FT   gene            complement(501196..502305)
FT                   /locus_tag="CpB0465"
FT   CDS_pept        complement(501196..502305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0465"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yxjG - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98396"
FT                   /protein_id="AAP98396.1"
FT                   /translation="MMSPFQQPEQCHFDVVGSFLRPESLTRARSDFEEGRIVYEQMRVV
FT                   EDAAIRNLIKKQTEAGLIFFTDGEFRRYSWDFDFMWGFHGVDRRRDSNDPEIGVYLKDK
FT                   ISVSKHPFIEHFEFVKTFEKGNAKAKQTIPSPSQFFHEMIFAPNLKNTRKFYPTNQELI
FT                   DDIVFYYRQVIQDLYAAGCRNLQLDDCAWCRLLDIRAPSWYGVDSHDRLQEILEQFLWI
FT                   HNLVMKDRPEDLFVSLHVCRGDYQAEFFSRRAYDSIEEPLFAKTDVDSYHYYWALDDKY
FT                   SGGAEPLAYVSGEKHVCLGLISSNHSCIEDRDAVVSRIYEAASYIPLERLSLSPQCGFA
FT                   SCEGDHRMTEEEQWKKIAFVKEIAKEIWG"
FT   gene            complement(502346..502516)
FT                   /locus_tag="CpB0466"
FT   CDS_pept        complement(502346..502516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98397"
FT                   /protein_id="AAP98397.1"
FT                   /translation="MQRRYVSFFFKGRGVVTPILRFVRFPSGSNFYNRTLCFDLAVFLS
FT                   LIYSTIEKRDP"
FT   gene            complement(502828..505611)
FT                   /locus_tag="CpB0467"
FT   CDS_pept        complement(502828..505611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0467"
FT                   /product="outer membrane protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98398"
FT                   /db_xref="GOA:Q9RB65"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RB65"
FT                   /protein_id="AAP98398.1"
FT                   /translation="MKSQFSWLVLSSTLACFTSCSTVFAATAENIGPSDSFDGSTNTGT
FT                   YTPKNTTTGIDYTLTGDITLQNLGDSAALTKGCFSDTTESLSFAGKGYSLSFLNIKSSA
FT                   EGAALSVTTDKNLSLTGFSSLTFLAAPSSVITTPSGKGAVKCGGDLTFDNNGTILFKQD
FT                   YCEENGGAISTKNLSLKNSTGSISFEGNKSSATGKKGGAICATGTVDITNNTAPTLFSN
FT                   NIAEAAGGAINSTGNCTITGNTSLVFSENSVTATAGNGGALSGDADVTISGNQSVTFSG
FT                   NQAVANGGAIYAKKLTLASGGGGISFSNNIVQGTTAGNGGAISILAAGECSLSAEAGDI
FT                   TFNGNAIVATTPQTTKRNSIDIGSTAKITNLRAISGHSIFFYDPITANTAADSTDTLNL
FT                   NKADAGNSTDYSGSIVFSGEKLSEDEAKVADNLTSTLKQPVTLTAGNLVLKRGVTLDTK
FT                   GFTQTAGSSVIMDAGTTLKASTEEVTLTGLSIPVDSLGEGKKVVIAASAASKNVALSGP
FT                   ILLLDNQGNAYENHDLGKTQDFSFVQLSALGTATTTDVPAVPTVATPTHYGYQGTWGMT
FT                   WVDDTASTPKTKTATLAWTNTGYLPNPERQGPLVPNSLWGSFSDIQAIQGVIERSALTL
FT                   CSDRGFWAAGVANFLDKDKKGEKRKYRHKSGGYAIGGAAQTCSENLISFAFCQLFGSDK
FT                   DFLVAKNHTDTYAGAFYIQHITECSGFIGCLLDKLPGSWSHKPLVLEGQLAYSHVSNDL
FT                   KTKYTAYPEVKGSWGNNAFNMMLGASSHSYPEYLHCFDTYAPYIKLNLTYIRQDSFSEK
FT                   GTEGRSFDDSNLFNLSLPIGVKFEKFSDCNDFSYDLTLSYVPDLIRNDPKCTTALVISG
FT                   ASWETYANNLARQALQVRAGSHYAFSPMFEVLGQFVFEVRGSSRIYNVDLGGKFQF"
FT   gene            505774..508560
FT                   /locus_tag="CpB0468"
FT   CDS_pept        505774..508560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0468"
FT                   /product="outer membrane protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98399"
FT                   /db_xref="GOA:O86164"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O86164"
FT                   /protein_id="AAP98399.1"
FT                   /translation="MKTSIPWVLVSSVLAFSCHLQSLANEELLSPDDSFNGNIDSGTFT
FT                   PKTSATTYSLTGDVFFYEPGKGTPLSDSCFKQTTDNLTFLGNGHSLTFGFIDAGTHAGA
FT                   AASTTANKNLTFSGFSLLSFDSSPSTTVTTGQGTLSSAGGVNLENIRKLVVAGNFSTAD
FT                   GGAIKGASFLLTGTSGDALFSNNSSSTKGGAIATTAGARIANNTGYVRFLSNIASTSGG
FT                   AIDDEGTSILSNNKFLYFEGNAAKTTGGAICNTKASGSPELIISNNKTLIFASNVAETS
FT                   GGAIHAKKLALSSGGFTEFLRNNVSSATPKGGAISIDASGELSLSAETGNITFVRNTLT
FT                   TTGSTDTPKRNAINIGSNGKFTELRAAKNHTIFFYDPITSEGTSSDVLKINNGSAGALN
FT                   PYQGTILFSGETLTADELKVADNLKSSFTQPVSLSGGKLLLQKGVTLESTSFSQEAGSL
FT                   LGMDSGTTLSTTAGSITITNLGINVDSLGLKQPVSLTAKGASNKVIVSGKLNLIDIEGN
FT                   IYESHMFSHDQLFSLLKITVDADVDTNVDISSLIPVPAEDPNSEYGFQGQWNVNWTTDT
FT                   ATNTKEATATWTKTGFVPSPERKSALVCNTLWGVFTDIRSLQQLVEIGATGMEHKQGFW
FT                   VSSMTNFLHKTGDENRKGFRHTSGGYVIGGSAHTPKDDLFTFAFCHLFARDKDCFIAHN
FT                   NSRTYGGTLFFKHSHTLQPQNYLRLGRAKFSESAIEKFPREIPLALDVQVSFSHSDNRM
FT                   ETHYTSLPESEGSWSNECIAGGIGLDLPFVLSNPHPLFKTFIPQMKVEMVYVSQNSFFE
FT                   SSSDGRGFSIGRLLNLSIPVGAKFVQGDIGDSYTYDLSGFFVSDVYRNNPQSTATLVMS
FT                   PDSWKIRGGNLSRQAFLLRGSNNYVYNSNCELFGHYAMELRGSSRNYNVDVGTKLRF"
FT   gene            508818..510362
FT                   /locus_tag="CpB0469"
FT   CDS_pept        508818..510362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0469"
FT                   /product="outer membrane protein 13"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98400"
FT                   /db_xref="GOA:Q9Z3D6"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z3D6"
FT                   /protein_id="AAP98400.1"
FT                   /translation="MTILRNFLTCSALFLALPAAAQVVYLHESDGYNGAINNKSLEPKI
FT                   TCYPEGTSYIFLDDVRISNVKHDQEDAGVFINRSGNLFFMGNRCNFTFHNLMTEGFGAA
FT                   ISNRVGDTTLTLSNFSYLAFTSAPLLPQGQGAIYSLGSVMIENSEEVTFCGNYSSWSGA
FT                   AIYTPYLLGSKASRPSVNLSGNRYLVFRDNVSQGYGGAISTHNLTLTTRGPSCFENNHA
FT                   YHDVNSNGGAIAIAPGGSISISVKSGDLIFKGNTASQDGNTIHNSIHLQSGAQFKNLRA
FT                   VSESGVYFYDPISHSESHKITDLVINAPEGKETYEGTISFSGLCLDDHEVCAENLTSTI
FT                   LQDVTLAGGTLSLSDGVTLQLHSFKQEASSTLTMSPGTTLLCSGDARVQNLHILIEDTD
FT                   NFVPVRIRAEDKDALVSLEKLKVAFEAYWSVYDFPQFKEAFTIPLLELLGPSFDSLLLG
FT                   ETTLERTQVTTENDAVRGFWSLSWEEYPPSLDKDRRITPTKKTVFLTWNPEITSTP"
FT   gene            510733..513654
FT                   /locus_tag="CpB0470"
FT   CDS_pept        510733..513654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0470"
FT                   /product="outer membrane protein 14"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98401"
FT                   /db_xref="GOA:Q9Z896"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z896"
FT                   /protein_id="AAP98401.1"
FT                   /translation="MKTSIRKFLISTTLAPCFASTAFTVEVIMPSENFDGSSGKIFPYT
FT                   TLSDPRGTLCIFSGDLYIANLDNAISRTSSSCFSNRAGALQILGKGGVFSFLNIRSSAD
FT                   GAAISSVITQNPELCPLSFSGFSQMIFDNCESLTSDTSASNVIPHASAIYATTPMLFTN
FT                   NDSILFQYNRSAGFGAAIRGTSITIENTKKSLLFNGNGSISNGGALTGSAAINLINNSA
FT                   PVIFSTNATGIYGGAIYLTGGSMLTSGNLSGVLFVNNSSRSGGAIYANGNVTFSNNSDL
FT                   TFQNNTASPQNSLPAPTPPPTPPAVTPLLGYGGAIFCTPPATPPPTGVSLTISGENSVT
FT                   FLENIASEQGGALYGKKISIDSNKSTIFLGNTAGKGGAIAIPESGELSLSANQGDILFN
FT                   KNLSITSGTPTRNSIHFGKDAKFATLGATQGYTLYFYDPITSDDLSAASAAATVVVNPK
FT                   ASADGAYSGTIVFSGETLTATEAATPANATSTLNQKLELEGGTLALRNGATLNVHNFTQ
FT                   DEKSVVIMDAGTTLATTNGANNTDGAITLNKLVINLDSLDGTKAAVVNVQSTNGALTIS
FT                   GTLGLVKNSQDCCDNHGMFNKDLQQVPILELKATSNTVTTTDFSLGTNGYQQSPYGYQG
FT                   TWEFTIDTTTHTVTGNWKKTGYLPHPERLAPLIPNSLWANVIDLRAVSQASAADGEDVP
FT                   GKQLSITGITNFFHANHTGDARSYRHMGGGYLINTYTRITPDAALSLGFGQLFTKSKDY
FT                   LVGHGHSNVYFATVYSNITKSLFGSSRFFSGGTSRVTYSRSNEKVKTSYTKLPKGRCSW
FT                   SNNCWLGELEGNLPITLSSRILNLKQIIPFVKAEVAYATHGGIQENTPEGRIFGHGHLL
FT                   NVAVPVGVRFGKNSHNRPDFYTIIVAYAPDVYRHNPDCDTTLPINGATWTSIGNNLTRS
FT                   TLLVQASSHTSVNDVLEIFGHCGCDIRRTSRQYTLDIGSKLRF"
FT   gene            513681..516617
FT                   /locus_tag="CpB0471"
FT   CDS_pept        513681..516617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0471"
FT                   /product="outer membrane protein 11"
FT                   /note="similar to outer membrane protein 11 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98402"
FT                   /db_xref="GOA:Q9Z895"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z895"
FT                   /protein_id="AAP98402.1"
FT                   /translation="MPLSFKSSSFCLLACLCSASCAFAETRLGGNFVPPITNQGEEILL
FT                   TSDFVCSNFLGASFSSSFINSSSNLSLLGKGLSLTFTSCQAPTNSNYALLSAAETLTFK
FT                   NFSSINFTGNQSTGLGGLIYGKDIVFQSIKDLIFTTNRVAYSPASVTTSATPAITTVTT
FT                   GASALQPTDSLTVENISQSIKFFGNLANFGSAISSSPTAVVKFINNTATMSFSHNFTSS
FT                   GGGVIYGGSSLLFENNSGCIIFTANSCVNSLKGVTPSSGTYALGSGGAICIPTGTFELK
FT                   NNQGKCTFSYNGTPNDAGAIYAETCNIVGNQGALLLDSNTAARNGGAICAKVLNIQGRG
FT                   PIEFSRNRAEKGGAIFIGPSVGDPAKQTSTLTILASEGDIAFQGNMLNTKPGIRNAITV
FT                   EAGGEIVSLSAQGGSRLVFYDPITHSLPTTSPSNKDITINANGASGSVVFTSKGLSSTE
FT                   LLLPANTTTILLGTVKIASGELKITDNAVVNVLGFATQGSGQLTLGSGGTLGLATPTGA
FT                   PAAVDFTIGKLAFDPFSFLKRDFVSASVNAGTKNVTLTGALVLDEHDVTDLYDMVSLQS
FT                   PVAIPIAVFKGATVTKTGFPDGEIATPSHYGYQGKWSYTWSRPLLIPAPDGGFPGGPSP
FT                   SANTLYAVWNSDTLVRSTYILDPERYGEIVSNSLWISFLGNQAFSDILQDVLLIDHPGL
FT                   SITAKALGAYVEHTPRQGHEGFSGRYGGYQAALSMNYTDHTTLGLSFGQLYGKTNANPY
FT                   DSRCSEQMYLLSFFGQFPIVTQKSEALISWKAAYGYSKNHLNTTYLRPDKAPKSQGQWH
FT                   NNSYYVLISAEHPFLNWCLLTRPLAQAWDLSGFISAEFLGGWQSKFTETGDLQRSFSRG
FT                   KGYNVSLPIGCSSQWFTPFKKAPSTLTIKLAYKPDIYRVNPHNIVTVVSNQESTSISGA
FT                   NLRRHGLFVQIHDVVDLTEDTQAFLNYTFDGKNGFTNHRVSTGLKSTF"
FT   gene            complement(516670..516834)
FT                   /locus_tag="CpB0472"
FT   CDS_pept        complement(516670..516834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98403"
FT                   /protein_id="AAP98403.1"
FT                   /translation="MLSLGMQSRSYSLLSKTDYRFKRYSFFSNRLERGGGRSHRVRILA
FT                   FIAKFFDDG"
FT   gene            complement(516955..518874)
FT                   /locus_tag="CpB0473"
FT   CDS_pept        complement(516955..518874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98404"
FT                   /protein_id="AAP98404.1"
FT                   /translation="MISHCFERGVSHPGFPSDIAPILKVEKIAGRDHISRIENQLKSLR
FT                   KTIEVEDLDKVHGQYQENPYADMASSEVLKLDKGVHVSELGKAFSRVRNRITRSYSYAP
FT                   TPQLDSIAIVGIDLVSPEEQENLVRLANEVIQLYPKSKTTLYLLIDFNKEWVGDISSDK
FT                   EKQLRSLGLHSEVQCLSVLEPQGAEGEDTKHFDLMVGCYGKDSYLREGKILQQALGTSL
FT                   GTVPWVNVMHTLPSRYRSRLSLPINTEKDKTELYKEISRTHHQLHTLGMGLGAQDSGLL
FT                   LDRQRLHAPLSQGSHCHSYLADLTHEELKILLFSAFVDAKNISKKELREVSLNFANDTS
FT                   VESWLRFLLLVSYDEKEKDVVVVCNHSEPNILGLPPEAVSQLIEELSDEGYSYLNVVRC
FT                   DLSGETTVQQRLLLNADEGRSMTVVISELPEGHPDIRNLQLASERIFVSREKEAADAYA
FT                   SGCKVVAFDDEHLPWVSSHIAYAEEIREKQEQTMQGSLTEEQLGALLCNTVSTEKNLAF
FT                   ALDAVIKQSVWRFRNPDLFAYEREALEASVTDALVSYVSNLDMIPYTSSQGIVIEDSSI
FT                   VRTSQEHTLIVNCAAFDKLASQIEFLCPSDVLPISGKDPLISDDEDEELNPKVSSAADS
FT                   KDKT"
FT   gene            complement(519477..521366)
FT                   /locus_tag="CpB0474"
FT   CDS_pept        complement(519477..521366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98405"
FT                   /protein_id="AAP98405.1"
FT                   /translation="MASCLSAWFSIVREHFYRAFDFSLPFCARITEFVLGVIKGIPVVG
FT                   HIIVGIEWLVSRYLESFVTKPTFVSDVVSLLKTEKVAGRDHIARVVETLKRQRVAVAPE
FT                   DEDKVHGKIPVHPFGGIQPVEVLTLYPEVQDATLGLAFSKIRNRVRQAYLQAPRPKLQK
FT                   IYIIGNDMNPFEVDDFLHLARLCNETQRLYPDATISLYLTASGGRNAMDKKNRKLLSDC
FT                   ELNPKIACLDFNQGDVVKQATCDCWMVYHGENDQGTLNQIQEELEKSGEETPWIHVGQK
FT                   PLSQSLWDFSPFSSLEMKGDKEKALEYSELEKEQLYSRLVYVGERSSVLSLEFGDSRSG
FT                   ILMDPKRVHAPLSEGHYCHSYLADLENPGLQKTILAAFLNPKELSSTILQPISLNLILN
FT                   SKTYLRQHFGFFERMSRSDRNVVVVVCDSWWGTDWKEEPSFQHFIMELECRGYSHFNIF
FT                   AFRSNSMCVEERRILNESSQEKAFTMIFCEDSVSQGDIRCLHLASEGMLCGKECYAVDV
FT                   YTSGCANFMMEEVLTLERESNLWNRKHGLWKREVRKQKQEAALDQDESEIYVCNQLTAQ
FT                   QNFACSLDAAIRQSIWRSRMPELLSIERRALGEQLFTTVHHYLTTQKKILRGI"
FT   gene            complement(521734..523821)
FT                   /locus_tag="CpB0475"
FT   CDS_pept        complement(521734..523821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98406"
FT                   /protein_id="AAP98406.1"
FT                   /translation="MFVSNFIFFVVMPIPYISSWISTVRQHFVKAFDFSRPFCSRVTNF
FT                   ALGVIKAIPIVGHIVMGMEWLVSSCVAGIITRSSFTSDVVQIVKTEKALGRDHISRVAE
FT                   ILQRERGTITPENQDKVHGKFPVCPFGRLKSEETLKLKPGEREGTLDTVFSPIRTRVTR
FT                   AYLQAPRPEIRTISIVGSKLKTPQDFSQFVSLANETQRLHPEALVCLYLTGLNRESQMC
FT                   DTTTAEKKQYLHNSGLDSRIQCKDSKEDDAGSPENPELWIGYYSREQQHNIDGQYIQQC
FT                   LGKSADPIPWIHVTEDTKDFYYPPNFTSYSHTRQSTDPTSPPRLPESEGDKDSLYGQLS
FT                   RSYHHEYMLGLGLKPEDAGLLMDPDRIYAPLSQGHYCHSYLADIENEDLRTLVLSPFLD
FT                   PGNLSSEDLRPVAFNIARLPLELDSLFFRLVAGQQEGRNIVTLAHGTPRPEDLDPDSMN
FT                   ILTRRLQMSGYSYLNIFSYKSRKMIVKERQFFGDRSEGKSFTLILFEDPISAADFRCLQ
FT                   LAAEGMVAKDLPSVADICASGCSCIQFSEMQSPQAIEYRQWEARVEDEAGEEAREPVIY
FT                   SQDQLSSMLTTQQNFVFSLDAVVKQAIWRFRSKGLLTMERKALGEEFLTAIFSYLGSQE
FT                   RNENMGKRTTEEHEVVISFEELDRMVQVLPAEVPADSGNDPTRPVPNPDSNPDSSQNEG
FT                   S"
FT   gene            complement(524117..524548)
FT                   /locus_tag="CpB0476"
FT   CDS_pept        complement(524117..524548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98407"
FT                   /protein_id="AAP98407.1"
FT                   /translation="MHPGLRNWRTSTNKLREEGSVSFREYFRAYMCDKIVAQKNFLFTL
FT                   DAVIKQAGWRSQEKLNLFYVESQALGREIKVSLEEYIQSMVGILGSQRTKKSFKFSVDF
FT                   TPLEQALQERCSSDDDEDATATSTATGATASPTDMHEDE"
FT   gene            complement(524490..525341)
FT                   /locus_tag="CpB0477"
FT   CDS_pept        complement(524490..525341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98408"
FT                   /protein_id="AAP98408.1"
FT                   /translation="MIQHLLNFALEETPSISVQYQEQEKLSPCDHSPEIGKKKRWNKLE
FT                   SFSTYCSLFMSVKDHYKLNLGIQNSLSGWLLDPYRVCAPLSSPYSCPSYLLDLQNKELR
FT                   RSLLSTFLDPKNLTSETFRSVSINFGNSSFGQRWSEFLSRVLHDEKEKHVAVVCNDAKL
FT                   LEEGLSPEALSLLEEDLRESGYSYLNILSVSPEGVSKVQERQILRRDLQGRSFTVMITD
FT                   LPLGSEDIRSLQLASDRILVSSSLDAADACASGCKVLVYENPNASWAQELENFYKQVER
FT                   RR"
FT   gene            complement(525342..525992)
FT                   /locus_tag="CpB0478"
FT   CDS_pept        complement(525342..525992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98409"
FT                   /protein_id="AAP98409.1"
FT                   /translation="MGIEWLISWIPRHTVRHGMFTSDVSSAIKVEQTRGHNCLAPLEAY
FT                   LSSLRVPISQEDLGKVHGRTPEDPFVDITPTEIVQLLPDEELSTVDEALQGVRSRLTYA
FT                   YRSVEKPMIQDLALVGFGLRDSADLINFVRLANGVQNHYPHTKVKLYLAKNLADVWDCE
FT                   ISEEEKGQLRALGLDPKIESISLTSAGLPSVPEVATVDFMITCYGKDQEVQDP"
FT   gene            complement(526535..528553)
FT                   /locus_tag="CpB0479"
FT   CDS_pept        complement(526535..528553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98410"
FT                   /protein_id="AAP98410.1"
FT                   /translation="MACYISIWISTVKQHFIRAFDFTRPLGSRITNFALGVIKAIPILG
FT                   CVVIGVSWLVSTCSARRFGKPAFTSDVASIVKIEKTRGYNPLAWVEQYLRQLRVRLPEG
FT                   DLGKIHGKVSRDYVCDRTPQENLNMVPHQYLGELGRAFYGIRNRVTKAYQRVTPLEVPC
FT                   LTLVGFDILDPEDQVNFVRLANGIQTQYPQTQIKLYLISIQKIWNQCDGTISQEKEQQL
FT                   RSLGLDAKIKCVSAPALLLQKYLQSENLPSCDLLINYYGKQQSVRDVDSIKSLLNLSSE
FT                   HIPAISVTYRPDDPFYSYYFFPGSQGGTAPDQRIPWSEQEHLQTYTTLSNPRCDRYAVH
FT                   LGMEDFASGVFLDPLRVSAPLSGEYSCPSYLLDLKSEELRCFLLSAFIDPNNSGQGNPR
FT                   PMSINFGNSPLGQRWSEFLSRVLHDETEKHVAVVCNNPQLIKKSFPSHSLSLLENELEE
FT                   SGYSYLNIVSVSQERTCVKERRILSSDPSGRSFTVILTDLPEGSSDIRNLQLASDRILV
FT                   SSALDAADACASECKILEYEDPEQEWAQQYASFYRNIDRAGDLQRQGIPGEPLGVSAST
FT                   RVVLEKDIVFNLNAVIQQAMWKFKKRDLFAVESQALGDDMRRALEGYIGSSLLVEGTIQ
FT                   PQVACNVNVSFATLDEAVCAACDSAQDAPSEENNTDD"
FT   gene            complement(528689..529960)
FT                   /locus_tag="CpB0480"
FT   CDS_pept        complement(528689..529960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98411"
FT                   /protein_id="AAP98411.1"
FT                   /translation="MEQLLGTPNCRTPRVNISTVGIPIDETSNAFVDSMMKQGVGQDAK
FT                   ELYTFLSRGNEHYQPCLWFSLEEELGFLFDAKMLCAPLSEDHYCHSYLVDLVDQHLKDL
FT                   ILSMFLDPQNISAGELLKVSINVGDSFSPLQQKDFLSMVLRDETGKNVVVVFKGVLSLP
FT                   ATQVCKLVEELNSKDYSYLNIFSCHGDSSPQLLFRKELEGTSGRYFTVICALYLGDTDM
FT                   RSLQLASERIMVSREFDLVDAYAARCKLLKIDHTNWRPGTFSRHADFADAVDVSAGFNS
FT                   REFKLITQANQGILESGELPLPSKTFWEGFLAFCDRVTVTRHFIPMLDAAIKQAVWTHK
FT                   HPSLIDKECEALDLKTQCLPSIVSYLEYVTNSHEKTSKGPFIQKEIIADCSPLKEALFP
FT                   GSDEDVPSTSEDPSDDHPSDLEDS"
FT   gene            complement(529864..530343)
FT                   /locus_tag="CpB0481"
FT   CDS_pept        complement(529864..530343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98412"
FT                   /protein_id="AAP98412.1"
FT                   /translation="MFSEGTALNLFRIFAPLRNRVTTEYSRARQPDLHRIAIVYIGVLD
FT                   SESSKILERLISYMSCIYSESQMYLRFFMGKNVNQSAVLSKLHVENLHIRCGFFSEDAV
FT                   PESEPFDLSIYVHTDRSCPLPTKKWSSSWELQTVELPESIYPQSEFLLMRPRMLS"
FT   gene            complement(530369..530713)
FT                   /locus_tag="CpB0482"
FT   CDS_pept        complement(530369..530713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98413"
FT                   /protein_id="AAP98413.1"
FT                   /translation="MSYYFSLWYLKVQQHFQAAFDFTRSLCSRISNFALGVIALLPIIG
FT                   QLYVGLDWLLSRIKKPEFPSDVDQIVRVEHVVGHDHRSRVEDILKRQRLSLEPRDEGKV
FT                   HGDLPSAPFF"
FT   gene            complement(530766..530936)
FT                   /locus_tag="CpB0483"
FT   CDS_pept        complement(530766..530936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98414"
FT                   /protein_id="AAP98414.1"
FT                   /translation="MGSESLLISLGDALGTLPKHRGSVRDKNKGPSGRLVLIRATYLYS
FT                   YRFLLILIIRK"
FT   gene            531246..534041
FT                   /locus_tag="CpB0484"
FT   CDS_pept        531246..534041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0484"
FT                   /product="outer membrane protein 11"
FT                   /note="similar to outer membrane protein 11 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98415"
FT                   /db_xref="GOA:Q9Z883"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z883"
FT                   /protein_id="AAP98415.1"
FT                   /translation="MLLPFTFVLANEGLQLPLETYITLSPEYQAAPQVGFTHNQNQDLA
FT                   IVGNHNDFILDYKYYRSNGGALTCKNLLISENIGNVFFEKNVCPNSGGAIYAAQNCTIS
FT                   KNQNYAFTTNLVSDNPTATAGSLLGGALFAINCSITNNLGQGTFVDNLALNKGGALYTE
FT                   TNLSIKDNKGPIIIKQNRALNSDSLGGGIYSGNSLNIEGNSGAIQITSNSSGSGGGIFS
FT                   TQTLTISSNKKLIEISENSAFANNYGSNFNPGGGGLTTTFCTILNNREGVLFNNNQSQS
FT                   NGGAIHAKSIIIKENGPVYFLNNTATRGGALLNLSAGAGNGSFILSADNGDIIFNNNTA
FT                   SKHALNPPYRNAIHSTPNMNLQIGARPGYRVLFYDPIEHELPSSFPILFNFETGHTGTV
FT                   LFSGEHVHQNFTDEMNFFSYLRNTSELRQGVLAVEDGAGLACYKFFQRGGTLLLGQGAV
FT                   ITTAGTIPTPSSTPTTVGSTITLNHIAIDLPSILSFQAQAPKIWIYPTKTGSTYTEDSN
FT                   PTITISGTLTLRNSNNEDPYDSLDLSHSLEKVPLLYIVDVAAQKINSSQLDLSTLNSGE
FT                   HYGYQGIWSTYWVETTTITNPTSLLGANTKHKLLYANWSPLGYRPHPERRGEFITNALW
FT                   QSAYTALAGLHSLSSWDEEKGHAASLQGIGLLVHQKDKNGFKGFRSHMTGYSATTEATS
FT                   SQSPNFSLGFAQFFSKAKEHESQNSTSSHHYFSGMCIENTLFKEWIRLSVSLAYMFTSE
FT                   HTHTMYQGLLEGNSQGSFHNHTLAGALSCVFLPQPHGESLQIYPFITALAIRGNLAAFQ
FT                   ESGDHAREFSLHRPLTDVSLPVGIRASWKNHHRVPLVWLTEISYRSTLYRQDPELHSKL
FT                   LISQGTWTTQATPVTYNALGIKVKNTMQVFPKVTLSLDYSADISSSTLSHYLNVASRMR
FT                   F"
FT   gene            534080..536938
FT                   /locus_tag="CpB0485"
FT   CDS_pept        534080..536938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0485"
FT                   /product="outer membrane protein 5"
FT                   /note="similar to outer membrane protein 5 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98416"
FT                   /db_xref="GOA:Q9Z882"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z882"
FT                   /protein_id="AAP98416.1"
FT                   /translation="MSKTPPKFLFYLGNFTACMFGMTPAVYSLQTDSLEKFALERDEEF
FT                   RTSFPLLDSLSTLTGFSPITTFVGNRHNSSQDIVLSNYKSIDNILLLWTSAGGAVSCNN
FT                   FLLSNVEDHAFFSKNLAIGTGGAIACQGACTITKNRGPLIFFSNRGLNNASTGGETRGG
FT                   AIACNGDFTISQNQGTFYFVNNSVNNWGGALSTNGHCRIQSNRAPLLFFNNTAPSGGGA
FT                   LRSENTTISDNTRPIYFKNNCGNNGGAIQTSVTVAIKNNSGSVIFNNNTALSGSINSGN
FT                   GSGGAIYTTNLSIDDNPGTILFNNNYCIRDGGAICTQFLTIKNSGHVYFTNNQGNWGGA
FT                   LMLLQDSTCLLFAEQGNIAFQNNEVFLTTFGRYNAIHCTPNSNLQLGANKGYTTAFFDP
FT                   IEHQHPTTNPLIFNPNANHQGTILFSSAYIPEASDYENNFISSSKNTSELRNGVLSIED
FT                   RAGWQFYKFTQKGGILKLGHAASIATTANSETPSTSVGSQVIINNLAINLPSILAKGKA
FT                   PTLWIRPLQSSAPFTEDNNPTITLSGPLTLLNEENRDPYDSIDLSEPLQNIHLLSLSDV
FT                   TARHINTDNFHPESLNATEHYGYQGIWSPYWVETITTTNNASIETANTLYRALYANWTP
FT                   LGYKVNPEYQGDLATTPLWQSFHTMFSLLRSYNRTGDSDIERPFLEIQGIADGLFVHQN
FT                   SIPGAPGFRIQSTGYSLQASSETSLHQKISLGFAQFFTRTKEIGSSNNVSAHNTVSSLY
FT                   VELPWFQEAFATSTVLAYGYGDHHLHSLHPSHQEQAEGTCYSHTLAAAIGCSFPWQQKS
FT                   YLHLSPFVQAIAIRSHQTAFEEIGDNPRKFVSQKPFYNLTLPLGIQGKWQSKFHVPTEW
FT                   TLELSYQPVLYQQNPQIGVTLLASGGSWDILGHNYVRNALGYKVHNQTALFRSLDLFLD
FT                   YQGSVSSSTSTHHLQAGSTLKF"
FT   gene            537184..537936
FT                   /locus_tag="CpB0486"
FT   CDS_pept        537184..537936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0486"
FT                   /product="outer membrane protein 10"
FT                   /note="similar to outer membrane protein 10 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98417"
FT                   /protein_id="AAP98417.1"
FT                   /translation="MRPICLSILSTALCCSLSGNEVPNLASCQMSRKDISAFHTSPSFR
FT                   LNVTPEPLVSSFRPSNLLNGFGHDITQDITITGNSINSVIDYNYHYEDGGILACKNLFI
FT                   SENKGNLSFERNSSHSSGGALYSVRECWISKNQNYSFISNAASLATTTTSGFGGAIHAL
FT                   DSYITNNLGEGQFLDNVSKNRGGAIYVGVSLSITDNLGPIVIKKNQTLEDSSFGGGIFC
FT                   RAVNIERNYQNIQINDNASGQGVVYFLP"
FT   gene            538041..538964
FT                   /locus_tag="CpB0487"
FT   CDS_pept        538041..538964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0487"
FT                   /product="outer membrane protein 11"
FT                   /note="similar to outer membrane protein 11 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98418"
FT                   /protein_id="AAP98418.1"
FT                   /translation="MCTSLVIENNPKGLIFNNKTAALSGGAIHTRSFIFQNNGPTAFIN
FT                   NSATSGGALINLSGIGSTPQNFFLSADYGDILFNNNTITSSSPQPGYRNALYAAPGINL
FT                   KLGARQGYKILFYDPIDHDQTTTDPIVFNYEPHHLGTVLFSGINVDSNATNPLNFLSKF
FT                   SNSSRLERGVLAIEDRAAISCKTLSQTGGILRLGNAALIRTKGPGSSINFNAIAINLPS
FT                   ILQSEASAPKFWIYPTLTGSTYSEDTSSTITLSGPLTFLNDENENPYDSLDLSEPRKDI
FT                   PPPLPPRCDCKKNRYFESHCRSHELR"
FT   gene            538858..540036
FT                   /locus_tag="CpB0488"
FT   CDS_pept        538858..540036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0488"
FT                   /product="outer membrane protein"
FT                   /note="similar to outer membrane protein, Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98419"
FT                   /protein_id="AAP98419.1"
FT                   /translation="MSLNLERISPLLYLLDVTAKKIDTSNLIVEAMNLDEHYGYQGIWS
FT                   PYWMETTTTTSSTVPEQTNTNHRQLYVDWTPVGYRPNPERHGEFIANTLWQSAYNALLG
FT                   IRILPPQNLKEHDLEASLQGLGLLINQHNREGRKGFRNHTTGYAATTSAKTAARHSFSL
FT                   GFAQMFSKTRERQSPSTTSSHNYFAGLRFDSLLFRDFISTGLSLGYSYGDHHMLCHYTE
FT                   ILKGSSKAFFNNHTLVASLDCTFLPARITRTLELQPFISAIALRCSQASFQETGDHIRK
FT                   FHPKHPLTDLSSPIGFRSEWKTSHHIPMLWTTEISYVPTLYRKNPEMFTTLLISNGTWT
FT                   TQATPVSYNSVAAKIKNTSQLFSRVTLSLDYSAQVSSSTVGQYLKAESHCTF"
FT   gene            540065..542905
FT                   /locus_tag="CpB0489"
FT   CDS_pept        540065..542905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0489"
FT                   /product="outer membrane protein 11"
FT                   /note="similar to outer membrane protein 11 - Chlamydia
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98420"
FT                   /db_xref="GOA:Q9Z880"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z880"
FT                   /protein_id="AAP98420.1"
FT                   /translation="MQNNRSLSKSSFFVGALILGKTTILLNATPLSDYFDNQANQLTTL
FT                   FPLIDTLTNMTPYSHRATLFGVRDDTNQDIVLDHQNSIESWFENFSQDGGALSCKSLAI
FT                   TNTKNQILFLNSFAIKRAGAMYVNGNFDLSENHGSIIFSGNLSFPNASNFADTCTGGAV
FT                   LCSKNVTISKNQGTAYFINNKAKSSGGAIQAAIINIKDNTGPCLFFNNAAGGTAGGALF
FT                   ANACRIENNSQPIYFLNNQSGLGGAIRVHQECILTKNTGSVIFNNNFAMEADISANHSS
FT                   GGAIYCISCSIKDNPGIAAFDNNTAARDGGAICTQSLTIQDSGPVYFTNNQGTWGGAIM
FT                   LRQDGACTLFADQGDIIFYNNRHFKDTFSNHVSVNCTRNVSLTVGASQGHSATFYDPIL
FT                   QRYTIQNSIQKFNPNPEHLGTILFSSAYIPDTSTSRDDFISHFRNHIGLYNGTLALEDR
FT                   AEWKVYKFDQFGGTLRLGSRAVFSTTDEEQSSSSVGSVININNLAINLPSILGNRVAPK
FT                   LWIRPTGSSAPYSEDNNPIINLSGPLSLLDDENLDPYDTADLAQPIAEVPLLYLLDVTA
FT                   KHINTDNFYPEGLNTTQHYGYQGVWSPYWIETITTSDTSSEDTVNTLHRQLYGDWTPTG
FT                   YKVNPENKGDIALSAFWQSFHNLFATLRYQTQQGQIAPTASGEATRLFVHQNSNNDAKG
FT                   FHMEATGYSLGTTSNTASNHSFGVNFSQLFSNLYESHSDNSVASHTTTVALQINNPWLQ
FT                   ERFSTSASLAYSYSNHHIKASGYSGKIQTEGKCYSTTLGAALSCSLSLQWRSRPLHFTP
FT                   FIQAIAVRSNQTAFQESGDKARKFSVHKPLYNLTVPLGIQSAWESKFRLPTYWNIELAY
FT                   QPVLYQQNPEVNVSLESSGSSWLLSGTTLARNAIAFKGRNQIFIFPKLSVFLDYQGSVS
FT                   SSTTTHYLHAGTTFKF"
FT   gene            complement(543079..545406)
FT                   /locus_tag="CpB0490"
FT   CDS_pept        complement(543079..545406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98421"
FT                   /protein_id="AAP98421.1"
FT                   /translation="MASGIGGSSGLGKIPPKDNGDRSRSPSPKGELGSHEISLPPQEHG
FT                   EEGASGSSHIHSSSSFLPEDQESQSSSSAASSPGFFSRVRSGVDRALKSFGNFFSAEST
FT                   SQARETRQAFVRLSKTITADERRDVDSSSAAATEARVAEDASVSGENPSQGVPETSSGP
FT                   EPQRLFSLPSVKKQSGLGRLVQTVRDRIVLPSGAPPTDSEPLSLYELNLRLSSLRQELS
FT                   DIQSNDQLTPEEKAEATVTIQQLIQITEFQCGYMEATQSSVSLAEARFKGVETSDEINS
FT                   LCSELTDPELQELMSDGDSLQNLLDETADDLEAALSHARLSFSLDDNPTPIDNNPTLIS
FT                   QEEPIYEEIGGAADPQRTRENWSTRLWNQIREALVSLLGMILSILGSILHRLRIARHAA
FT                   AEAVGRCCTCRGEECTSSEEDSMSVGSPSEIDETERTGSPHDVPRRNGSPREDSPLMNA
FT                   LVGWAHKHGAKTKESSESSTPEISISAPIVRGWSQDSSVSFIVMEDDHIFYDVPRRKDG
FT                   IYDVPSSPRWSPARELEEDVFGDYEVPITSAEPSKDKNIYMTPRLATPAIYDLPSRPGS
FT                   SGSSRSPSSDRVRSSSPNRRGVPLPPVPSPAMSEEGSIYEDMSGASGAGESDYEDMSRS
FT                   PSPRGDLDEPIYANTPEDNPFTQRNIDRILQERSGGASASPVEPIYDEIPWIHGRPPAT
FT                   LPRPENTLTNVSLRVSPGFGPEVRAALLSESVSAVMVEAESIVPPTEPGDGESEYLEPL
FT                   GGLVATTKILLQKGWPRGESNA"
FT   gene            complement(545568..546914)
FT                   /locus_tag="CpB0491"
FT   CDS_pept        complement(545568..546914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98422"
FT                   /protein_id="AAP98422.1"
FT                   /translation="MAVGGVGGSRSPSPIPPNRRNSEDGKVSPKDNLGEHTVSSSDSSL
FT                   ASQGPTIEERKAQLGGTDKIPLPSVKEPGDSQTSGRSGVLQRIWKGVKGVFKKTPQARP
FT                   EVSSPRLPSHVQHGQRLPGLEGFRDRIQKRSENPEADLGKMKRSYSDGDLDRVGHDSNE
FT                   DSTEDSRSEGGEPSSKSSSFLSGVRGATSTVQGALGDAKEKVSAFGEQAAGAIRSAPGN
FT                   IRTRFQRSSSEGDLSNVNKAAKHLRKALENLEKVAPEQVSPEVASRVQSLLARMEQLTH
FT                   QEPPTVEDLITFVESNVGSDSVEYASIVPQDGSQAPAETAEAPETGGVEGSAAQGAWKA
FT                   LRDFVVSIFQAVASFFRAIASRLSSARRESAVDDLASESNTQWFVEQEGVSNPSAAPSL
FT                   SFAEEIARRAAEMSNRNAQSLEKLESGNVTDPVIQQGLGLARSFAPEGQ"
FT   gene            complement(546954..547115)
FT                   /locus_tag="CpB0492"
FT   CDS_pept        complement(546954..547115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98423"
FT                   /protein_id="AAP98423.1"
FT                   /translation="MNVRSSSFGSLSAFSNFIFSFTSSSLLNYIISILFVYFNLYFVFK
FT                   IFFILTFV"
FT   gene            complement(547125..548858)
FT                   /locus_tag="CpB0493"
FT   CDS_pept        complement(547125..548858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0493"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT365 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98424"
FT                   /protein_id="AAP98424.1"
FT                   /translation="MSLSNATEKTSLLANSRSLSPVPNSLVPSNPEDTGLRKSIFTHSV
FT                   TLFAGLVVLLVAVSVVVVALTVLAPGVPQAILLGIAISGVGIGGFSIMKSLVYMVRDYM
FT                   SPRMQESSRIKSALAVGTGFTVMGLVMKVGANFVPGGYGGLVGSLGSSAYSRGSQTTLA
FT                   SFSHYIYTKFFRSEKVAKGEKLTEAETIKEAKKLHYITLSIATIGVGLAVLGILLAIAG
FT                   TVLLGGAPATIAIILAPPLISIGLTTVLQTILHSSIGKWRAFLLTQEKKDLFVDTSLKD
FT                   IRLEKLPPSEVEESETSQSVIEVPDSEGIAETRISAEEIDTRLSLTTRQKVIFALATLL
FT                   LLASIAAFIVTGFGGLTVMQVLLVASVGSAVASVTLPMVSSGFSYVAYQLKARLNISKL
FT                   RWKEAKNKKRVRQFLIESGVIASDREFNQMWKTVYKKQIQKTDAAIREEVRNFEKGGEV
FT                   NSALVGGILLGVGTGIMLLALVPAFAPIVPGILALGGSTLGIAGSILMRKFVNWLYDEL
FT                   VKLYERRRNRRELLYGPESKMRSIATDLVVEALAASHDHLFDLDGPVDFIDVDVDIDGA
FT                   A"
FT   gene            complement(549003..551165)
FT                   /locus_tag="CpB0494"
FT   CDS_pept        complement(549003..551165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0494"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="similar to 1,4-alpha-glucan branching enzyme -
FT                   Synechococcus sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98425"
FT                   /db_xref="GOA:Q9Z876"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z876"
FT                   /protein_id="AAP98425.1"
FT                   /translation="MVDKLIHPWDLDLLVSGRQKDPHKLLGILASEDSSDHIVIFRPGA
FT                   HTVAIELLGELHHAVAYRSGLFFLSVPKGIGHGDYRVYHQNGLLAHDPYAFPPLWGEID
FT                   SFLFHRGTHYRIYERMGAIPMEVQGISGVLFVLWAPHAQRVSVVGDFNFWHGLVNPLRK
FT                   ISDQGIWELFVPGLGEGIRYKWEIVTQSGNVIVKTDPYGKSFDPPPQGTARVADSESYS
FT                   WSDHRWMERRSKQSEGPVTIYEVHLGSWQWQEGRPLSYSEMAHRLASYCKEMHYTHVEL
FT                   LPITEHPLNESWGYQVTGYYAPTSRYGTLQEFQYFVDYLHKENIGIILDWVPGHFPVDA
FT                   FALASFDGEPLYEYTGHSQALHPHWNTFTFDYSRHEVTNFLLGSALFWLDKMHIDGLRV
FT                   DAVASMLYRDYGREDGEWTPNIYGGKENLESIEFLKHLNSVIHKEFSGVLTFAEESTAF
FT                   PGVTKDVDQGGLGFDYKWNLGWMHDTFHYFMKDPMYRKYHQKDLTFSLWYAFQESFILP
FT                   LSHDEVVHGKGSLVNKLPGDTWTRFAQMRVLLSYQICLPGKKLLFMGGEFGQYGEWSPD
FT                   RPLDWELLNHHYHKTLRNCVSALNALYIHQPYLWMQESSQECFHWVDFHDIENNVIAYY
FT                   RFAGSNRSSALLCVHHFSASTFPSYVLRCEGVKHCELLLNTDDESFGGSGKGNRAPVVC
FT                   QDQGVAWGLDIELPPLATVIYLVTFF"
FT   gene            complement(551176..552165)
FT                   /locus_tag="CpB0495"
FT   CDS_pept        complement(551176..552165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0495"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT865 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98426"
FT                   /protein_id="AAP98426.1"
FT                   /translation="MIDIMQHFKPYTMVPGQKLPIPGSLLYAQVFPTLWRLFSSKHEIL
FT                   NEQTLQVQGPLKRFAVFQDLHRGGLAVTSERYKYYLLPSGECTQSIKGKLPSAAQAGPL
FT                   LSLGVHKHADWQKVRCRRDLKEILPLWFRFAAMAPKGSYRDLETTAIGSLVKTAHQRVL
FT                   HRETTEIAPALLSIALAGFSECFLPRSYDEEFQGILPQDGDPEGGVPFELLSYSFGMIQ
FT                   DIFLRHQGQLVEILPALPPEFPCGRLIHVALPNLGTLSIVWTKKTIRQVELHAEYSGEV
FT                   FLKFCSSLCSARLREWSERRLSGSKRLSLGETLEIKAGTTYLWDCFHK"
FT   gene            complement(552162..553427)
FT                   /locus_tag="CpB0496"
FT   CDS_pept        complement(552162..553427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0496"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yqeV - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98427"
FT                   /db_xref="GOA:Q9Z874"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z874"
FT                   /protein_id="AAP98427.1"
FT                   /translation="MTVAEVKGTFKLVCLGCRVNQYEVQAYRDQLTILGYQEVLDSEIP
FT                   ADLCIINTCAVTASAESSGRHAVRQLCRQNPTAHIVVTGCLGESDKEFFASLDRQCTLV
FT                   SNKEKSRLIEKIFSYDTTFPEFKIHSFEGKSRAFIKVQDGCNSFCSYCIIPYLRGRSVS
FT                   RPAEKILAEIAGVVDQGYREVVIAGINVGDYCDGERSLASLIEQVDQIPGIERIRISSI
FT                   DPDDITEDLHRAITSSRHTCPSSHLVLQSGSNSILKRMNRKYSRGDFLDCVEKFRASDP
FT                   RYAFTTDVIVGFPGESDQDFEDTLRIIEDVGFIKVHSFPFSARRRTKAYTFDNQIPNQV
FT                   IYERKKYLAEVAKRVGQKEMMKRLGETTEVLVEKVTGQVATGHSPYFEKVSFPVVGTVA
FT                   INTLVSVRLDRVEEEGLIGEIV"
FT   gene            complement(553528..554946)
FT                   /locus_tag="CpB0497"
FT   CDS_pept        complement(553528..554946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0497"
FT                   /product="GTP binding protein hflX"
FT                   /note="similar to GTP binding protein hflX family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98428"
FT                   /protein_id="AAP98428.1"
FT                   /translation="MDTIDTPGEQGSQSFGNSLGARFDLPRKEQDPSQALAVASYQNKT
FT                   DSQVVEEHLDELISLADSCGISVLETRSWILKTPSASTYINVGKLEEIEEILKEFPSIG
FT                   TLIIDEEITPSQQRNLEKRLGLVVLDRTELILEIFSSRALTAEANIQVQLAQARYLLPR
FT                   LKRLWGHLSRQKSGGGSGGFVKGEGEKQIELDRRMVRERIHKLSAQLKAVIKQRAERRK
FT                   VKSRRGIPTFALIGYTNSGKSTLLNLLTAADTYVEDKLFATLDPKTRKCVLPGGRHVLL
FT                   TDTVGFIRKLPHTLVAAFKSTLEAAFHEDVLLHVVDASHPLALEHVQTTYDLFQELKIE
FT                   KPRIITVLNKVDRLPQGSIPMKLRLLSPLPVLISAKTGEGIQNLLSLMTEIIQEKSLHV
FT                   TLNFPYTEYGKFTELCDAGVVASSRYQEDFLVVDAYLPKELQKKFRPFISYVFPEDCGD
FT                   DEGRGPVLESSFGD"
FT   gene            complement(554934..555746)
FT                   /locus_tag="CpB0498"
FT   CDS_pept        complement(554934..555746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0498"
FT                   /product="putative metal dependent hydrolase"
FT                   /note="similar to probable metal dependent hydrolase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98429"
FT                   /protein_id="AAP98429.1"
FT                   /translation="MVRDIQSESIGKLVFLGTGNPEGIPVPFCSCRVCQNTGIHRLRSS
FT                   VLIQYQNKTLVIDAGPDFRTQMLVAGVSELDGVFLTHPHYDHIGGIDDLRAWYIVTQRS
FT                   LPLVLSASTYRFLNKAKEYLFATPNVESSLPAVLEFTILNEDCGQEEFQGIPYTYVSYY
FT                   QKSCHVTGFRFGNLAYLTDLCSYDAKIFSYLDNVETLILSAGPSETPIPFQGHKSSHLT
FT                   VEEAKAFANHAGIKNLIITHISHCLEAERDQHPEVTFAYDGMEVLWTL"
FT   gene            complement(555968..556624)
FT                   /locus_tag="CpB0499"
FT   CDS_pept        complement(555968..556624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0499"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT383 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98430"
FT                   /protein_id="AAP98430.1"
FT                   /translation="MLGSLPCYPGAGNIEEYKNRYFYCQLCAEVVSPYVVPVIVVDVQG
FT                   APPTGILQVLRCKQHKFQGLPVHGPITSLWALEPVGKGAPQLESAMYELCSQVRNFDIC
FT                   SIVSWVFGGLCIFAGLIVGVMVEAPLIAGLSAWVIPCIIGGVGAILCLFAILMAYLGRG
FT                   RVREWLNLSHEYITQCHCRQIQAHSQNYSVITEYPATCALSQPITKLPNGSRRDN"
FT   misc_feature    complement(556657..558267)
FT                   /note="similar to Chlamydophila pneumoniae CWL029
FT                   hypothetical protein; contains frameshift"
FT   gene            complement(558279..559013)
FT                   /locus_tag="CpB0502"
FT   CDS_pept        complement(558279..559013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0502"
FT                   /product="arginine-binding periplasmic protein 2 precursor"
FT                   /note="similar to arginine-binding periplasmic protein 2
FT                   precursor - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98431"
FT                   /db_xref="GOA:Q9Z869"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR037297"
FT                   /db_xref="PDB:3N26"
FT                   /db_xref="PDB:3QAX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z869"
FT                   /protein_id="AAP98431.1"
FT                   /translation="MPLSLTSCESKIDRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDL
FT                   AKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQ
FT                   ELMVVSKRSLETPVLPLTQYSSVAVQTGTFQEHYLLSQPGICVRSFDSTLEVIMEVRYG
FT                   KSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITD
FT                   LKSEGVIQSLTKKWQLSEVAYE"
FT   gene            559187..562288
FT                   /locus_tag="CpB0503"
FT   CDS_pept        559187..562288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98432"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z868"
FT                   /protein_id="AAP98432.1"
FT                   /translation="MFPIPPPHCPPNNKNNFYHLTTDTKDPLLLRILRTIGYVLLHIIT
FT                   LGLLLLIHYYKHHRVVRKEGLPTPPTLPKGPEPKTIEIAKQPPKDGEDKKPDVPKPGTP
FT                   PPEDTPPPPPKAPSPASPKVPKQPADKKPTPPPEAPPPPVRVATPMPLRPSSQGYWQCL
FT                   NRMVSMVLRRAPLPLPAMQVDPILGDFNPHFVASYPNRIDNEPMYFQIKQFKKIAQNPD
FT                   LPQQHRRLAQLSLEQALYLNDNYYLVNVPGDGNCFYRAYAVGWLSALYEESSRNDIVFE
FT                   QEATRLLDLPFASSSPANANLCAEMAELLQLCSTYCSFIDLYDGVILSQKHTATLIAFL
FT                   RKLSAYAIRQQIAASSNEETARALFISDMQDDLLPSVLEFLAANRPYSELFQNLINHSA
FT                   LPYMQSRDKLFLLLEHLPALFLTDAELQKMSPEDQQLRKQYEREIREAFAKLSRRIADS
FT                   GWDTERFNAIVKDHLPEAIRCQYSRFLATIENRRSGDLPWSPALSFFAFLCTCPSVRFH
FT                   KLCATFYKSLEDIIIASAPPQRSIQEILQISNASLSYLNEDLDSSWQREVISSNIMTIL
FT                   TTHESLTLESSMPQLETLHKRIANLLKNVISTSFETPPLSNQPDLLSNLVNKLLVAIHS
FT                   KLELKEHFNTVCSARSLRLTRDEGSGLSQEQDLLYTQAVQLLFFILQHPQVNNRPETKD
FT                   AVKELKMLLLPFLQYAFKKVENEKKLQKLLRSILGSLVLKPPARYPSTPSNKDKETFCK
FT                   FWSRHPEVMVLDPILEKNCMQFLRATFPNYQLETEAILLEKEIESTFRNGWNVFLTRLN
FT                   LFGSKLGSPSSPTALSDQFSKSFLIFCFLNNYPKLLQKKTPLAARLDAFQREASHRFTQ
FT                   VKDKLLLSLKYGFPLATATINQYSRARDQLICNLLKNTVTASDGFCRSGFRQSLIGYLH
FT                   SLSSNELGDILDDVKEQAEANDVAAMTTVPLQPFAVCLIMSDRDTVSEENIENFVAMHG
FT                   FLNTISPERDARIFLIRFPNHYGCLLPRNPRTEDQNSKPDSSNP"
FT   gene            562291..563148
FT                   /locus_tag="CpB0504"
FT   CDS_pept        562291..563148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0504"
FT                   /product="2-dehydro-3-deoxyphosphoheptonate aldolase"
FT                   /note="similar to 2-dehydro-3-deoxyphosphoheptonate
FT                   aldolase - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98433"
FT                   /protein_id="AAP98433.1"
FT                   /translation="MHEVLILTFTYPLPRTLKQHPDEVHTVPISPNLSFGEGSPILIAG
FT                   PCTLESYEHTVSSALTVKEAGAQVFRGSIRKPRTSPFSFQGWEKECVLWHKEAQSIHGL
FT                   PTETEVLDVRDVEITAEHVDILRIGAKNMHNTPLLQEVSKSHRPIILKRSPAATLEEWL
FT                   CAAEYILASSPSCPGVILCERGIRTFEHSTRYTLDLNTVALLKEISSLPVIVDPSHAAG
FT                   KRSLVLPLASAGLSVGADGLMIEVHAHPEKALCDAKQQITPEELHLFAKKHFCPSESRA
FT                   HAIS"
FT   gene            563359..563553
FT                   /locus_tag="CpB0505"
FT   CDS_pept        563359..563553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98434"
FT                   /protein_id="AAP98434.1"
FT                   /translation="MIKQACKFYLLQCLLCALYWLLKYCRKLLKGTLHHSEETLYQALL
FT                   SSLIDLLYQLKQLPAPTNE"
FT   gene            complement(563723..565057)
FT                   /locus_tag="CpB0506"
FT   CDS_pept        complement(563723..565057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0506"
FT                   /product="prolin permease protein"
FT                   /note="similar to prolin permease protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98435"
FT                   /protein_id="AAP98435.1"
FT                   /translation="MNFSLFLFFLIAIQGICLYVGRRGSKKVEDRESYFLAGRSLKIFP
FT                   LMMTFIATQIGGGVLLGAAEEAFCYGYGGILYPLGVALGLIFLGMGPGKRLAEGSLTTV
FT                   VSIFEVFYGSKKLRKIAFLLSAGSLFFILVAQVIALDRLFSSFPFGKYVTVAFWIVLAS
FT                   YTSTGGFRGVVRTDVIQAGFLLIAVLVCGVSVWLSVPKSLSVLDPFQSLPCAKLSNWIF
FT                   MPMLFMLVEQDMVQRCVAASSPKRLQWAAVGAGLVLLLFNFIPLFLGSLGAKAGLKAGC
FT                   PLIDTIAYFCNPSLAAVMAAAIGVAILSTADSLMNAVSQLIAEEYPTLKAPYYRYLVLG
FT                   LAVAAPLVAIGFTNIVDVLILSYSLSVCCLSVPVGFYLLAPKGRRVSGAAAWAGVLVGA
FT                   LGYGWVQIVSLGMFGELLAWIGSLVAFSFVGFIEITWKNKVKTQT"
FT   gene            complement(565430..566983)
FT                   /locus_tag="CpB0507"
FT   CDS_pept        complement(565430..566983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0507"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT384 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98436"
FT                   /protein_id="AAP98436.1"
FT                   /translation="MESKEYSLLQAKLVLRALAQNSSFDDWFRSFKKCQISYPELAHDR
FT                   DVLEEFGIQVLREGIENPSVTVRAVSVLAIGLARDFRLVPLLLQSCNDDSAIVRSLALQ
FT                   VAVNYGSESLKKAIVELARNDDSIHVRITAYQVVALLQIEELLPFLRERAENKLVDSVE
FT                   RREAWKACLELSSQFLETGVAKDDIDQALFTCEVLRNGMLPETTEIFTELLSVEHPEVQ
FT                   ESLLLSALAWSHQLQNHKEFLSKVRHVMCTSPFAKVRFQAAALLHLHGDPLGRDSLVEG
FT                   LRSPQPLVCEAASAALCSLGIHGVPLAKEHLESLSSRKAAANLSILLLVSREDIERAGD
FT                   VIARYLSNPEMCWAIEYFLWDAQWNLRGDTFPLYSDMIKREIGRKLIRLLAVARYSQAK
FT                   AVTATFLSGQQAQGWSFFSGMFWEEGDVKTSEDLVTDACFAAKLEGALASLCQKKDQAS
FT                   LQRVSQLYNDSRWQDKLAILESVAFSENLDAVPFLLDCCHHEAPSLRSAAAGALFSIFK
FT                   "
FT   gene            complement(567085..567417)
FT                   /locus_tag="CpB0508"
FT   CDS_pept        complement(567085..567417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0508"
FT                   /product="histidine triad homology"
FT                   /note="similar to histidine triad homology family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98437"
FT                   /db_xref="GOA:Q9Z863"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z863"
FT                   /protein_id="AAP98437.1"
FT                   /translation="MTVFKQIIDGLIDCEKVFENENFIAIKDRFPQAPVHLLIIPKKPI
FT                   PRFQDIPGDEMILMAEAGKIVQELAAEFGIADGYRVVINNGAEGGQAVFHLHIHLLGGR
FT                   PLGAIA"
FT   gene            complement(567414..568286)
FT                   /locus_tag="CpB0509"
FT   CDS_pept        complement(567414..568286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0509"
FT                   /product="putative metal dependent hydrolase"
FT                   /note="similar to probable metal dependent hydrolase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98438"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z862"
FT                   /protein_id="AAP98438.1"
FT                   /translation="MQIPRSIGTHDGSFHADEVTACALLIIFDLVDENKIIRSRDPVVL
FT                   SKCEYVCDVGGVYSIENKRFDHHQVSYDGSWSSAGMILHYLKEFGYMDCEEYHFLNNTL
FT                   VHGVDEQDNGRFFSKEGFCSFSDIIKIYNPREEEETNSDADFSCALHFTIDFLCRLRKK
FT                   FQYDRVCRGIVREAMETEDMCLYFDRPLAWQENFFFLGGEKHPAAFVCFPSCDQWILRG
FT                   IPPNLDRRMEVRVPFPENWAGLLGKELSKVSGIPGAVFCHKGLFLSVWTNRESCQRALR
FT                   LTLQDRGII"
FT   gene            568600..570657
FT                   /locus_tag="CpB0510"
FT   CDS_pept        568600..570657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0510"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT387 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98439"
FT                   /protein_id="AAP98439.1"
FT                   /translation="MYNLLHAHHDAASPDGRLVSHLKKLSPHIYEGEVLIENIPAYFLG
FT                   FHLPQQCIQVNLKSSLAQLGVEAVLNHLELNKARKEARLHVLFMSQDPIATAMLELLEP
FT                   GSFVCKLFAADDRRLVRSPCYLNRMFTHTDRTGSPLLRFGKKLEHFITLEIINDRLVVF
FT                   LPILPGTICYEETIYGFLPLMSKSLTRPHLKIRKFLPLYQMVTDRPPVPEDHKILLIKT
FT                   EPLHIRTVFARVVQDLLPQGLRHTAADILEPTTQESGDIYEFYGSTSEPIERIPLEFFT
FT                   LEPYKEHSFFFYRDMLQETLESPQEVFRVFESIPEGEDQAAMFISKGSELLELSQDSWI
FT                   IKPRISPSDERHAREIQKHIEDQPCFPFLKAMETDHITSQGVLFSRYFPSASLKGMFLS
FT                   NYSRYYLQHIYFQIPSPTSGEFFSNRDRSFLLDLYFAGISVFWADLESKRLLQYIKRRN
FT                   KDVGMFVPKHQAEQFAQSYFIGIHGSCLIAGDYDEFLRELLTGMHTLSQQFTIPEFPPQ
FT                   TPLAILTGGGSGAMELANRVATELSILSCGNLISLDTTNAYVEAKMSYAIPDLLERQAD
FT                   FHVDLAVFVIGGMGTDFELLLELISLKTGKKALVPVFLIGPVDYWKSKITALYNSNHAV
FT                   GTIRGSEWVHNCLFCLSSAKAGIAIFRRYLNHTLPIGPEHPVPEDGFVIV"
FT   gene            complement(570654..571793)
FT                   /locus_tag="CpB0511"
FT   CDS_pept        complement(570654..571793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0511"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT389 - Chlamydia
FT                   trachomati"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98440"
FT                   /protein_id="AAP98440.1"
FT                   /translation="MCPDCKYETKSVLRSDQLPDHLWNYENDCYLTGYVQSLLDMHFLD
FT                   SRTQVVIEKNRAYLFSLPVDSSLSEAITNFVRDLPFICAVEICERPYGECITRSSAERP
FT                   LLPKEKTLGMPIFCGKEGVWLPQNTILFSPLIADPRQVTNSAGIRFNEKVVGNRVGATI
FT                   FGGDFILLRLFDVSRFHVDCDFGIQGGVFSVFDLDHPESCMVNSDFFVAGLWSGAIDKW
FT                   SFRFRLWHLSSHLGDEFILTHPNFPRFNLSDEGVDLFISFRYTPQIRLYGGCGYIVSRD
FT                   LTFPERPFYCEWGAELRPFGLREGNLHAQPIFAMHFRCWEEQKFGLDQSYILGMEWAKF
FT                   QEIGRKIRAVLEYHQGFSKEGQFIREPCNYYGFRLTYGF"
FT   gene            571973..572128
FT                   /locus_tag="CpB0512"
FT   CDS_pept        571973..572128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98441"
FT                   /protein_id="AAP98441.1"
FT                   /translation="MIFPICEERNSQQTYKHLHVESACFLLESPLKIHWSSPYGFPPFY
FT                   RRDLKL"
FT   gene            complement(572173..572325)
FT                   /locus_tag="CpB0513"
FT   CDS_pept        complement(572173..572325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98442"
FT                   /protein_id="AAP98442.1"
FT                   /translation="MRTYTRSPKQSGVERKQEDAETSFIETPKGILKKPGNKDPKGKHV
FT                   HWKDS"
FT   gene            complement(572464..572685)
FT                   /locus_tag="CpB0514"
FT   CDS_pept        complement(572464..572685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98443"
FT                   /protein_id="AAP98443.1"
FT                   /translation="MIRVNPYGSYRGRNPSPEDGKKDVPLSGNSRLHRRGGIRRKHKSA
FT                   SVGVTSGSKTGKASLEKKVKGISEAHFK"
FT   gene            572852..574117
FT                   /locus_tag="CpB0515"
FT   CDS_pept        572852..574117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0515"
FT                   /product="aspartate transaminase"
FT                   /note="similar to aspartate transaminase - Sulfolobus
FT                   solfataricus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98444"
FT                   /db_xref="GOA:Q9Z856"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z856"
FT                   /protein_id="AAP98444.1"
FT                   /translation="MAIQKAGAFLRCLPSESRPYLEHAMRRNPHFSLLKPQYLFSEISK
FT                   KLAQFRKENPEISVIDLSIGDTTQPLCRSITQAIKEFCVSQEKQETYRGYGPETGLEKL
FT                   RTKIASEVYENRISPEEIFISDGAKPDIFRLFSFFGSEKTLGLQDPVYPAYRDIAHITG
FT                   IRDIIPLACRKETGFIPELPNQQSLDILCLCYPNNPTGTVLTFQQLQALVNYANQHGTV
FT                   LIFDAAYSAFVSDPSLPKSIFEIPEAKYCAIEINSFSKSLGFTGMRLAWNVIPKELTYD
FT                   NNEPMINDWKRLFATTFNGASLLMQEAGYYGLDLFPTPPAISLYLTNAQKLKKSLETAG
FT                   FSVHGGDHAPYLWVELPEGISDEEAFDFFLHQYHIAVTPGHGFGSCGQGFVRFSALTQP
FT                   QNIALACDRLCTASLKETMVLA"
FT   gene            574114..575136
FT                   /locus_tag="CpB0516"
FT   CDS_pept        574114..575136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0516"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT391 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98445"
FT                   /protein_id="AAP98445.1"
FT                   /translation="MTILRKLSQYLFFFSLFCSFIYVATCGSQPDSVSSPKIAIFLSFP
FT                   HPLLEDCSKSCIETLKDFENLPEIVVLNAEDSIVKARKIARSLHTDKNVVAIVTLGTIA
FT                   TKVMSHIETQKPVIYAAVPDRESLTLPKNTMNIYGVNDTLDINQYCFAIQAVATNAQSI
FT                   VYLKPSEPFPSDLQKEIVKKLHASGIEVIEISITSSTFKTRIRQAIDKRPSAIFIPLSP
FT                   LSHKEGTAFLQEILKEKIPIITDDTSLISEGACIACSVDYKKSGKQIAKIVHHLLYNNH
FT                   DVDSLRKIIAQRLSPTTTFNEDIIKYLGIKLHKTERNQFLSFKSKKLEKSEKGKNVAVS
FT                   "
FT   gene            complement(575138..575410)
FT                   /locus_tag="CpB0517"
FT   CDS_pept        complement(575138..575410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0517"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT388 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98446"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z854"
FT                   /protein_id="AAP98446.1"
FT                   /translation="MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAV
FT                   ISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRVQDIIFSLHIDV"
FT   gene            complement(575403..576356)
FT                   /locus_tag="CpB0518"
FT   CDS_pept        complement(575403..576356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98447"
FT                   /protein_id="AAP98447.1"
FT                   /translation="MNRRKARWVVALFAMTALISVGCCPWSQAKSRCSIDKYIPVVNRL
FT                   LEVCGLPEAENVEDLIESSSAWVLTPEERFSGELVSICQVKDEHAFYNDLSLLHMTQAV
FT                   PSYSATYDCAVVFGGPLPALRQRLDFLVREWQRGVRFKKIVFLCGERGRYQSIEEQEHF
FT                   FDSRYNPFPTEENWESGNRVTPSSEEEIAKFVWMQMLLPRAWRDSTSGVRVTFLLAKPE
FT                   ENRVVANRKDTLLLFRSYQEAFPGRVLFVSSQPFIGLDACRVGQFFKGESYDLAGPGFA
FT                   QGVLKYHWAPRICLHTLAEWLKETNGCLNISEGCFG"
FT   gene            complement(576524..577681)
FT                   /locus_tag="CpB0519"
FT   CDS_pept        complement(576524..577681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0519"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein yprS - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z852"
FT                   /protein_id="AAP98448.1"
FT                   /translation="MSSVNQSSGTPNPEEVTSPESTEENKNVVSSDEAQATHAVALPIV
FT                   TQLSLPEGVGTSSEETASNPKVDEIVAEVSSSRAVADQISSLVERVGELLDDLKGAQSL
FT                   FTSFQSELKNCLPAWKSSTRRLETRGAGDNADIARLELFRSDYEAVLGHANQFHGKAHL
FT                   ILSKLTDVHHKLQGLSREDLSLAFDNNDRVLEHLGSLGLDVDAEGNWSLSCERGIPRLV
FT                   LTADSMLVQIKKVNLPTVEELRTLQGTTESSSDPRVEESLSCCERLLNELRRLWANFVG
FT                   FISSCYDNIVFVLMWIVRRINLLPGLGCLPFHNPDASQEDQRSSSGERSTRRERLSRRS
FT                   DLSEEEMIVRAEGESIHPESPHGDGRNQPSRGDKQDSDSEEETEL"
FT   gene            577981..579687
FT                   /locus_tag="CpB0520"
FT   CDS_pept        577981..579687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0520"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="similar to prolyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98449"
FT                   /db_xref="GOA:Q9Z851"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z851"
FT                   /protein_id="AAP98449.1"
FT                   /translation="MKTSQLFYKTSKNANKSAAVLSNELLEKAGYLFKVSKGVYTYTPL
FT                   LWRVVSKMMNIIREELNAIGGQELLLPLLHNAELWQHTGRWEAFTSEGLLYTLKDREGK
FT                   SHCLAPTHEEVICSFVAQWLSSKRQLPLHLYQIATKFRDEIRPRFGLIRSRELLMEDSY
FT                   TFSDSPEQMNEQYEKLRSAYSKIFDRLGLAYVIVTADGGKIGKGKSEEFQVLCSLGEDT
FT                   ICVSGSYGANIEAAVSIPPQHAYDREFLPVEEVATPGITTIEALANFFSIPLHKILKTL
FT                   VVKLSYSNEEKFIAIGMRGDRQVNLVKVASKLNADDIALASDEEIERVLGTEKGFIGPL
FT                   NCPIDFFADETTSPMTNFVCAGNAKDKHYVNVNWDRDLLPPQYGDFLLAEEGDTCPENP
FT                   GHPYRIYQGIEVAHIFNLGTRYTDSFEVNFQDEHGQTQQCWMGTYGIGVGRTLAACVEQ
FT                   LADDRGIVWPKALAPFSITIAFNGGDTVSQELAETIYHELQSQGYEPLLDDRDERLGFK
FT                   LKDSDLIGIPYKLILGKSYQSSGIFEIESRSGEKYTVSPEAFPTWCQNHLA"
FT   gene            579752..580975
FT                   /gene="hrcA"
FT                   /locus_tag="CpB0521"
FT   CDS_pept        579752..580975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="CpB0521"
FT                   /product="heat-inducible transcription repressor"
FT                   /note="similar to heat-inducible transcription repressor
FT                   hrcA - Bacillus stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98450"
FT                   /db_xref="GOA:Q9Z850"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z850"
FT                   /protein_id="AAP98450.1"
FT                   /translation="MTFSGSFPIMLSVTIVLVGLEMARSKVSKRDSKILDILFATTELY
FT                   LKTGQPVGSKTLKESFCSDLSTATIRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVD
FT                   HQEECPEAEISAPIFDKISQLPSESRNIIKDLQKATELLGEILDLPTFFSSPRFENDSV
FT                   TNIQITQVDKQRAVTILSTEFGQIFTDTLWLPEACDTLSIKRIEKFLQNYIRKLPTNEE
FT                   LSKKEEHLSMSLYNEVVVRYLTRYCNFSEEDLYQTGMSKLLKYEAFKDPEVLALGLSLF
FT                   ENRRQMCELLNIGMHKGRATAFIGKELSDILGTSNPGCSVITIPYYMNRSPLGALGILG
FT                   PINLPYKEALPLLKLFANKINETLTQSFYKFKLSFRRPLTSNCKLSNEPILRTEYSSIK
FT                   LLPSKETL"
FT   gene            580972..581526
FT                   /gene="grpE"
FT                   /locus_tag="CpB0522"
FT   CDS_pept        580972..581526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="CpB0522"
FT                   /product="GrpE"
FT                   /note="heat shock protein; similar to heat shock protein
FT                   grpE - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98451"
FT                   /db_xref="GOA:Q9Z849"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z849"
FT                   /protein_id="AAP98451.1"
FT                   /translation="MTDTPPENEEQHESNVQNENEVEHLQQEIVTLKTELKEKNDKYLM
FT                   ALAESENSRKRLQKERQELMQYALENTLIDFLNPIESMEKALGFATQMSDDVKNWALGF
FT                   NMILNQFKQIFEEKGIIEYSSIGQKFNPFLHEAVQTEETSEVPEGTILEEFAKGYKIGE
FT                   RPIRVAKVKVAKAPTPKENKE"
FT   gene            581556..583538
FT                   /locus_tag="CpB0523"
FT   CDS_pept        581556..583538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0523"
FT                   /product="dnaK-type molecular chaperone"
FT                   /note="similar to dnaK-type molecular chaperone - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98452"
FT                   /db_xref="GOA:P27542"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27542"
FT                   /protein_id="AAP98452.1"
FT                   /translation="MSEHKKSSKIIGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSI
FT                   VAFKGNEKLVGIPAKRQAVTNPEKTLGSTKRFIGRKYSEVASEIQTVPYTVTSGSKGDA
FT                   VFEVDGKQYTPEEIGAQILMKMKETAEAYLGETVTEAVITVPAYFNDSQRASTKDAGRI
FT                   AGLDVKRIIPEPTAAALAYGIDKVGDKKIAVFDLGGGTFDISILEIGDGVFEVLSTNGD
FT                   TLLGGDDFDEVIIKWMIEEFKKQEGIDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQ
FT                   PFITMDAQGPKHLALTLTRAQFEKLAASLIERTKSPCIKALSDAKLSAKDIDDVLLVGG
FT                   MSRMPAVQETVKELFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGI
FT                   ETLGGVMTTLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLT
FT                   DIPPAPRGHPQIEVSFDIDANGIFHVSAKDVASGKEQKIRIEASSGLQEDEIQRMVRDA
FT                   EINKEEDKKRREASDAKNEADSMIFRAEKAIKDYKEQIPETLVKEIEERIENVRNALKD
FT                   DAPIEKIKEVTEDLSKHMQKIGESMQSQSASAAASSAANAKGGPNINTEDLKKHSFSTK
FT                   PPSNNGSSEDHIEEADVEIIDNDDK"
FT   gene            complement(583575..583808)
FT                   /locus_tag="CpB0524"
FT   CDS_pept        complement(583575..583808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98453"
FT                   /protein_id="AAP98453.1"
FT                   /translation="MGSACKFRTLNEKSRSFTRELSGSTKFSLLSGFCDYERSSLKFKA
FT                   NCTKEALLLQLLDQRIREWNCFLFIRKFPILL"
FT   gene            583809..585839
FT                   /locus_tag="CpB0525"
FT   CDS_pept        583809..585839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0525"
FT                   /product="proteins of ribonuclease"
FT                   /note="similar to proteins of ribonuclease family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98454"
FT                   /db_xref="GOA:Q9Z848"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z848"
FT                   /protein_id="AAP98454.1"
FT                   /translation="MLKKPKRKPGRRTYGKSLKIFIPGTLFVHARKGFGFVSPDNPEEY
FT                   PFDIFVPARDLRGALDGDHVIVSVLPYPRDGQKLKGTISEVLARGKTTLVGTITSLVSP
FT                   TSALAYTSMSGSQSLIPVELLPGRTYKIGDRILLSTPPWVDKPQEGASPALQMLEFIGH
FT                   ITNAKADFQAIQAEYNLAEEFPPEVIEEASLFSQKHITQVLHSRKDLRDLLCFTIDSST
FT                   ARDFDDAISLTYDHNNNYILGVHIADVSHYVTPHSHLDKEAAKRCNSTYFPGKVIPMLP
FT                   SALSDNLCSLKPNVDRLAVSVFMTFTKSGHLSDYQIFRSVIRSKYRMTYDEVDNIIEKK
FT                   HSHPLSKILNEMATLSKKFSDIREERGCIRFVLPSVTMSLDNLQEPVALIENHQTFSHK
FT                   LIEEFMLKANEVVAYHISHQGVSLPFRSHEPPNDENLLAFQELAKNMGFDITFTPTQEP
FT                   DYQYLLQTTSAGHPLEQVLHSQFVRSMKTASYSTENKGHYGLKLDYYTHFTSPIRRYID
FT                   LIVHRLLFNPLSIDQTHLEIIVRACSTKERVSAKAENSFENLKKTRFINKFLQEQPKTT
FT                   YHAYIITANHEGLSFVVTEFCHEGFIAAAELPKEYSLKKNALPESIPDKMKPGASIKVT
FT                   IDSVNLLTQKIVWSIATTTEDKPKKIKKTPSKKKGTKKRAS"
FT   gene            585841..586431
FT                   /locus_tag="CpB0526"
FT   CDS_pept        585841..586431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0526"
FT                   /product="N-methylpurine-DNA glycosylase"
FT                   /note="similar to N-methylpurine-DNA glycosylase - Mus
FT                   musculus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98455"
FT                   /db_xref="GOA:Q9Z847"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z847"
FT                   /protein_id="AAP98455.1"
FT                   /translation="MLQEHFFLSEDVITLAQQLLGHKLITTHEGLITSGYIVETEAYRG
FT                   PDDKACHAYNYRKTQRNRAMYLKGGSAYLYRCYGMHHLLNVVTGPEDIPHAVLIRAILP
FT                   DQGKELMIQRRQWRDKPPHLLTNGPGKVCQALGISLENNRQRLNTPALYISKEKISGTL
FT                   TATARIGIDYAQEYRDVPWRFLLSPEDSGKVLS"
FT   gene            586383..587165
FT                   /locus_tag="CpB0527"
FT   CDS_pept        586383..587165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0527"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT421 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98456"
FT                   /protein_id="AAP98456.1"
FT                   /translation="MEISPIPRRFGKSFILNNLKLYSKETNAHFLISCRRIMKKYFITG
FT                   LVILLPLAITIAIVTMIMNFLTQPFVGLASEFFEKFSFYTKHRALLKFVLQIILLFGLF
FT                   FATVLLGFLTRIMIFKSLLSIYDKILHRIPIIKTVYKAAQQVMTTIFGSKSGSFKQVVM
FT                   VPFPNANVQCIGLVAGDAPTVCCTGEKEDDPLVTVFIPTTPNPTSGFLTLFRKSDIVFL
FT                   DMKIEDAFKYIISCGVLSTPMACPSSPLPDELHQDQGS"
FT   gene            587283..587447
FT                   /locus_tag="CpB0528"
FT   CDS_pept        587283..587447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0528"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT421.1 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98457"
FT                   /protein_id="AAP98457.1"
FT                   /translation="MTRMSKQARRRAKSPKKRKPKYAIVHPAPAPRIVYKLHTNALSTS
FT                   DSIFIPKIG"
FT   gene            587464..587625
FT                   /locus_tag="CpB0529"
FT   CDS_pept        587464..587625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0529"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT421.2 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98458"
FT                   /protein_id="AAP98458.1"
FT                   /translation="MSRHRSYGKSVKGVTKRNVLKRFERVEVLRKLGRWNDSTAKKVTG
FT                   LPKTPILK"
FT   gene            587657..588133
FT                   /locus_tag="CpB0530"
FT   CDS_pept        587657..588133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0530"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT422 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98459"
FT                   /db_xref="GOA:Q9Z843"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z843"
FT                   /protein_id="AAP98459.1"
FT                   /translation="MTQEKIKIHVSNEQTCIPIHLVSVEKLVLTLLEHLKVTTNEIFIY
FT                   FLEDKALAELHDKVFADPSLTDTITLPIDAPGDPAYPHVLGEAFISPQAALRFLENTSP
FT                   NQEDIYEEISRYLVHSILHMLGYDDTSSEEKRKMRVKENQILCMLRKKHALLTA"
FT   gene            588135..589298
FT                   /locus_tag="CpB0531"
FT   CDS_pept        588135..589298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0531"
FT                   /product="hemolysin C"
FT                   /note="similar to hemolysin C - Treponema hyodysenteriae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98460"
FT                   /protein_id="AAP98460.1"
FT                   /translation="MLHILLAIFCILLFLAFGLTQPSCHGSSKFLKTLNQRFFKDKGRE
FT                   YPPFPSAPTILATLLCILYGALGTKLYTLLPPKTAHKDLLFWPLYSLSALIAYGFLPPW
FT                   ISTKVPKETTAHLRFLASVFQLGLFPLQLLFYRRRPNQQVRSSTSFQSQLSEALSAFDN
FT                   LIVREVMIPKVDIFALPEETTLQEALVLVSEEGYSRVPVYKKNLDNITGILLVKDLLLL
FT                   YTSSHDLSQPISSVAKPPFYAPEIKKASSLLQEFRQKHRHLAIIVNEYGFTEGIATMED
FT                   IIEEIIGEIADEHDVQENTPYKKIGSSWIVDGRMNISDAEEYFNLKIDHENSYDTLGGH
FT                   VFHKVGAVPQKGMRIHHENFDIEIITCTERNVGKLKITPRKRKFNIS"
FT   gene            589463..589813
FT                   /locus_tag="CpB0532"
FT   CDS_pept        589463..589813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0532"
FT                   /product="sigma F regulatory factor"
FT                   /note="similar to sigma F regulatory factor - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98461"
FT                   /protein_id="AAP98461.1"
FT                   /translation="MSDIQKEEHGSTTIFHLHGKLDGISSPEVQENISQSLAAGSKNII
FT                   LDCAHLDYMSSAGIRVLLQSYHQVGQHSGKIVLTTVPKTIEQTLYVTGFLSYFKIFNTV
FT                   DEAIQTLNKDGD"
FT   gene            589875..591737
FT                   /locus_tag="CpB0533"
FT   CDS_pept        589875..591737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0533"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT425 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98462"
FT                   /db_xref="InterPro:IPR022028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z840"
FT                   /protein_id="AAP98462.1"
FT                   /translation="MRRSVCYVNPSIARAGQISTWKFLYSLATPLPAGTKCKFDLAGSG
FT                   KPTDWEAPATDLSQTRNVIYAEMPEGEIIEATAIPVKDNPVPQFEFTLPYELQVGETLT
FT                   IVMGASPNHPQVDDAGNGAQLFAQRRKPFYLYIDPTGEGNYDEPDVFSMDIRGNVLKKI
FT                   EIFTPSYVVKNKRFDITVRFEDEFGNLTNFSPEETRIELSYEHLRENLNWQLFIPETGF
FT                   VILPNLYFNEPGIYRIQLKNLSTQEIFISAPIKCFADSAPNLMWGLLHGESERVDSEEN
FT                   IETCMRYFRDDRALNFYASSSFENQENLSPDIWKLINQTVSDFNEEDRFITLSGFQYSG
FT                   EPHLEGVRHILHTKETKSHSKHKEYKHIPLAKLYKSTVNHDMISIPSFTASKEHGFDFE
FT                   NFYPEFERVVEIYNAWGSSETTAALNNPFPIQGKDSEDPRGTVIEGLKKNLRFGFVAGG
FT                   LDDRGIYKDYFDSPQVQYSPGLTAIICNKYTRESLVEALFARHCYATTGPRIVLSFNIT
FT                   SAPMGSELSTGSKPGLNVNRHISGHVAGTALLKTVEIIRNGEVLHTFFPDSNNLDYEYD
FT                   DMVPLSSVTLKDPNGKAPFVFYYLRVTQADNAMAWSSPIWVDLN"
FT   gene            591924..593078
FT                   /locus_tag="CpB0534"
FT   CDS_pept        591924..593078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0534"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT426 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98463"
FT                   /protein_id="AAP98463.1"
FT                   /translation="MLQNLERIVHQSVHQMTTCLPQPPKTSPLYSIFEKLDAQERLSSE
FT                   DALHLLLLTNKEDQRTLWNFADQVRKQRVGDTVYYSSTLYLYPTNFCDFSCKFCSFYAK
FT                   PGDPKGWLYSPDDLLQQIQNIKTPITEVHIVGGCFPSCNLQYYSDLFTKIKEYDPQIHI
FT                   KALTAIEYAYLSDLDNLSIRDVLLTLKDAGLDSIPGGGAEILVDKIRNFLAPKRLSSSD
FT                   FLNIHKMAHQLGIHSNITMLCYHKEGPEDLVTHMVKVRDLQDETQGFKNFILLKFAQEN
FT                   NVLGKRLRKSGQGHAIPLKSLMAVARIFLDNFSNMKALWNYLGIEAALDLLSCGANDLS
FT                   STHMGEKVFQMASSKEPIKMDAEGMAALITQQGRTPCLTNSSHV"
FT   gene            593051..593845
FT                   /locus_tag="CpB0535"
FT   CDS_pept        593051..593845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98464"
FT                   /protein_id="AAP98464.1"
FT                   /translation="MSNQLQPCISLGCVSYINSFPLSLQLIKRNDIRCVLAPPADLLNL
FT                   LIEGKLDVALTSSLGAISHNLGYVPGFGIAANQRILSVNLYAAPTFFNSPQPRIAATLE
FT                   SRSSIGLLKVLCRHLWRIPTPHILRFITTKVLRQTPENYDGLLLIGDAALQHPVLPGFV
FT                   TYDLASGWYDLTKLPFVFALLLHSTSWKEHPLPNLAMEEALQQFESSPEEVLKEAHQHT
FT                   GLPPSLLQEYYALCQYRLGEEHYESFEKFREYYGTLYQQARL"
FT   gene            593793..594506
FT                   /gene="ubiE"
FT                   /locus_tag="CpB0536"
FT   CDS_pept        593793..594506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CpB0536"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase"
FT                   /note="similar to ubiquinone/menaquinone biosynthesis
FT                   methlytransferase ubiE - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98465"
FT                   /db_xref="GOA:Q9K2B6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K2B6"
FT                   /protein_id="AAP98465.1"
FT                   /translation="MKNSGNIMEPSTNKPDCKKIFDSIASKYDRTNTILSLGMHHFWNR
FT                   SLIQILGSGYSLLDLCAGTGKVAKRYIAAHPQASVTLVDFSSAMLDIAKQHLPQGSCSF
FT                   IHSDINQLPLENHSYPLAAMAYGLRNLSDPHKALQEISRVLMPSGKLGILELTPPKKTH
FT                   PTYSAHKLYLRAVVPWIGKSVSKDPDAYSYLSKSIQQLPKDHDLEDLFSKSGFYIAKKK
FT                   KLFLGAATIWLLEKQ"
FT   gene            complement(594574..596193)
FT                   /locus_tag="CpB0537"
FT   CDS_pept        complement(594574..596193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98466"
FT                   /protein_id="AAP98466.1"
FT                   /translation="MKIILAVLGRAIAKAYYVCMVARGLCDFPTLVPNERLPIGPFFVP
FT                   QHTSGAKGKEFAKRNFSIISGLDDILKLCILQRRPFALQWDNLSVKSDYEEAGPAIGIR
FT                   SLEPQVSQISPAHGRLCSTLVQWAPILGSEEQLVWLEETMKRLKFPKSLGSKDAVIVDS
FT                   EMVPVNANPTQEIPAASETVESSPVAPGNTTDTMPAASGTTDTTSGVSEAAAAEATVDS
FT                   TPGTEEEPSFSLRYALVVQNVPYPEPPKEPEVMFTDEEKSLILEATRARRMELDLYNGY
FT                   LADYELSKDEIQKHVPDLPENWRTNWRWSERLYKFFFKTKKEGLEEIFLNKELGNMILA
FT                   RGLAATQSQARIKVFNSLVAWLLQSFNVGRSCTAKPLPTSKLDLFKSEFESKPKNNILT
FT                   EFLVASDEEILFKGLRVLEPGIEGWYDHPDQAGEIRSVLEGLVQAGRISGYWENQPFGR
FT                   FVLRGVGERRTELVELLESLVASGEIMQFFESSDEEGAFIIDNEPSKTAMLKQRFKSCV
FT                   RTKLVGSFADESLPRGRFTILV"
FT   gene            complement(596114..596953)
FT                   /locus_tag="CpB0538"
FT   CDS_pept        complement(596114..596953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98467"
FT                   /protein_id="AAP98467.1"
FT                   /translation="MSSLLSCGRIEPTRVTCSLKTYLEDTSQNQLSTRLVRASVIFLCA
FT                   LLIILVCVALSSLIPSIMALPTSFTVMGLILFVMSLLGDVAIISYLTYSTVTSYRQNKR
FT                   AFEIHKPARSVYYEGVRHWDLGRSSLGTGEIPIVRTLFSPFQNHGLNHALAAKIFLFME
FT                   HFSPEPPNEPLVDWACLIRDFRPHVSSLCFVIEKQGSSLRTKEGNTICEAFRSDYDAHF
FT                   AMVDCYRLIHSKLIIEKMGLKNIDIIPSVMVREDYPSRPGEGYREGLLRMYGGKGAL"
FT   gene            complement(597151..598125)
FT                   /locus_tag="CpB0539"
FT   CDS_pept        complement(597151..598125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0539"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT429 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98468"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z834"
FT                   /protein_id="AAP98468.1"
FT                   /translation="MMTYPVPQNPLLLRILRLMDAFSKSDDERDFYLDRVEGFILYIDL
FT                   DKDQEDLNKIYQELEENAERYCLIPKLTFYEVKKIMETFINEKIYDIDTKEKFLEILQS
FT                   KNAREQFLEFIYDHEAELEKWQQFYVERSRIRIIEWLRNNKFHFVFEEDLDFTKNVLEQ
FT                   LKIHLFDAKVGKEITQARQLLSNKAKIYYSNEALNPRPKRGRPPKQSAKVETETTISSD
FT                   IYTKVPQAARRFLFLPEITSPSSITFSEKFDTEEEFLANLRGSTRVEDQLNLTNLSERF
FT                   ASLKELSAKLGYDSLSTGDFFGDDDEKVVTKTKGSKRGRKKSS"
FT   gene            complement(598223..599008)
FT                   /locus_tag="CpB0540"
FT   CDS_pept        complement(598223..599008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0540"
FT                   /product="diaminopimelate epimerase"
FT                   /note="similar to diaminopimelate epimerase - Haemophilus
FT                   influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98469"
FT                   /db_xref="GOA:Q9Z833"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z833"
FT                   /protein_id="AAP98469.1"
FT                   /translation="MVYWMAFYSPSTISKYFIYSGAGNRFLLGETLPEVEDVRFLCQET
FT                   RVDGFLYLKPSSCADAQLIIFNSDGSRPTMCGNGLRCAIAHLASQKGKSDISVSTDSGL
FT                   YSGYFYSWDRVLVDMTLADWRASVHRLESRPDPLPKEVVCIHTGVPHAVVILPEISTLD
FT                   LSILGPFLRYHQTFSPDGVNVNFVQILGHCQLRVRTYERGVEGETAACGTGALASALVV
FT                   SNSYGWKESIQIHTWGGELMTVSQNRGRVYLQGSVTRDL"
FT   gene            complement(598965..599540)
FT                   /gene="clp"
FT                   /locus_tag="CpB0541"
FT   CDS_pept        complement(598965..599540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clp"
FT                   /locus_tag="CpB0541"
FT                   /product="endopeptidase"
FT                   /note="similar to endopeptidase clp - Caulobacter
FT                   crescentus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98470"
FT                   /db_xref="GOA:Q9Z832"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z832"
FT                   /protein_id="AAP98470.1"
FT                   /translation="MADGEVHKLRDIIEKELLEARRVFFSEPVTEKSASDAIKKLWYLE
FT                   LKDPGKPIVFVINSPGGSVDAGFAVWDQIKMLTSPVTTVVTGLAASMGSVLSLCAAPGR
FT                   RFATPHSRIMIHQPSIGGPITGQATDLDIHAREILKTKARIIDVYVEATNQPRDIIEKA
FT                   IDRDMWMTANEAKDFGLLDGILFSFNDL"
FT   gene            complement(599560..601119)
FT                   /locus_tag="CpB0542"
FT   CDS_pept        complement(599560..601119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0542"
FT                   /product="serine hydroxymethyl transferase"
FT                   /note="similar to serine hydroxymethyl transferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98471"
FT                   /db_xref="GOA:Q9Z831"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z831"
FT                   /protein_id="AAP98471.1"
FT                   /translation="MLKVFEKFKKFAIVEIFTKVVAVVSLLHKFLENASGKKGQSLAST
FT                   AYLAALDHLLNAFPSIGERIIDELKSQRSHLKMIASENYSSLSVQLAMGNLLTDKYCEG
FT                   SPFKRFYSCCENVDAIEWECVETAKELFAADCACVQPHSGADANLLAVMAILTHKVQGP
FT                   AVSKLGYKTVNELTEEEYTLLKAEMSSCVCLGPSLNSGGHLTHGNVRLNVMSKLMRCFP
FT                   YDVNPDTECFDYAEISRLAKEYKPKVLIAGYSSYSRRLNFAVLKQIAEDCGSVLWVDMA
FT                   HFAGLVAGGVFVDEENPIPYADIVTTTTHKTLRGPRGGLVLATREYESTLNKACPLMMG
FT                   GPLPHVIAAKTVALKEALSVDFKKYAHQVVNNARRLAERFLSHGLRLLTGGTDNHMMVI
FT                   DLGSLGISGKIAEDILSSVGIAVNRNSLPSDAIGKWDTSGIRLGTPALTTLGMGIDEME
FT                   EVADIIVKVLRNIRLSCHVEGSSKKNKGELPEAIAQEARDRVRNLLLRFPLYPEIDLEA
FT                   LV"
FT   gene            601309..601980
FT                   /locus_tag="CpB0543"
FT   CDS_pept        601309..601980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0543"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT433 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98472"
FT                   /protein_id="AAP98472.1"
FT                   /translation="MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQA
FT                   THVILTSPSSTHLFLSRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYVVATQEI
FT                   AEGIFPLLQALPSSARILYPHSSLARPVIREFLYNRFTFFSYPHYTVKPRKLKKNILSK
FT                   YKKIILTSPSTVRAFAKIFPRFPEKTYWCQGRMTLQEFQKFSSQKQVSLLETLGKSRTS
FT                   P"
FT   gene            602045..602377
FT                   /locus_tag="CpB0544"
FT   CDS_pept        602045..602377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98473"
FT                   /protein_id="AAP98473.1"
FT                   /translation="MASSATPGFDGTAPSLFPLATRPRYNFKLALFVTIAIALVWIALI
FT                   ATTIAIGLCIHPLCSFIFLTAIPLYFISRYICSHYARNVYIALDVVPDHSKLQDMRSHS
FT                   PIFSDR"
FT   gene            602425..603504
FT                   /locus_tag="CpB0545"
FT   CDS_pept        602425..603504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98474"
FT                   /protein_id="AAP98474.1"
FT                   /translation="MSGPSRTESSQVSVLSYVPRDKEIAPKKQFTIAKISTLAILASLA
FT                   LGALVAGISLTIVLGNPVFLALLITTALFSVVTFLVYHQMTSKVSSNWQKVLEQNFKPL
FT                   GKAWQEKNVDCYSNEMQFYNNHLNPKFKVAIQTDASQPFQPTFLTGLRVIEKNQSTGII
FT                   FNPVGPTNLIDNTATNLSTILYSTLKDKSVWDTCKQREGDPAKGEDPFSPTEVRVVKLP
FT                   NEALDQTFNLNLSSAEKKSILPTFLGHVCGPKSEELPNQQEYYRQALLAYENCLKAAIE
FT                   SHAAIVALPLFTSVYEVPPEEILPKEGTFYWDNQTQAFCKRALLDAIQNTALRYPQRSL
FT                   LVILQDPFNTIESQSRSEE"
FT   gene            603844..604608
FT                   /locus_tag="CpB0546"
FT   CDS_pept        603844..604608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0546"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT398 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98475"
FT                   /protein_id="AAP98475.1"
FT                   /translation="MHDALLSILAIQELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRK
FT                   VQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKKMDEFNALTQEMTTANKER
FT                   RSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKALLEQ
FT                   RTELKHATNPELLSIYERLLNNKKDRVVVPIENRVCSGCHIVLTPQHENLVRKKDRLIF
FT                   CEHCSRILYWQESQVNAQENSTAKRRRRRAAV"
FT   gene            complement(605029..606018)
FT                   /gene="kpsF"
FT                   /locus_tag="CpB0547"
FT   CDS_pept        complement(605029..606018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="CpB0547"
FT                   /product="KpsF"
FT                   /note="similar to kpsF protein - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98476"
FT                   /db_xref="GOA:Q9Z826"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z826"
FT                   /protein_id="AAP98476.1"
FT                   /translation="MPSPMISTDVCQDILGKQKEAVDFFFQAFQPKEAMQLAEKILGHS
FT                   GWVFFSGVGKSGCVARKLVATLQSLSERALFFSPVDLLHGDLGLVSPGDIVCLFSKSGE
FT                   TQELLDTVPHLKSRRAILVAITSMPYSNLAALSDLVVILPSVAELDPFNLIPTNSTTCQ
FT                   MIFGDFLAMLLFHSRGVSLSTYGKNHPSGQVGMKANGKVKDFMFPKTEVPFCHLGDKVS
FT                   FSLEVFSAYGCGCVCIVDPQFRLMGIFTDGDLRRSLASYGGEVLSLSLEKVMTANPRCI
FT                   TEDSDIAIALQLMESSSPVAVLPVLDNEENRHVTGLLHMHTLAKAGLL"
FT   gene            complement(606045..607226)
FT                   /locus_tag="CpB0548"
FT   CDS_pept        complement(606045..607226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0548"
FT                   /product="dihydrolipoamide S-acetyltransferase"
FT                   /note="similar to dihydrolipoamide S-acetyltransferase -
FT                   Bacillus stearothermophilus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98477"
FT                   /protein_id="AAP98477.1"
FT                   /translation="MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIA
FT                   TELPSPKAGRLVRFCVNEGDEVASGDVLGLIELEEISEADDESTSCPLTSCETKSEAGS
FT                   SSSSVWFSPAVLSLAQREGIGLDNLQKIAGTGKGGRVTRQDLEAYISESQQVSIPEIFQ
FT                   GEVNRIPMSPLRRAIASSLSKSSDEVPHASLVVDVDVTDLMHLISGERQRFLDTHGVKL
FT                   TITSFIVQCLAQTLRQFPLLNGSLDGTTIVMKKSVNVGVAVNLNKEGVVVPVIHNCQDR
FT                   GLVSIAKALADLSSRARLNKLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIG
FT                   TIQKRVVVRDDDSLAVRKMVYVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG"
FT   gene            complement(607240..608484)
FT                   /locus_tag="CpB0549"
FT   CDS_pept        complement(607240..608484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0549"
FT                   /product="proton/sodium glutamate symport transporter"
FT                   /note="similar to proton/sodium glutamate symport
FT                   transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98478"
FT                   /protein_id="AAP98478.1"
FT                   /translation="MKLWMKIFIGLFVGVTLGLVLEDKAIFFKPIGDIFLNLLSMVVYP
FT                   LVFCSMVLGIASISDMKKLGRIGIKSVGLYLGTTALAIVIGLCFAWIFSPGNGCDFAQA
FT                   QSMDSAVTVIDSNKTAAYFLSIIAQVFPSNPVRSFAEGNILQIIIFAIFLGIALRLSGE
FT                   RGRPVERFIDGFSEIMLRMVNMIMSFAPYGVGASMAWISGNHGLGVLWQLGKFIIAYYL
FT                   ACLFHATLVFGGLVRFGCKMSFSKFLSSMMDAISCAVSTASSSATLPVTMRCVSKNLGV
FT                   SAEVSGFVLPLGATVNMNGTAIFQGMAAVFIAQAYNCPLSLSSLLLLVVTATFSAVGSA
FT                   GVPGGGMITLGSVLASVGLPIQGIAILAGIDRLRDIVGTPMNILGDAVVATYVASGEGE
FT                   LSPYESIKQESVETT"
FT   gene            complement(608484..609581)
FT                   /gene="ycaH"
FT                   /locus_tag="CpB0550"
FT   CDS_pept        complement(608484..609581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaH"
FT                   /locus_tag="CpB0550"
FT                   /product="YcaH"
FT                   /note="similar to ycaH protein - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98479"
FT                   /db_xref="GOA:Q9Z823"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z823"
FT                   /protein_id="AAP98479.1"
FT                   /translation="MKKRFPSTLFLFYRRVTIAISLEGILGWGWLGSLLSKVFAFLVAC
FT                   WNRFSWSTPYRARSTVISVGNIVVGGAGKTPTVLWLAEALRLRGYSCGVLSRGYKSQSS
FT                   RQKKLTVVDSKVHSASYVGDEPLLMAEKLPEGSVWVHKDRRISAARAAEKFGILLLDDG
FT                   LQYRKLHKDVEIAVVNGQDPLGGRAFFPKGRLRDFPLRLKTVDAIIVNGGGKEAGTVVK
FT                   RVSNAPQIFVKPTIASVVWTHNGERIPKEALRELRVGVFCGLGFPQGFLNMLREEGIHI
FT                   LGKYLLPDHAAITKKELNYFCQQMAMRQGQGLLCTEKDSVKLPRLSGEVSLLPIAKVEM
FT                   RLSVNQDDTLSLLNMIEQIHKNRGN"
FT   gene            complement(609779..610576)
FT                   /gene="spoU"
FT                   /locus_tag="CpB0551"
FT   CDS_pept        complement(609779..610576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="CpB0551"
FT                   /product="tRNA methylase"
FT                   /note="similar to tRNA methylase spoU - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98480"
FT                   /protein_id="AAP98480.1"
FT                   /translation="MDCIGKHNPLVKEALALKRSRCRKSSWFLVEGAREIQKALRTGYL
FT                   CQHVFCSTHLSEKEKEFLYELKRNSTKILYCLDSTLAQLSFKEHHDSFVAVIQKRVWNK
FT                   EDFLIQRKNAQPFYLIIEQVEKPGNVGAILRIADGAGVDGVILCNPIVDLYNPNVVRSS
FT                   LGAVFSLPILSISREEGKELFKQEGWTVFVTSPRAETMYFSKNYLGPTALVFGSEKDGL
FT                   TEDWFSEDFSEIALPMLGESDSLNLATSVAAVAYEVVRQRWVN"
FT   gene            complement(610564..611391)
FT                   /locus_tag="CpB0552"
FT   CDS_pept        complement(610564..611391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0552"
FT                   /product="putative SAM dependent methyltransferase"
FT                   /note="similar to probable SAM dependent methyltransferase
FT                   - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98481"
FT                   /protein_id="AAP98481.1"
FT                   /translation="MDYKLLDSGDGNKLECFGPVTLIRPSSIAVWPKSRPELWSQAQLQ
FT                   YVREGERGAWKNFKRLPEEWEVAFSDVRCLLKRTPFGHLGVFPEHMGFWPALKQAIEKH
FT                   KERQVLNLFAYTGAGSIFAAKCGARVTHVDASQAAVRWAQRNVEKNAFPERRIFWVIED
FT                   VISFLKKEIRRNKKYQVILLDPPSYGRGPDGEVFKIDKDLFPLLSLCSKLLADDASYFL
FT                   LTSHTPGHTPEFLRAIARRSVPTLVSEAWSCGESFCGEGVGALPSGSFVQWIA"
FT   gene            complement(611394..611996)
FT                   /locus_tag="CpB0553"
FT   CDS_pept        complement(611394..611996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0553"
FT                   /product="riboflavin synthase alpha chain"
FT                   /note="similar to riboflavin synthase alpha chain -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98482"
FT                   /db_xref="GOA:Q9Z820"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z820"
FT                   /protein_id="AAP98482.1"
FT                   /translation="MFSGIIQELGEVCFFEAQGNGLSLGIKSTPLFVTPLVTGDSVAVD
FT                   GVCLTLTSCNESKIFFDVIPETLACTTLGEKRCSDQVNLEAALKMGDSIGGHLLSGHVF
FT                   GTAEIFLIKENRYYFRGSKELSQYLFEKGFIAIDGISLTLVSVDSDTFSVGLIPETLQR
FT                   TTLGKKREGERVNIEIDMSTKIQVDTVKRILASSGKD"
FT   gene            612252..612710
FT                   /locus_tag="CpB0554"
FT   CDS_pept        612252..612710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0554"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT406 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98483"
FT                   /db_xref="GOA:Q9Z819"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z819"
FT                   /protein_id="AAP98483.1"
FT                   /translation="MQCPFCNHGELKVIDSRNAPEANAIKRRRECLKCSQRFTTFETVE
FT                   LTLQVLKRDGRYENFQESKLIHGLNAASSHTRIGQDQVHAIASNVKSELLGKQNREIST
FT                   KEIGELVMKYLKKADMIAYIRFACVYRRFKDVGELMEVLLSATPDMEK"
FT   gene            612735..613109
FT                   /locus_tag="CpB0555"
FT   CDS_pept        612735..613109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0555"
FT                   /product="general stress protein 160"
FT                   /note="similar to general stress protein 160 - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98484"
FT                   /protein_id="AAP98484.1"
FT                   /translation="MPLSDDEIEQFKKRLLEMKAKLSHTLEGNAQEVKKPNEATGYSQH
FT                   QADQGTDTFDRTISLEVTTKEYELLRQINRALEKINESSYGICDVSGEEIPLARLIAIP
FT                   YATMTVKAQEQFEKGLLSGN"
FT   gene            613145..613621
FT                   /locus_tag="CpB0556"
FT   CDS_pept        613145..613621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0556"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="similar to lipoprotein signal peptidase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98485"
FT                   /db_xref="GOA:Q9Z817"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z817"
FT                   /protein_id="AAP98485.1"
FT                   /translation="MITLFVLIDWVTKLVVLLQYKDLQILTHPTLYTHSWGRFSFSIAP
FT                   VFNEGAAFGLFSNYKYFLFLLRIFVILGLLAYLFFKKKSIQSTTQTALVLLCAGAIGNV
FT                   GDIIFYGHIVDFISFNYKQWAFPTFNVADVLISLGTLLLVYKFYFPTKQTEKKR"
FT   gene            613667..615016
FT                   /locus_tag="CpB0557"
FT   CDS_pept        613667..615016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0557"
FT                   /product="alanine/glycine transporter protein"
FT                   /note="similar to alanine/glycine transporter protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98486"
FT                   /protein_id="AAP98486.1"
FT                   /translation="MNRLLSLLSVFDDFFWSYVAFILIIVLGVSFSWKSRFFQFTKFSQ
FT                   FCKLFRYYSQNPQERETKQGVHPLKVFFASAGGNIGIGNVVGIVTAACIGGPGALFWVW
FT                   IAGIFGSIVKYSEVYLGIKFRKLDRDGVYQGGPMYFLIKAFKTPVVSVIVAILLCIYGV
FT                   EIYQFSVITDSLAHCWNLPKVYPMLGLLFLVFYAIRGGLQRIGKICSIVLPFFMLLYCA
FT                   LSLYILVKEFHTLPHLLSTVFSSAFKGQSALGGFAGCTVATTIHQGISRAAYSGDIGIG
FT                   FDSIIQSESSAKDPSTQAQLSIVGIAIDNLICTLSLLMVLASGSWSLGLENASQVVEHT
FT                   LASYFPMVKFFLPTFFFVTGYTTIISYFLVGKKCAKFLYGNTGAKIYTLYGLLILPLFC
FT                   FLSQNTALLIMSVSGALLLCFNLLGVFILRKEVIFPARAASLTETSLSTE"
FT   gene            615155..615514
FT                   /locus_tag="CpB0558"
FT   CDS_pept        615155..615514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0558"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT814.1 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98487"
FT                   /protein_id="AAP98487.1"
FT                   /translation="MDNYLLGSLIFCCVLLSIGMCTIFVMTICFLRQLNKILKNIHRVT
FT                   TILNFEAKILAPLMLGKKLLCGWLKKRKNRGSLSEDIDELLDEKKQRSWKKNLDQGIKW
FT                   CAALVLIWKVFRNKD"
FT   gene            615519..615836
FT                   /locus_tag="CpB0559"
FT   CDS_pept        615519..615836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0559"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT814 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98488"
FT                   /protein_id="AAP98488.1"
FT                   /translation="MRDIVMFRNNHKPKKTKCKRFRWLRGVLFGGFIATLLTCLFTPKS
FT                   GVQLRKKILKVKNSGAKKSRVFFKNSKQHTKSFVKQAKLLAKNISHELQDFKKGILDDK
FT                   D"
FT   gene            616027..618870
FT                   /locus_tag="CpB0560"
FT   CDS_pept        616027..618870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0560"
FT                   /product="Omp11"
FT                   /note="similar to outer membrane protein omp11 - Chlamydia
FT                   pneumoniae, strain VR1310"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98489"
FT                   /db_xref="GOA:Q9Z813"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z813"
FT                   /protein_id="AAP98489.1"
FT                   /translation="MKQMRLWGFLFLSSFCQVSYLRANDVLLPLSGIHSGEDLELFTLR
FT                   SSSPTKTTYSLRKDFIVCDFAGNSIHKPGAAFLNLKGDLFFINSTPLAALTFKNIHLGA
FT                   RGAGLFSESNVTFKGLHSLVLENNESWGGVLTTSGDLSFINNTSVLCQNNISYGPGGAL
FT                   LLQGRKSKALFFRDNRGTILFLKNKAVNQDESHPGYGGAVSSISPGSPITFADNQEILF
FT                   QENEGELGGAIYNDQGAITFENNFQTTSFFSNKASFGGAVYSRYCNLYSQWGDTLFTKN
FT                   AAAKVGGAIHADYVHIRDCKGSIVFEENSATAGGAIAVNAVCDINAQGPVRFINNSALG
FT                   LNGGAIYMQATGSILRLHANQGDIEFCGNKVRSQFHSHINSTSNFTNNAITIQGAPREF
FT                   SLSANEGHRICFYDPIISATENYNSLYINHQRLLEAGGAVIFSGARLSPEHKKENKNKT
FT                   SIINQPVRLCSGVLSIEGGAILAVRSFYQEGGLLALGPGSKLTTQGKNSEKDKIVITNL
FT                   GFNLENLDSSDPAEIRATEKASIEISGVPRVYGHTESFYENHEYASKPYTTSIILSAKK
FT                   LVTAPSRPEKDIQNLIIAESEYMGYGYQGSWEFSWSPNDTKEKKTIIASWTPTGEFSLD
FT                   PKRRGSFIPTTLWSTFSGLNIASNIVNNNYLNNSEVIPLQHLCVFGGPVYQIMEQNPKQ
FT                   SSNNLLVQHAGHNVGARIPFSFNTILSAALTQLFSSSSQQNVADKSHAQILIGTVSLNK
FT                   SWQALSLRSSFSYTEDSQVMKHVFPYKGTSRGSWRNYGWSGSVGMSYAYPKGIRYLKMT
FT                   PFVDLQYTKLVQNPFVETGYDPRYFSSSEMTNLSLPIGIALEMRFIGSRSSLFLQVSTS
FT                   YIKDLRRVNPQSSASLVLNHYTWDIQGVPLGKEALNITLNSTIKYKIVTAYMGISSTQR
FT                   EGSNLSANAHAGLSLSF"
FT   gene            619016..624187
FT                   /locus_tag="CpB0561"
FT   CDS_pept        619016..624187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0561"
FT                   /product="outer membrane protein omp5"
FT                   /note="similar to outer membrane protein omp5 - Chlamydia
FT                   pneumoniae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98490"
FT                   /db_xref="GOA:Q9Z812"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z812"
FT                   /protein_id="AAP98490.1"
FT                   /translation="MKWLPATAVFAAVLPALTAFGDPASVEISTSHTGSGDPTSDAALT
FT                   GFTQSSTETDGTTYTIVGDITFSTFTNIPVPVVTPDANDSSSNSSKGGSSSSGATSLIR
FT                   SSNLHSDFDFTKDSVLDLYHLFFPSASNTLNPALLSSSSSGGSSSSSSSSSSGSASAVV
FT                   AADPKGGAAFYSNEANGTLTFTTDSGNPGSLTLQNLKMTGDGAAIYSKGPLVFTGLKNL
FT                   TFTGNESQKSGGAAYTEGALTTQAIVEAVTFTGNTSAGQGGAIYVKEATLFNALDSLKF
FT                   EKNTSGQAGGGIYTESTLTISNITKSIEFISNKASVPAPAPEPTSPAPSSLINSTTIDT
FT                   STLQTRAASATPAVAPVAAVTPTPISTQETAGNGGAIYAKQGISISTFKDLTFKSNSAS
FT                   VDATLTVDSSTIGESGGAIFAADSIQIQQCTGTTLFSGNTANKSGGGIYAVGQVTLEDI
FT                   ANLKMTNNTCKGEGGAIYTKKALTINNGAILTTFSGNTSTDNGGAIFAVGGITLSDLVE
FT                   VRFSKNKTGNYSAPITKAASNTAPVVSSSTTAASPAVPAAAAAPVTNAAKGGALYSTEG
FT                   LTVSGITSILSFENNECQNQGGGAYVTKTFQCSDSHRLQFTSNKAADEGGGLYCGDDVT
FT                   LTNLTGKTLFQENSSEKHGGGLSLASGKSLTMTSLESFCLNANTAKENGGGANVPENIV
FT                   LTFTYTPTPNEPAPVQQPVYGEALVTGNTATKSGGGIYTKNAAFSNLSSVTFDQNTSSE
FT                   NGGALLTQKAADKTDCSFTYITNVNITNNTATGNGGGIAGGKAHFDRIDNLTVQSNQAK
FT                   KGGGVYLEDALILEKVITGSVSQNTATESGGGIYAKDIQLQALPGSFTITDNKVETSLT
FT                   TSTNLYGGGIYSSGAVTLTNISGTFGITGNSVINTATSQDADIQGGGIYATTSLSINQC
FT                   NTPILFSNNSAATKKTSTTKQIAGGAIFSAAVTIENNSQPIIFLNNSAKSEATTAATAG
FT                   NKDSCGGAIAANSVTLTNNPEITFKGNYAETGGAIGCIDLTNGSPPRKVSIADNGSVLF
FT                   QDNSALNRGGAIYGETIDISRTGATFIGNSSKHDGSAICCSTALTLAPNSQLIFENNKV
FT                   TETTATTKASINNLGAAIYGNNETSDVTISLSAENGSIFFKNNLCTATNKYCSIAGNVK
FT                   FTAIEASAGKAISFYDAVNVSTKETNAQELKLNEKATSTGTILFSGELHENKSYIPQKV
FT                   TFAHGNLILGKNAELSVVSFTQSPGTTITMGPGSVLSNHSKEAGGIAINNVIIDFSEIV
FT                   PTKDNATVAPPTLKLVSRTNADSKDKIDITGTVTLLDPNGNLYQNSYLGEDRDITLFNI
FT                   DNSASGAVTATNVTLQGNLGAKKGYLGTWNLDPNSSGSKIILKWTFDKYLRWPYIPRDN
FT                   HFYINSIWGAQNSLVTVKQGILGNMLNNARFEDPAFNNFWASAIGSFLRKEVSRNSDSF
FT                   TYHGRGYTAAVDAKPRQEFILGAAFSQVFGHAESEYHLDNYKHKGSGHSTQASLYAGNI
FT                   FYFPAIRSRPILFQGVATYGYMQHDTTTYYPSIEEKNMANWDSIAWLFDLRFSVDLKEP
FT                   QPHSTARLTFYTEAEYTRIRQEKFTELDYDPRSFSACSYGNLAIPTGFSVDGALAWREI
FT                   ILYNKVSAAYLPVILRNNPKATYEVLSTKEKGNVVNVLPTRNAARAEVSSQIYLGSYWT
FT                   LYGTYTIDASMNTLVQMANGGIRFVF"
FT   gene            complement(624224..624310)
FT                   /locus_tag="CpBt15"
FT   tRNA            complement(624224..624310)
FT                   /locus_tag="CpBt15"
FT                   /product="tRNA-Ser"
FT                   /note="GGA"
FT   gene            624492..625328
FT                   /locus_tag="CpB0562"
FT   CDS_pept        624492..625328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0562"
FT                   /product="adhesin B protein"
FT                   /note="similar to adhesin B protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98491"
FT                   /db_xref="GOA:Q9Z811"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z811"
FT                   /protein_id="AAP98491.1"
FT                   /translation="MHKVIVFIFLTLYSLKSYGNDVIDKPHVLVSIAPYKFLVEQIAEE
FT                   TCFVYAIVTNHYDPHTYELPPQQIKELRQGDLWFRIGEAFEKTCERNLTCQQVDLSQNV
FT                   SLIQGKPCCNQHTTNYDTHTWLSPKNLKVQVETIVTTLSKKYPQHATLYQSNGEKLLLA
FT                   LDQLNEEILTITSKAKQRHILVSHGAFGYFCRDYNFSQHTIEKSSHVEPSPKDVARVFR
FT                   DIEQYKISSVILLEYSGRRSSAMLADRFHMHTVNLDPYAENVLVNLKTIATTFSSL"
FT   gene            625325..626062
FT                   /locus_tag="CpB0563"
FT   CDS_pept        625325..626062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0563"
FT                   /product="ABC transporter ATPase"
FT                   /note="similar to ABC transporter ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98492"
FT                   /db_xref="GOA:Q9Z810"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z810"
FT                   /protein_id="AAP98492.1"
FT                   /translation="MTIRILAEGLAFRYGSKGPNIIHDVSFSVYDGDFIGIIGPNGGGK
FT                   STLTMLILGLLTPTFGSLKTFPSHSAGKQTHSMIGWVPQHFSYDPCFPISVKDVVLSGR
FT                   LSQLSWHGKYKKKDFEAVDHALDLVGLSDHHHHCFAHLSGGQIQRVLLARALASYPEIL
FT                   ILDEPTTNIDPDNQQRILSILKKLNRTCTILMVTHDLHHTTNYFNKVFYMNKTLTSLAD
FT                   TSTLTDQFCCHPYKNQEFSCSPH"
FT   gene            626041..626928
FT                   /locus_tag="CpB0565"
FT   CDS_pept        626041..626928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0565"
FT                   /product="iron transport protein"
FT                   /note="similar to iron transport protein - Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98493"
FT                   /db_xref="GOA:Q9Z809"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z809"
FT                   /protein_id="AAP98493.1"
FT                   /translation="MFMLSSLIRDSFPLLILLPTFLAALGASVAGGVMGTYIVVKRIVS
FT                   ISGSISHAILGGIGLTLWIQYKLHLSFFPMYGAIVGAIFLALCIGKIHLKYQEREDSLI
FT                   AMIWSVGMAIGIIFISRLPTFNGELINFLFGNILWVTPSDLYSLGIFDLLVLGIVVLCH
FT                   TRFLALCFDERYTALNHCSVQLWYFLLLVLTAITIVMLIYVMGTILMLSMLVLPVAIAC
FT                   RFSYKMTRIMFISVLLNILCSFSGICIAYCLDFPVGPTISLLMGLGYTASLCVKKRYNP
FT                   STPSPVSPEINTNV"
FT   gene            complement(626844..627851)
FT                   /locus_tag="CpB0564"
FT   CDS_pept        complement(626844..627851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0564"
FT                   /product="GTP binding protein"
FT                   /note="similar to GTP binding proteins of the obg family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98494"
FT                   /db_xref="GOA:Q9Z808"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z808"
FT                   /protein_id="AAP98494.1"
FT                   /translation="MFVDQITLELRAGKGGNGVVAWRKEKYLPKGGPYGGNGGNGGSVI
FT                   IEATTSVYSFEAYRNIRFLKAPDGQSGATNNRTGRSGKDLIVSVPTGTLLRDAETGEIL
FT                   HDFTVDGERLLVSQGGKGGKGNTFFKTSVNRAPTKATPGKPGEIRQVELELKLIADIGL
FT                   VGFPNAGKSTLFNTLAHTEVKVGAYPFTTLAPSLGLVLCKDRLYQKPWIIADIPGIIEG
FT                   AHQNKGLGLDFLRHIERTLLLLFVIDVSKRERNSPEEDLETLIHELHSHQPDFEKKDML
FT                   VALNKIDDLLPDEQEECLQSFQKRFPSYTFVLISGLTGEGVDGLYRFFTQRLAV"
FT   gene            complement(627952..628206)
FT                   /locus_tag="CpB0566"
FT   CDS_pept        complement(627952..628206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0566"
FT                   /product="ribosomal protein L27"
FT                   /note="similar to ribosomal protein L27 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98495"
FT                   /db_xref="GOA:Q9Z807"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z807"
FT                   /protein_id="AAP98495.1"
FT                   /translation="MAHKKGQGASRNGRDSKSKRLGVKVGAGQKVSTGSILVRQRGTRW
FT                   NPAQNVGRGRDDTLFALVDGIVVMKKTNRTYISVVPEQL"
FT   gene            complement(628231..628554)
FT                   /locus_tag="CpB0567"
FT   CDS_pept        complement(628231..628554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0567"
FT                   /product="ribosomal protein L21"
FT                   /note="similar to ribosomal protein L21 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98496"
FT                   /db_xref="GOA:Q9Z806"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z806"
FT                   /protein_id="AAP98496.1"
FT                   /translation="MMEPYAVIQTGSKQYQVRSGDVIDVELLGEVASDKEVIFQDVLFV
FT                   FDGTKASLGSPTIANAQVKAEYLSHVKGEKVVAYKYKKRKNYHRKHGHRQKYLRVKIRE
FT                   ILI"
FT   gene            complement(628696..628768)
FT                   /locus_tag="CpBt16"
FT   tRNA            complement(628696..628768)
FT                   /locus_tag="CpBt16"
FT                   /product="tRNA-Phe"
FT                   /note="GAA"
FT   gene            628944..629513
FT                   /locus_tag="CpB0568"
FT   CDS_pept        628944..629513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0568"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT434 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98497"
FT                   /db_xref="GOA:Q9Z805"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z805"
FT                   /protein_id="AAP98497.1"
FT                   /translation="MKEILKKNIYQVVMDRDNEVPLPKPKWIYRTGIGQDSHRFLPESS
FT                   TKPCILGGIIFDHCPGFQANSDGDIIFHAICNAISSVTNKIILGKVADELLQTRGITDS
FT                   GIYLEEALKSLKPNQKISHVAITIEGSRPKFLCKLSALRQNIAQVMNLTPTDIGITATS
FT                   GEGLSDFGCGDGVQCFCVLTVMEYCD"
FT   gene            complement(629510..630553)
FT                   /locus_tag="CpB0569"
FT   CDS_pept        complement(629510..630553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0569"
FT                   /product="sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /note="similar to sulfite reductase [NADPH] flavoprotein
FT                   alpha-component - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98498"
FT                   /protein_id="AAP98498.1"
FT                   /translation="MYLQEKFKAQQVPLVLRELLSCSDSINDSDPIYRMVFDSNDTTIS
FT                   YKVGDALGVLPENSKEVSEHVLQLLGYSPTTLVNVKKTSEKVSAQKFIQGYVDLDKIPA
FT                   KLNSFFPDKDPKITLYDAIQEYRPQIPIELFAESVFPLLPRFYSIASSPDLHPKSIELL
FT                   VKHVSYPGKYQKRFGVCSSFLCSELQVNDSAYIFVQPTKHFTLSTQTEGKPLVMIGAGT
FT                   GIAPYKAFLEERLFNKDPGNNLLFFGERKEKVNFYYREFWNHAEEEGKLKLFLAFSRER
FT                   DQKVYVQDLLRIQKDEVRKAYEEGGFFFVCGRKVLGIEVKHALEEILGKDTLASLRKEH
FT                   RYVVDVY"
FT   gene            complement(630574..630912)
FT                   /locus_tag="CpB0570"
FT   CDS_pept        complement(630574..630912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0570"
FT                   /product="ribosomal protein S10"
FT                   /note="similar to ribosomal protein S10 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98499"
FT                   /db_xref="GOA:Q9Z803"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z803"
FT                   /protein_id="AAP98499.1"
FT                   /translation="MLRSKGCMKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARV
FT                   VGPIPLPTKREVYTVLRSPHVDKKSREQFEIRTHKRLVDILDPTGKTIDALKMLALPAG
FT                   VDIKIKAA"
FT   gene            complement(630899..632983)
FT                   /locus_tag="CpB0571"
FT   CDS_pept        complement(630899..632983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0571"
FT                   /product="translation elongation factor EF-G"
FT                   /note="similar to translation elongation factor EF-G
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98500"
FT                   /db_xref="GOA:Q9Z802"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z802"
FT                   /protein_id="AAP98500.1"
FT                   /translation="MSNQEFDLSAIRNIGIMAHIDAGKTTTTERILFYAGRTHKIGEVH
FT                   EGGATMDWMAQEQERGITITSAATTVFWLGAKINIIDTPGHVDFTIEVERSLRVLDGAV
FT                   AVFDAVSGVEPQSETVWRQADKYGVPRIAFVNKMDRMGADYFAAVESMKEKLGANAFPV
FT                   HCPIGSESQFVGMVDLISQKALYFLDDTLGAKWEEKEISEDLKERCAELRANLLEELAT
FT                   IDESNEAFMMKVLEDPDSITEDEIHQVMRKGVIENKINPVLCGTAFKNKGVQQLLNVIV
FT                   KWLPSPLDRGNIRGINLKTDQEISLEPRRDGPLAALAFKIMTDPYVGRITFIRIYSGTL
FT                   KKGSAILNSTKDKKERISRLLEMHANERTDRDEFTVGDIGACVGLKFSVTGDTLCDDNQ
FT                   EIVLERIEFPDPVIDMAIEPKSKGDREKLAQALSSLSEEDPTFRVSTNEETGQTIISGM
FT                   GELHLDILRDRMIREFKVEANVGKPQVSYKETITVSGNSETKYVKQSGGRGQYAHVCLE
FT                   IEPNEPGKGNEVVSKIVGGVIPKEYIPAVIKGIEEGLNTGVLAGYGLVDVKVSIVFGSY
FT                   HEVDSSEMAFKICGSMAVKDACRKAKPVILEPIMKVAVITPEDHLGDVIGDLNRRRGKI
FT                   LGQESSRGMAQVNAEVPLSEMFGYTTSLRSLTSGRATSTMEPAFFAKVPQKIQEEIVKK
FT                   "
FT   gene            complement(633017..633490)
FT                   /locus_tag="CpB0572"
FT   CDS_pept        complement(633017..633490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0572"
FT                   /product="ribosomal protein S7"
FT                   /note="similar to ribosomal protein S7 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98501"
FT                   /db_xref="GOA:Q9Z801"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z801"
FT                   /protein_id="AAP98501.1"
FT                   /translation="MSRRHSAEKRDIPGDPIYGSVILEKFINKVMMHGKKSVARKIVYS
FT                   ALERFGKKLNLENVLEGFGEALENAKPILEVRSRRVGGATYQVPVEVASERRNCLAMQW
FT                   IIKHARSKPGKSMEVGLATELIDCFNKQGATIKKREDTHRMAEANKAFAHYKW"
FT   gene            complement(633538..633909)
FT                   /locus_tag="CpB0573"
FT   CDS_pept        complement(633538..633909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0573"
FT                   /product="ribosomal protein S12"
FT                   /note="similar to ribosomal protein S12 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98502"
FT                   /db_xref="GOA:Q9Z800"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z800"
FT                   /protein_id="AAP98502.1"
FT                   /translation="MPTINQLIRKRRKSSLARKKSPALQKCPQKRGVCLQVKTKTPKKP
FT                   NSALRKVAWVRLSNGQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDC
FT                   AAVKNRKQSRSRYGAKRPK"
FT   gene            633969..634145
FT                   /locus_tag="CpB0575"
FT   CDS_pept        633969..634145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98503"
FT                   /protein_id="AAP98503.1"
FT                   /translation="MLARAYFQMKRERILLEFKKMLSFSRRTVFLLFKRNFSCNELILT
FT                   YLFGEKNFVLGFS"
FT   gene            complement(634131..635069)
FT                   /locus_tag="CpB0574"
FT   CDS_pept        complement(634131..635069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98504"
FT                   /protein_id="AAP98504.1"
FT                   /translation="MWRVVLRFLIIFILGRVVFPLRASESFSWETSTCLTVLGIPFIDI
FT                   ILTTNEDFVAQCGLQIGTISSTNNAKIKEIFLIYKEKFPEASISFKRKEPLNLSQSHLS
FT                   DLGILCMRNGETYAEGMANKENGPALKQPKDLRLVLRCPNQPDTLLYSEKEAEKGIETN
FT                   TCLCNQGYTLLDGQLILYGDSIEKFLKETKRKNNHTLVDLCDSQVVTTFLGRFWSLLNY
FT                   VQVLFLSEDSAKILAGIPDLAQATQLLSHTVPLLFIYTNDSIHIIEQGKESSFTYNQDL
FT                   TEPILGFLFGYINRGSMEYCFNCAQSSLGET"
FT   gene            635128..635466
FT                   /locus_tag="CpB0576"
FT   CDS_pept        635128..635466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0576"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT440 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98505"
FT                   /protein_id="AAP98505.1"
FT                   /translation="MFSYLLLCIILVYVRFMYEGKSRMASPTPGQLHLQQKVESKAYDY
FT                   SRSLAMIATALLFFIVALILSGLSLLPQVFLPFSGAYFIIGSFLAFIALGILLINCVCD
FT                   LKQYLTSS"
FT   gene            635629..637566
FT                   /locus_tag="CpB0577"
FT   CDS_pept        635629..637566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0577"
FT                   /product="carboxy-terminal proteinase precursor"
FT                   /note="similar to carboxy-terminal proteinase precursor -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98506"
FT                   /protein_id="AAP98506.1"
FT                   /translation="MKKLVRLCVVLLSLLPNVLFSSDLLREEGIKKMMDKLIEYHVDAQ
FT                   EVSTDILSRSLSSYIQSFDPHKSYLSNQEVAVFLQSPETKKRLLKNYKAGNFAIYRNIN
FT                   QLIHESILRARQWRNEWVKNPKELVLEASSYQISKQPMQWSKSLDEVKQRQRALLLSYL
FT                   SLHLAGASSSRYEGKEEQLAALCLRQIENHENVYLGINDHGVAMDRDEEAYQFHIRVVK
FT                   ALAHSLDAHTAYFSKDEALAMRIQLEKGMCGIGVVLKEDIDGVVVREIIPGGPAAKSGD
FT                   LQLGDIIYRVDGKDIEHLSFRGVLDCLRGGHGSTVVLDIHRGESDHTITLRREKILLED
FT                   RRVDVSYEPYGDGVIGKVTLHSFYEGENQVSSEQDLRRAIQGLKEKNLLGLVLDIRENT
FT                   GGFLSQAIKVSGLFMTNGVVVVSRYADGTMKCYRTVSPKKFYDGPLAILVSKSSASAAE
FT                   IVAQTLQDYGVALVVGDEQTYGKGTIQHQTITGDASQDDCFKVTVGKYYSPSGKSTQLQ
FT                   GVKSDILIPSLYAEDRLGERFLEHPLPADCCDNVLHDPLTDLDTQTRPWFQKYYLPNLQ
FT                   KQETLWREMLPQLTKNSEQRLSENSNFQAFLSQIKSSEKTDLSYGSNDLQLEESINILK
FT                   DMILLQQCRK"
FT   gene            complement(637644..638234)
FT                   /locus_tag="CpB0578"
FT   CDS_pept        complement(637644..638234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0578"
FT                   /product="sulfur-rich protein"
FT                   /note="similar to sulfur-rich protein - Chlamydia psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98507"
FT                   /db_xref="GOA:Q9Z7Z6"
FT                   /db_xref="InterPro:IPR008436"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z6"
FT                   /protein_id="AAP98507.1"
FT                   /translation="MSSNLHPVGGTGTGAAAPESVLNIVEEIAASGSVTAGLQAITSSP
FT                   GMVNLLIGWAKTKFIQPIRESKLFQSRACQITLLVLGILLVVAGLACMFIFHSQLGANA
FT                   FWLIIPAAIGLIKLLVTSLCFDEACTSEKLMVFQKWAGVLEDQLDDGILNNSNKIFGHV
FT                   KTEGNTSRATTPVLNDGRGTPVLSPLVSKIARV"
FT   gene            complement(638513..640183)
FT                   /locus_tag="CpB0579"
FT   CDS_pept        complement(638513..640183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0579"
FT                   /product="60K cysteine-rich outer membrane protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98508"
FT                   /db_xref="GOA:P23700"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR003506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23700"
FT                   /protein_id="AAP98508.1"
FT                   /translation="MSKLIRRVVTVLALTSMASCFASGGIEAAVAESLITKIVASAETK
FT                   PAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSV
FT                   KVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETT
FT                   PTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTAATVCACPELRSYTKCGQPAICI
FT                   KQEGPDCACLRCPVCYKIEVVNTGSAIARNVTVDNPVPDGYSHASGQRVLSFNLGDMRP
FT                   GDKKVFTVEFCPQRRGQITNVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCK
FT                   PVEYSISVSNPGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQF
FT                   KLVVKAQVPGRFINQVAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTNDPICVGEN
FT                   TVYRICVTNRGSAEDTNVSLILKFSKELQPIASSGPTKGTISGNTVVFDALPKLGSKES
FT                   VEFSVTLKGIAPGDARGEAILSSDTLTSPVSDTENTHVY"
FT   gene            complement(640350..640622)
FT                   /locus_tag="CpB0580"
FT   CDS_pept        complement(640350..640622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0580"
FT                   /product="9K cysteine-rich outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98509"
FT                   /db_xref="GOA:Q9Z7Z5"
FT                   /db_xref="InterPro:IPR003517"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z5"
FT                   /protein_id="AAP98509.1"
FT                   /translation="MKKAVLIAAMFCGVVSLSSCCRIVDCCFEDPCAPSSCNPCEVIRK
FT                   KERSCGGNACGSYVPSCSNPCGSTECNSQSPQVKGCTSPDGRCKQ"
FT   gene            641064..641252
FT                   /locus_tag="CpB0581"
FT   CDS_pept        641064..641252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0581"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT444.1 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98510"
FT                   /protein_id="AAP98510.1"
FT                   /translation="MKLFYFCNIIFLTSLFSVSCTHTPPPRSYILAQGRTPLVNKAHSL
FT                   EFFLARSVFNTCYNTNL"
FT   gene            complement(641417..642934)
FT                   /locus_tag="CpB0582"
FT   CDS_pept        complement(641417..642934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0582"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="similar to glutamyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98511"
FT                   /db_xref="GOA:Q9Z7Z3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z3"
FT                   /protein_id="AAP98511.1"
FT                   /translation="MNWENVRVRVAPSPTGDPHVGTAYMALFNEIFAKRFKGKMILRIE
FT                   DTDRTRSRQDYEENIFSALRWCGIQWDEGPDVGGPYGPYRQSERTKIYQGYVETLLKTD
FT                   CAYKCFATPQELAEMRAVASTLGYRGGYDRRYRYLSPEEVASREAAGQPYTIRLKVPLS
FT                   GECVFEDYSKGRVVFPWADVDDQVLVKSDGFPTYHFANVIDDHLMGITHVLRGEEWLSS
FT                   TPKHLLLYEAFGWEPPVFLHMPLLLNPDGTKLSKRKNPTSIFYYRDSGYVKEAFVNFLT
FT                   LMGYSMEGDEEVYSLERIIETFNPRRIGKSGAVFDIQKLDWMNKHYLNHEGSPECLLKE
FT                   LQGWLLNDEFFLKILPLCQSRITTLAEFINLTSFFFSGLLEYRVEELLPQALSPEKAAI
FT                   LLYSYVKYLEKTDQWTKETCYLGSKWLAQAFNVHHKKAIIPLLYVAITGKKQGLPLFDS
FT                   IEILGKPRARARLVYAEKLLGGVPKKLAATVDKFMQREDFEEATFDL"
FT   gene            complement(643190..643726)
FT                   /locus_tag="CpB0583"
FT   CDS_pept        complement(643190..643726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0583"
FT                   /product="early upstream orf EUO"
FT                   /note="similar to early upstream orf EUO - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98512"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Z2"
FT                   /protein_id="AAP98512.1"
FT                   /translation="MACEQHEGCYELEEREEIEDIKDSDTKWVSITQAAKLHNVTRQAI
FT                   YVAIKQKKLKASKETRWEIDIKDLEEYKRNRYSRKKSLYQGELVFDNGKGCYSINQVAQ
FT                   ILGIPVQKVYYATRTGTIRGERKGAAWVIHVSEIERYKNEYLSKQAAKKLKGAEPKEHQ
FT                   APNFEPPTEIFPESN"
FT   gene            complement(644237..645358)
FT                   /locus_tag="CpB0584"
FT   CDS_pept        complement(644237..645358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0584"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical 43.0K protein - Chlamydia
FT                   psittaci"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98513"
FT                   /protein_id="AAP98513.1"
FT                   /translation="MSIAIAREQYAAILDMHPKPSIAMFSSEQARTSWEKRQAHPYLYR
FT                   LLEIIWGVVKFLLGLIFFIPLGLFWVLQKICQNFILLGAGGWIFRPICRDSNLLRQAYA
FT                   ARLFSASFQDHVSSVRRVCLQYDEVFIDGLELRLPNAKPDRWMLISNGNSDCLEYRTVL
FT                   QGEKDWIFRIAEESQSNILIFNYPGVMKSQGNITRNNVVKSYQACVRYLRDEPAGPQAR
FT                   QIVAYGYSLGASVQAEALSKEIADGSDSVRWFVVKDRGARSTGAVAKQFIGSLGVWLAN
FT                   LTHWNINSEKRSKDLHCPELFIYGKDSQGNLIGDGLFKKETCFAAPFLDPKNLEECSGK
FT                   KIPVAQTGLRHDHILSDDVIKEVAGHIQRHFDN"
FT   gene            complement(645612..647378)
FT                   /gene="recJ"
FT                   /locus_tag="CpB0585"
FT   CDS_pept        complement(645612..647378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="CpB0585"
FT                   /product="ssDNA-specific exonuclease"
FT                   /note="similar to ssDNA-specific exonuclease recJ -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98514"
FT                   /protein_id="AAP98514.1"
FT                   /translation="MTNSDNASAAGLLWAHPKEDPAFLGMIIKEFHLPPTVAQIFISRG
FT                   FQTIQEIHKFLYSHLSSLYDPGLFLDMSKAVERLLLARDRKEHVMIYGDSDVDGMTGVA
FT                   LLVEFLRDIDVHVSYFFLGAILKQHGETSTLIAKLKEEGITLLITVDCGITAGKEVSDI
FT                   TRQGIDVIITDHHMPTGKIPHCVATLNPKLRDHTYPNRELTGVGVAFKLARGVLNALIS
FT                   RNLVPKSQGSLKKLLDLVTLGTITDVGVLLGENRVMVRYGIKEIARGARPGLNKLCALC
FT                   GVEKSEVTSTDIVLKIAPKLNSLGRLDDPAKGVELLLTQDDERVDALIMELDNINRERQ
FT                   RIEAEVFQDVQEILNSNPEILKQAAIVLSSTAWHARVIPIISARLAKTYNKPVVIIAIQ
FT                   RGIGKGSARTIGSFPLLGVLKKCSSLLLSYGGHDFAAGVIMKEDKVEDFKKKFVHLVNS
FT                   SLKKGDTLPHLEIDAYADFDAIDYDLLASMELFEPFGKGNLMPIFYSKVRQVRYPKVLP
FT                   GNHLKLYLSQKERNLEGVAFGLGRHADALKASWHYPLEIAYTPRLSQTSGSGVIHLLVR
FT                   DFRISSEPRFSD"
FT   gene            complement(647464..651672)
FT                   /locus_tag="CpB0586"
FT   CDS_pept        complement(647464..651672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0586"
FT                   /product="SecDF"
FT                   /note="similar to SecDF - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98515"
FT                   /protein_id="AAP98515.1"
FT                   /translation="MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEH
FT                   IIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQHPAIPDIVSVRFKRGEDAEDFIGN
FT                   LVHGEPNVPIKSARLHVVGYSREHDDHVIQVASSINTSLVESDFSFVSYSSENEQEMAS
FT                   SILQRVYSACTFPKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLSAFCQQS
FT                   FSSNQDRLAFLSRLSSLSNDAAIDVEDQKLLKSVYETLSQTACIRSLDCPYIEGLRLDC
FT                   SESSLFFSSIEYCPKERKIFLTLHSDLLAQRTSLSKEQRLDFDSRLAVEKQKLSKNLTV
FT                   QVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFPV
FT                   FCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDL
FT                   QNLYNCFSHTEAISWTLGEDQVLEIRHPLQQFLDVWGEGFVIGKEGCAFLEVKDIQDRL
FT                   ATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPYQNLFLENMKLNMRKFSRGE
FT                   NILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGD
FT                   YIHLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKT
FT                   SPEEINTFASALFNEEVDVPPSVHEAITKLKSEGLAFSPSGCETPSTDLDTTFSMIAIG
FT                   KDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSVKDTSPKKMAEKLSPTE
FT                   SFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFT
FT                   HREVSKLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYY
FT                   RFGGVIASGAVLLNLLLIWAALQYLDAPLTLSGLAGIVLAMGMAVDANVLVFERIREEF
FT                   LLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFALTLILGIFSSMF
FT                   TALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGF
FT                   GAWNSVLGMDFKGGYAFTFNPKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSE
FT                   KIKIYFSDKALSYTKADTSLSPKINDHELALAVGLLSETGLDFSTETLNETQNFWSKVS
FT                   SKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLATCAVLFIAHFF
FT                   LKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRT
FT                   VMTTATTLSVLLMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK
FT                   "
FT   gene            complement(651852..652952)
FT                   /locus_tag="CpB0587"
FT   CDS_pept        complement(651852..652952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0587"
FT                   /product="sensory transduction regulatory protein"
FT                   /note="similar to sensory transduction regulatory protein -
FT                   Methanobacterium thermoautotrophicum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98516"
FT                   /protein_id="AAP98516.1"
FT                   /translation="MKFPRISISDLIPTQMVIWWRGGGNVHYVPNAQNLPKKILGGVLA
FT                   CFGLALLGCAAFAAGVCQTIFPCIGLMILGLVLLGFAYLQYSKGWSRFERPLFRETKVF
FT                   EKPINWLGCLSLLQSWKKIRPGCYYHPGCPQVEICEGSQEIVTKIFQKKSDRNTSIFLI
FT                   QEMDQIALRQGIEKSSLSRKTFAIDPSVVSSLLSEIQREEQQYLDPKVISWSSEDQASD
FT                   RTHPKSAIYVNISDAAQEPQGRCYIDAYTKAFFTVLDQIGDPNIVKKHTIYVLTPILGV
FT                   PDALPKEEQENLKLLSQAAFLYSAEQVAKRMREEKQDSIRIKFIFTDPTSPTSLYFSPH
FT                   HSSTPHSVTPISLSGFVGEQESYTFA"
FT   gene            653463..654215
FT                   /locus_tag="CpB0588"
FT   CDS_pept        653463..654215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0588"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT450 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98517"
FT                   /db_xref="GOA:Q9Z7Y7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y7"
FT                   /protein_id="AAP98517.1"
FT                   /translation="MSLATNNAESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHT
FT                   SGHYYGAKVLPNILNAVLDLGIKVLTLYTFSTENFGRPKEEIQEIFNIFYTQLDKQLPY
FT                   LMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGKDELVRAFKKL
FT                   HVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYIT
FT                   DTLWPDFTPQDLFEAINVYQQRSRRGGK"
FT   gene            654216..655142
FT                   /locus_tag="CpB0589"
FT   CDS_pept        654216..655142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0589"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="similar to phosphatidate cytidylyltransferase -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98518"
FT                   /db_xref="GOA:Q9Z7Y6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y6"
FT                   /protein_id="AAP98518.1"
FT                   /translation="MLNSNKFKSKTGAYGDLFQRVVVHSLVLTFLVLLLYSSLFPLTSF
FT                   ALGFITATCGAVGTYEYSSMAKAKMHYPLSTFSAIGSFLFLALSFLSIRWGHSLPGFFD
FT                   ALPWTLLIVWVVWSIFRVRKSTIGALQLSGVTLFSILYVGIPIRLFLHVLYSFIHTQEP
FT                   YLGIWWASFLIATTKGADIFGYFFGKAFGNKKIAPQISPNKTVVGFVAGCLGATLISFI
FT                   FFLQIPTRFASYFPMPAILIPLGLALGITGFFGDIIESIFKRDAHLKNSNKLKAVGGML
FT                   DTLDSLLLSTPIAYLFLLITQSKEFIG"
FT   gene            655139..655789
FT                   /locus_tag="CpB0590"
FT   CDS_pept        655139..655789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0590"
FT                   /product="cytidylate kinase"
FT                   /note="similar to cytidylate kinase - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98519"
FT                   /db_xref="GOA:Q9Z7Y5"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y5"
FT                   /protein_id="AAP98519.1"
FT                   /translation="MIITIDGPSGTGKSTTAKALADHLHFNYCNTGKMYRTLAYARLQS
FT                   PWATLPLTKFLEEPPFSFTFATGQPLESFFNGHLLTSELTTQEVANAASELSQLPEVRA
FT                   FMQDLQRRYAQLGNCVFEGRDMGSKVFPNADLKIFLTSSPEVRAQRRLKDLPEGTLSPE
FT                   QLQAELVKRDAADAQRAHDPLVIPENGIVIDSSDLTIRQVLEKILALLFRNEL"
FT   gene            655786..656424
FT                   /locus_tag="CpB0591"
FT   CDS_pept        655786..656424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0591"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /note="similar to glycerol-3-phosphate acyltransferase -
FT                   Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98520"
FT                   /protein_id="AAP98520.1"
FT                   /translation="MIFRICKFFTWVAFSLFYKLKVYGVKKNFIKGPAIIAVNHNSFLD
FT                   PIALHMCVHECIYHLARASLFNIPWLWKQWGCFPVRQDEGNSAAFKIASRLFNKRKKLV
FT                   IYPEGARSPDGQLQPGKVGIGMMAAKSRVPIIPVYIRGTFEAFNRHQKIPHVWKTITCV
FT                   FGTPMYFDDIIQNPEIKNKETYQIITNQTMNKIAELKAWYESGCKGDVP"
FT   gene            656429..658114
FT                   /locus_tag="CpB0593"
FT   CDS_pept        656429..658114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0593"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="similar to arginyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98521"
FT                   /db_xref="GOA:Q9Z7Y3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y3"
FT                   /protein_id="AAP98521.1"
FT                   /translation="MSTLLSILSVICSQAIAKAFPNLEDWAPEITPSTKEHFGHYQCND
FT                   AMKLARVLKKAPRAIAEAIVAELPQEPFSLIEIAGAGFINFTFSPVFLNQQLEHFKDAL
FT                   KLGFQVSQPKKIIIDFSSPNIAKDMHVGHLRSTIIGDSLARIFSYVGHDVLRLNHIGDW
FT                   GTAFGMLITYLQENPCDYSDLEDLTSLYKKAYVCFTNDEEFKKRSQQNVVALQAKDPQA
FT                   IAIWEKICETSEKAFQKIYDILDIVVEKRGESFYNPFLPEIIEDLEKKGLLTVSNDAKC
FT                   VFHEAFSIPFMVQKSDGGYNYATTDLAAMRYRIEEDHADKIIIVTDLGQSLHFQLLEAT
FT                   AIAAGYLQPGIFSHVGFGLVLDPQGKKLKTRSGENVKLRELLDTAIEKAEEALREHRPE
FT                   LTDEAIQERAPVIGINAIKYSDLSSHRTSDYVFSFEKMLRFEGNTAMFLLYAYVRIQGI
FT                   KRRLGISQLSLEGPPEIQEPAEELLALTLLRFPEALESTIKELCPHFLTDYLYNLTHKF
FT                   NGFFRDSHIQDSPYAKSRLFLCALAEQVLATGMHLLGLKTLERL"
FT   gene            complement(658068..659444)
FT                   /locus_tag="CpB0592"
FT   CDS_pept        complement(658068..659444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0592"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyl-transferase"
FT                   /note="similar to UDP-N-acetylglucosamine
FT                   1-carboxyvinyl-transferase from RT - Acinetobacter
FT                   calcoaceticus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98522"
FT                   /db_xref="GOA:Q9Z7Y2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y2"
FT                   /protein_id="AAP98522.1"
FT                   /translation="MQIAQVFGCGRLNGEVKVSGAKNAATKLLVASLLSDQKCTLRNVP
FT                   DIGDVSLTVELCKSLGAHVSWDKETEVLEIYTPEIQCTRVPPTFSNVNRIPILLLGALL
FT                   GRCPEGVYVPTVGGDAIGERTLNFHFEGLKQLGVQISSDSSGYYAKAPRGLKGNYIHLP
FT                   YPSVGATENLILAAIHAKGRTVIKNVALEAEILDLVLFLQKAGADITTDNDRTIDIFGT
FT                   GGLGSVDHTILPDKIEAASFGMAAVVSGGRVFVRNAKQELLIPFLKMLRSIGGGFLVSE
FT                   SGIEFFQERPLVGGVVLETDVHPGFLTDWQQPFAVLLSQAQGSSVIHETVHENRLGYLH
FT                   GLQHMGAECQLFHQCLSTKACRYAIGNFPHSAVIHGATPLWASHLVIPDLRAGFAYVMA
FT                   ALIAEGGGSIIENTHLLDRGYTNWVGKLRSLGAKIQIFDMEQEELTTSPKSLALRDASL
FT                   "
FT   gene            659674..661941
FT                   /locus_tag="CpB0594"
FT   CDS_pept        659674..661941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0594"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT456 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y1"
FT                   /protein_id="AAP98523.1"
FT                   /translation="MAAPINQPSTTTQITQTGQTTTTTTVGSLGEHSVTTTGSGAAAQT
FT                   SQTVTLIADHEMQEIASQDGSAVSFSAEHSFSTLPPETGSVGATAQSAQSAGLFSLSGR
FT                   TQRRDSEISSSSDGSSISRTSSNASSGETSRAESSPDLGDLDSLSGSERAEGAEGPEGP
FT                   GGLPESTIPHYDPTDKASILNFLKNPAVQQKMQTKGGHFVYVDEARSSFIFVRNGDWST
FT                   AESIKVSNAKTKENITKPADLEMCIAKFCVGYETIHSDWTGRVKPTMEERSGATGNYNH
FT                   LMLSMKFKTAVVYGPWNAKESSSGYTPSAWRRGAKVETGPIWDDVGGLKGINWKTTPAP
FT                   DFSFINETPGGGAHSTSHTGPGTPVGATVVPNVNVNLGGIKVDLGGINLGGITTNVTTE
FT                   EGGGTNITSTKSTSTDDKVSITSTGSQSTIEEDTIQFDDPGQGEDDNAIPGTNTPPPPG
FT                   PPPNLSSSRLLTISNASLNQVLQNVRQHLNTAYDSNGNSVSDLNQDLGQVVKNSENGVN
FT                   FPTVILPKTTGDTDPSGQATGGVTEGGGHIRNIIQRNTQSTGQSEGATPTPQPTIAKIV
FT                   TSLRKANVSSSSVLPQPQVATTITPQARTASTSTTSIGTGTESTSTTSTGTGTGSVSTQ
FT                   STGVGTPTTTTRSTGTSATTTTSSASTQTPQAPLPSGTRHVATISLVRNAAGRSIVLQQ
FT                   GGRSQSFPIPPSGTGTQNMGAQLWAAASQVASTLGQVVNQAATAGSQPSSRRSSPTSPR
FT                   RK"
FT   gene            complement(662010..662726)
FT                   /locus_tag="CpB0595"
FT   CDS_pept        complement(662010..662726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0595"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT457 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98524"
FT                   /db_xref="GOA:Q9Z7Y0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Y0"
FT                   /protein_id="AAP98524.1"
FT                   /translation="MAGHSKWANTKHRKERADHKKGKIFSRIIKELISAVKLGGADPKS
FT                   NARLRMVIQKAKENNIPNENIERNLKKATSAEQKNFEEVTYELYGHGGVGIIVEAMTDN
FT                   KNRTASDMRIAINKRGGSLVEPGSVLYNFARKGACTVAKSSIDEEVIFSYAIEAGAEDL
FT                   DTEDEENFLVICAPSELASVKEKLISQGATCSEDRLIYLPLRLVDCDEKDGEANLALID
FT                   WLEQIEDVDDVYHNMS"
FT   gene            complement(662713..663267)
FT                   /locus_tag="CpB0596"
FT   CDS_pept        complement(662713..663267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98525"
FT                   /protein_id="AAP98525.1"
FT                   /translation="MVETVLHNFQRYLSKYLYRVFRFPCRKKTFLSSHRVLARPSFPVD
FT                   YCPGKIYDLQEIYEELNAQLFQGALRLQIGWFGRKATRKGKSVVLGLFHENEQLIRIHR
FT                   SLDRQEIPRFFMEYLVYHEMVHSVVPREYSLSGRSIFHGKKFKEYEQRFPLYDRAVAWE
FT                   KANAYLLRGYKKRVGGGYGRA"
FT   gene            complement(663301..663816)
FT                   /gene="bltD"
FT                   /locus_tag="CpB0597"
FT   CDS_pept        complement(663301..663816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bltD"
FT                   /locus_tag="CpB0597"
FT                   /product="spermine/spermidine acetyltransferase"
FT                   /note="similar to spermine/spermidine acetyltransferase
FT                   bltD - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98526"
FT                   /protein_id="AAP98526.1"
FT                   /translation="MTAEKQNTGILGLEIRYTLPSDATYMLKWLNDPKILRGFPIQTEA
FT                   EIRETVNFWVGFYRYHSSLTAVYNGNVAGVATLVLNPYVKVSHHALISIIVGEEFRNKG
FT                   IGTALLNNLIHLAKTRFKLEVLYLEVYEGNPALHLYQRFGFVEVGRQNRFYKDEIGYLA
FT                   KTTMEKDL"
FT   gene            complement(663813..664574)
FT                   /locus_tag="CpB0598"
FT   CDS_pept        complement(663813..664574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0598"
FT                   /product="translation releasing factor RF-2"
FT                   /note="similar to translation releasing factor RF-2 -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98527"
FT                   /db_xref="GOA:P56906"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56906"
FT                   /protein_id="AAP98527.1"
FT                   /translation="MLSGEADKNSCFLTINAGAGGTESCDWVEMLFRMYSRWATKHQWA
FT                   LEVVDRLDGEVVGIKHVTVKFSGMYAYGYAKAERGVHRLVRISPFDSNGKRHTSFASVD
FT                   VFPEIDDQIKIEIRPNDLRIDTFRSSGAGGQHVNVTESAVRITHLPSGVVVSCQNERSQ
FT                   IQNRESCMKMLQAKLYQQVLQERLEKQSLDRKDKKEIAWGSQIRNYVFQPYTLVKDVRT
FT                   GHETGNVQAMLDGELLDEFIKAYLAEFGEVS"
FT   gene            664821..665000
FT                   /locus_tag="CpB0599"
FT   CDS_pept        664821..665000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0599"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein - Synechocystis sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98528"
FT                   /protein_id="AAP98528.1"
FT                   /translation="MKFFLFFIEVKETSQLKIFPCEVLPNACLNFPALLLPTYDSNQDS
FT                   RKQKPIKSIRARTS"
FT   gene            complement(665062..665217)
FT                   /locus_tag="CpB0600"
FT   CDS_pept        complement(665062..665217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0600"
FT                   /product="histone H3"
FT                   /note="similar to histone H3 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98529"
FT                   /protein_id="AAP98529.1"
FT                   /translation="MVTPSKGGKKRPELFIPTFLSLREVSRQNKKVEFSLPFLFRKRQG
FT                   ESLEKI"
FT   gene            665217..665480
FT                   /locus_tag="CpB0601"
FT   CDS_pept        665217..665480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0601"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT460 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98530"
FT                   /protein_id="AAP98530.1"
FT                   /translation="MSQKNKNSAFMHPVNISTDLAVIVGKGPMPRTEIVKKVWEYIKKH
FT                   NCQDQKNKRNILPDANLAKVFGSSDPIDMFQMTKALSKHIVK"
FT   gene            665728..666690
FT                   /gene="yaeI"
FT                   /locus_tag="CpB0602"
FT   CDS_pept        665728..666690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="CpB0602"
FT                   /product="putative phosphoesterase"
FT                   /note="similar to probable phosphoesterase yaeI -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98531"
FT                   /db_xref="GOA:Q9Z7X6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X6"
FT                   /protein_id="AAP98531.1"
FT                   /translation="MLISISLATLPILAFSWASFIEPNWLRTTAIPWRLPKKHAHLHGL
FT                   RIAQISDLHFHKRVPEKFLNKVSKSIKNFSPDLIVFCGDLLCRARLEDKERLETFLNTL
FT                   EAPLGVFAILGNHDYSSYISRNTKGEITCIPEEKSRPIQRAIIAVMQGLFSSPSYRYDP
FT                   NLTPQEPHPDLLKLLKNTPLTLLHNTTHVIPNTLNIVGLGDLFARQFHPEQAFKNYDPS
FT                   LPGLLLSHNPDGITRLQQYPGDFVLSGHSHGPQVTLSWPKFARKFFERLSGLENPYLAR
FT                   GYFVTKEGKQLYVNRGLGGLKRIRFCSPPEICYITCSYD"
FT   gene            666683..667318
FT                   /locus_tag="CpB0603"
FT   CDS_pept        666683..667318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0603"
FT                   /product="CDP-ribitol pyrophosphorylase"
FT                   /note="similar to CDP-ribitol pyrophosphorylase -
FT                   Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98532"
FT                   /db_xref="GOA:Q9Z7X5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X5"
FT                   /protein_id="AAP98532.1"
FT                   /translation="MIKSSLILLSGGQGTRFGSKIPKQYLPLNGTPLVLHSLKILSSLP
FT                   QIAEVIVVCDPSYQETFQEYPVSFAIPGERRQDSVFSGLQQVSYPWVIIHDGARPFIYP
FT                   DEIHDLLETAEKIGATALASPIPYTIKQRNPVRTLDRDNLAIIHTPQCIKTEILREGLA
FT                   LAKEKQLTLVDDIEAAEIIGKPSQLVFNKHPQIKISYPEDLTIAQALL"
FT   gene            667315..668118
FT                   /gene="truA"
FT                   /locus_tag="CpB0605"
FT   CDS_pept        667315..668118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CpB0605"
FT                   /product="pseudouridylate synthase I"
FT                   /note="similar to pseudouridylate synthase I truA -
FT                   Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98533"
FT                   /db_xref="GOA:Q9Z7X4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7X4"
FT                   /protein_id="AAP98533.1"
FT                   /translation="MTKVALLIAYQGTAYSGWQQQPNDLSIQEVIESSLKKITKTRTPL
FT                   IASGRTDAGVHAYGQVAHFRAPDHPLFANANLTKKALNAILPKDIVIRDVALFDDNFHA
FT                   RYLAIAKEYRYSLSRLAKPLPWQRHFCYTPRHPFSTELMQEGANLLIGTHDFASFANHG
FT                   RDYNSTVRTIYTLDIVDKGDSLSIICRGNGFLYKMVRNLVGALLDVGKGAYPPEHLLDI
FT                   LEQKNRREGPSAAPAYGLSLHHVCYSSPYNNFCCEQCSVSTSNEG"
FT   gene            complement(668064..668756)
FT                   /locus_tag="CpB0604"
FT   CDS_pept        complement(668064..668756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0604"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /note="similar to probable phosphoglycolate phosphatase -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98534"
FT                   /protein_id="AAP98534.1"
FT                   /translation="MYLEDYDVFFFDLDGLLVDTEPCFYRAFLQACAEFSLEVHWDFST
FT                   YYSHTTLGTEIFSKKFIEQYPQAQEYMAEIFAKRLQIYYKSLEHAGPALMPGVEAFIEL
FT                   VLSLNKTFGVVTNSPRDATHTLRTMYPILNKFLFWVTRENYARPKPYGDSYDYAYRTFA
FT                   REGMKVIGFEDSVKGLRALSKIPATLVCINSMAEITPEDYPELKGKEFFSYPSFDVLTE
FT                   HCSQQKLL"
FT   gene            668825..669502
FT                   /locus_tag="CpB0606"
FT   CDS_pept        668825..669502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0606"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT465 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98535"
FT                   /protein_id="AAP98535.1"
FT                   /translation="MILRISTVSLLTSCSFSKNSRTCFVTPERITSQKDCPVLLHPKST
FT                   TISPPLYDWIPPNREVITAYSFYCRGQGNSIITPEGVLYDCDGLHHSITKEEFRYIHPR
FT                   LIEVVRLLQQDHPKVSIIEAFCCPKHFHFLEASGISLSQLHLQGTAATFALDPPLPMEK
FT                   LLATIKKLYKKNSDPSLSNFIVTEATLTNPELRLTQQDLGSHTEITVEILDNLQNKETL
FT                   SSA"
FT   gene            669559..669641
FT                   /locus_tag="CpBt17"
FT   tRNA            669559..669641
FT                   /locus_tag="CpBt17"
FT                   /product="tRNA-Leu"
FT                   /note="CAA"
FT   gene            669740..670042
FT                   /locus_tag="CpB0607"
FT   CDS_pept        669740..670042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0607"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT466 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98536"
FT                   /protein_id="AAP98536.1"
FT                   /translation="MLLLKKKKGLFLAILDLTQTESSLTTPELEKVLKQKKIFLSCIDR
FT                   VDLQIKEFRHAFSSELPQDIQEELEEIRDVIIRILDTDKRNYAQKKKEFGIYERP"
FT   gene            670029..671123
FT                   /gene="atoS"
FT                   /locus_tag="CpB0608"
FT   CDS_pept        670029..671123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoS"
FT                   /locus_tag="CpB0608"
FT                   /product="AtoS"
FT                   /note="sensor protein; similar to sensor protein AtoS -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98537"
FT                   /protein_id="AAP98537.1"
FT                   /translation="MNVPDSKNLHPPAYELLEIKARITQSYKEASAILTAIPDGILLLS
FT                   ETGHFLICNSQAREILGIDENLEILNRSFTDVLPDTCLGFSIQEALESLKVPKTLRLSL
FT                   CKESKEKEVELFIRKNEISGYLFIQIRDRSDYKQLENAIERYKNIAELGKMTATLAHEI
FT                   RNPLSGIVGFASILKKEISSPRHQRMLSSIISGTRSLNNLVSSMLEYTKSQPLNLKIIN
FT                   LQDFFSSLIPLLSVSFPNCKFVREGAQPLFRSIDPDRMNSVVWNLVKNAVETGNSPITL
FT                   TLHTSGDISVTNPGTIPSEIMDKLFTPFFTTKREGNGLGLAEAQKIIRLHGGDIQLKTS
FT                   DSAVSFFIIIPELLAALPKERAAS"
FT   gene            complement(671184..673028)
FT                   /locus_tag="CpB0609"
FT   CDS_pept        complement(671184..673028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98538"
FT                   /protein_id="AAP98538.1"
FT                   /translation="MAIARVQQCGWNHTIVKVSLIILALLTILGGGLLVGLLPAVPMFI
FT                   GTGLIALGAVIFALALILCLYDSQGLPEELPPVPEPQQIQIEDLRNETREVLEGTLLEV
FT                   LLKDRDAKDPAVPQVVVDCEKRLGMLDRKLRREEEILYRSTAHLKDEERYEFLLELLEM
FT                   RSLVADRLEFNRRSYERFVQGIMTVRSEEGEKEISRLQDLISLQQQTVQDLRSRIDDEQ
FT                   KRCWTALQRINQSQKDIQRAHDREASQRACEGTEMDCAERQQLEKDLRRQLKSMQEWIE
FT                   MRGTIHQQEKAWRKQNAKLERLQEDLRLTGIAFDEQSLFYREYKEKYLSQKLDMQKILQ
FT                   EVNAEKSEKACLESLVHDYEKQLEQKDANLKKAAAVWEEELGKQQQEDYEQTQEIRRLS
FT                   TFILEYQDSLREAEKVEKDFQELQQRYSRLQEEKQVKEKILEESMNHFADLFEKAQKEN
FT                   MAYKKKLADLEGAAAPTEIGEDDDWVLTDSASLSQKKIRELVEENQELLKALAFKSNEL
FT                   TQLVADAVEAEKEISKLREHIEEQKEGLRALDKMHAQAIKDCEAAQRKCCDLESLLSPV
FT                   REDAGMRFELEVELQRLQEENAQLRAEVERLEQEQFQG"
FT   gene            673324..674508
FT                   /gene="atoC"
FT                   /locus_tag="CpB0610"
FT   CDS_pept        673324..674508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoC"
FT                   /locus_tag="CpB0610"
FT                   /product="acetate metabolism regulatory protein"
FT                   /note="similar to acetate metabolism regulatory protein
FT                   atoC - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98539"
FT                   /protein_id="AAP98539.1"
FT                   /translation="MNPSRGENMAIKNILVVDDEPLLRDFLSELLTSQGFIPDTAENLR
FT                   NALQMIRSRDYDLVISDMSMPDGSGLDLIKIIKQSSPHTPVLVVTAYGSIENAVEAMHQ
FT                   GAFNYLTKPFSSEALFAFISKAEELKNLVHENLFLHSQTTPDSHPLIAESKAMKDLLAI
FT                   AKKAASSSANIFIHGESGCGKEVLSFFIHHNSPRANHPYIKVNCAAIPETLLESELFGH
FT                   EKGAFTGATTKKAGRFELAHKGTLLLDEITEVPVNLQAKLLRAIQEKEIEHLGGTKTLS
FT                   VDVRILATSNRKLKEAIDDKSFRQDLYYRLNVIPLHLPPLRDRQDDILPLANYFLNKFC
FT                   RMNNTPLKTLSPKAQELLLNYPWPGNIRELSNVLERVVILENTSLLTEDMLALA"
FT   gene            674587..674660
FT                   /locus_tag="CpBt18"
FT   tRNA            674587..674660
FT                   /locus_tag="CpBt18"
FT                   /product="tRNA-Arg"
FT                   /note="TCG"
FT   gene            674763..675449
FT                   /locus_tag="CpB0611"
FT   CDS_pept        674763..675449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0611"
FT                   /product="ribosomal protein S30AE"
FT                   /note="similar to ribosomal protein S30AE family homolog
FT                   yvyD - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98540"
FT                   /protein_id="AAP98540.1"
FT                   /translation="MRPHRKHVSSKSLALKQSASTHVEITTKAFRLSMPLKQLILEKSD
FT                   HLPPMETIRVVLTSHKDKLGTEVHVVASHGKEILQTKVHNANPYTAVINAFKKIRTMAN
FT                   KHSNKRKDRTKHDLGLAAKEERIAIQEEQEDRLSNEWLPVEGLDAWDSLKTLGYVPASA
FT                   KKKISKKKMSIRMLSQDEAIRQLESAAENFLIFLNEQEHKIQCIYKKHDGNYVLIEPSL
FT                   KPGFCI"
FT   gene            675394..675951
FT                   /locus_tag="CpB0612"
FT   CDS_pept        675394..675951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0612"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT469 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98541"
FT                   /protein_id="AAP98541.1"
FT                   /translation="MTATMSLLNLPSSQDSASEDSTSQSQIFDPIRNRELVSTPEEKVR
FT                   QRLLSFLMHKLNYPKKLIIIEKELKTLFPLLMRKGTLIPKRRPDILIITPPTYTDAQGN
FT                   THNLGDPKPLLLIECKALAVNQNALKQLLSYNYSIGATCIAMAGKHSQVSALFNPKTQT
FT                   LDFYPGLPEYSQLLNYFISLNL"
FT   gene            675962..676720
FT                   /locus_tag="CpB0613"
FT   CDS_pept        675962..676720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0613"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT470 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98542"
FT                   /db_xref="GOA:Q9Z7W5"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W5"
FT                   /protein_id="AAP98542.1"
FT                   /translation="MQICVTGVVLRSRPLGKNHTLTTLFTPEGLFTFFAKQGQTLQCDY
FT                   RETLVPISLGKYTLHRNGSRLPKLTHGDILNAFEAIKQTYALLEASGKMIQALLASQWK
FT                   EKPSHKLFSLFLNFLHRIPESSNPEFFAAIFVLKLLQYEGILDLTPACSLCKASLPYAC
FT                   YRYQGHKLCKKHQHKQAISIEKEEEQILQAIIHAKQFSELLAIAEFPIAIAEKIFYLFD
FT                   SLQEEKKSERNSSEDPYHEILRLSKVVHPY"
FT   gene            complement(676835..677434)
FT                   /locus_tag="CpB0614"
FT   CDS_pept        complement(676835..677434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0614"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT471 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98543"
FT                   /protein_id="AAP98543.1"
FT                   /translation="MGFACRYLFFFIVLFASGSFGNQLLSVPCWLSEEESFYTHRFDFS
FT                   KSYPDMENMEIQAQRKKRVEFNLTGEFPKLETLNYQGSFGHLRAKCRGVYPVLYALNFS
FT                   CSSCKMDMDFRGKWNRSSTITISNQKESINLKLPKDVGVIVNTKTSLKGNVCPGSTFIK
FT                   QGWGVWNKIYHNDLVGFSEVTLIFNVSSEGGTITFS"
FT   gene            complement(677501..677582)
FT                   /locus_tag="CpBt19"
FT   tRNA            complement(677501..677582)
FT                   /locus_tag="CpBt19"
FT                   /product="tRNA-Leu"
FT                   /note="GAG"
FT   gene            677695..678345
FT                   /locus_tag="CpB0615"
FT   CDS_pept        677695..678345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0615"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT472 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98544"
FT                   /protein_id="AAP98544.1"
FT                   /translation="MRCTAYCTASAYNLHVLFHLLKPRYPTILSREYVLANLDSTQASN
FT                   QLAIFFPFGVAVFWGWEESEEIKLLQTIVTASPEILPQPEIDCYNFHYGDKLQIRRDRL
FT                   TLADTTLNTKLAIAFGLAQSVKLTTFETTIYKTIEDSKRLPQDLATKGKISMSRKAIAK
FT                   KIGKLFLDKASVNLHSDILDEPDFFWDHPETQAIYRDVLSCLDIEARINVLIV"
FT   gene            678475..678786
FT                   /gene="hlyA"
FT                   /locus_tag="CpB0617"
FT   CDS_pept        678475..678786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyA"
FT                   /locus_tag="CpB0617"
FT                   /product="alpha-hemolysin"
FT                   /note="similar to alpha-hemolysin hlyA - Aeromonas
FT                   hydrophila"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98545"
FT                   /db_xref="GOA:Q9Z7W2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W2"
FT                   /protein_id="AAP98545.1"
FT                   /translation="MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAE
FT                   QALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPKTALQEVLEPYQEIDGGDSSHFSE"
FT   gene            complement(678710..679798)
FT                   /locus_tag="CpB0616"
FT   CDS_pept        complement(678710..679798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0616"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT474 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98546"
FT                   /db_xref="GOA:Q9Z7W1"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W1"
FT                   /protein_id="AAP98546.1"
FT                   /translation="MAFKRKTRWLWQVLILSVGLNMLFLLLFYSAIFRKDIYKLHLFSG
FT                   PLIAKSSRKVYLSEDFLNEISQASLDDLISLFKDERYMYGRPIKLWALSVAIASHHIDI
FT                   TPVLSKPLTYTELKGSSVRWLLPNIDLKDFPVILDYLRCHKYPYTSKGLFLLIEKMVQE
FT                   GWVDEDCLYHFCSTPEFLYLRTLLVGADVQASSVASLARMVIRCGSERFFHFCNEESRT
FT                   SMISATQRQKVLKSYLDCEESLAALLLLVHDSDVVLHEFCDEDLEKVIRLMPQESPYSQ
FT                   NFFSRLQHSPRRELACMSTQRVEAPRVQEDQDEEYVVQDGDSLWLIAKRFGIPMDKIIQ
FT                   KNGLNHHRLFPGKVLKLPAKQS"
FT   gene            679905..682283
FT                   /locus_tag="CpB0618"
FT   CDS_pept        679905..682283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0618"
FT                   /product="phenylalanyl-tRNA beta chain"
FT                   /note="similar to phenylalanyl-tRNA synthetase family, beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98547"
FT                   /db_xref="GOA:Q9Z7W0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7W0"
FT                   /protein_id="AAP98547.1"
FT                   /translation="MRIPITLLQTYFSEPLSTKEILEACDHIGIEAEIENTTLYSFASV
FT                   ITAKILHTIPHPNADKLRVATLTDGEKEHQVVCGAPNCEAGLIVALALPGAKLFDSEGQ
FT                   AYTIKKSKLRGVESQGMCCGADELGLDELQIQERALLELPEATPLGEDLATVLGNTSLE
FT                   ISLTPNLGHCASFLGLAREICHVTQANLVIPKEFSFENLPTTALDMGNDPDICPFFSYV
FT                   VITGISAQPSPIKLQESLQALKQKPINAIVDITNYIMLSLGQPLHAYDASHVALDSLRV
FT                   EKLSTPESLTLLNGETVLLPSGVPVVRDDHSLLGLGGVMGAKAPSFQETTTTTVIKAAY
FT                   FLPEALRASQKLLPIPSESAYRFTRGIDPQNVVPALQAAIHYILEIFPEATISPIYSSG
FT                   EICRELKEVALRPKTLQRILGKSFSIEILSQKLQSLGFSTTPQETSLLVKVPSYRHDIN
FT                   EEIDLVEEICRTESWNIETQNPVSCYTPIYKLKRETAGFLANAGLQEFFTPDLLDPETV
FT                   ALTRKEKEEISLQGSKHTTVLRSSLLPGLLKSAATNLNRQAPSVQAFEIGTVYAKHGEQ
FT                   YQETQTLAILLTEDGESRSWLPKPSLSFYSLKGWVERLLYHHHLSIDALTLESSALCEF
FT                   HPYQQGVLRIHKQSFATLGQVHPELAKKAQIKHPVFFAELNLDLLCKMLKKTTKLYKPY
FT                   AIYPSSFRDLTLTVPEDIPANLLRQKLLHEGSKWLESVTIISIYQDKSLETRNKNVSLR
FT                   LVFQDYERTLSNQDIEEEYCRLVALLNELLTDTKGTINS"
FT   gene            682280..683251
FT                   /locus_tag="CpB0619"
FT   CDS_pept        682280..683251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0619"
FT                   /product="methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /note="similar to methylated-DNA-protein-cysteine
FT                   S-methyltransferase - Methanococcus jannaschii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98548"
FT                   /protein_id="AAP98548.1"
FT                   /translation="MKQLLFCVCVFAMSCSAYASPRRQDPSVMKETFRNNYGIIVSGQE
FT                   WVKRGSDGTITKVLKNGATLHEVYSGGLLHGEITLTFPHTTALDVVQIYDQGRLVSRKT
FT                   FFVNGLPSQEELFNEDGTFVLTRWPDNNDSDTITKPYFIETTYQGHVIEGSYTSFNGKY
FT                   SSSIHNGEGVRSVFSSNNILLSEETFNEGVMVKYTTFYPNRDPESITHYQNGQPHGLRL
FT                   TYLQGGIPNTIEEWRYGFQDGTTIVFKNGCKTSEIAYVKGVKEGLELRYNEQEIVAEEV
FT                   SWRNDFLHGERKIYAGGIQKHEWYYRGRSVSKAKFERLNAAG"
FT   gene            683261..683782
FT                   /locus_tag="CpB0620"
FT   CDS_pept        683261..683782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0620"
FT                   /product="methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /note="similar to methylated-DNA-protein-cysteine
FT                   S-methyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98549"
FT                   /protein_id="AAP98549.1"
FT                   /translation="MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKT
FT                   HLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKEHPPFSSHFAKDLIPSQYLEILNCV
FT                   AEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFPCHRVVGSHGERNYVLGPVIH
FT                   EILLKFENSY"
FT   gene            complement(683798..685537)
FT                   /locus_tag="CpB0621"
FT   CDS_pept        complement(683798..685537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0621"
FT                   /product="oligopeptide ABC transporter permease protein"
FT                   /note="similar to oligopeptide ABC transporter permease
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98550"
FT                   /protein_id="AAP98550.1"
FT                   /translation="MQKHPSFYQRFLSAYYKNLLASLSWKFFISVALIGIYAPLFASSK
FT                   PLLVTWHGEIFFPLLRYLFFPGYYTKPVDLFFNVLMVTFPFFILSFKLTRGWLRRWLLG
FT                   LCIISQCMIFAWAYSGKVQDPALAENLKKMRAEKVRENISKVNSEMVMLLPKDTRTWEM
FT                   ERRYMSTYEQLGILIKAKYRKKQEASVKKYQVAFEEKRQSPMPTLRHLEMKNEGICLKR
FT                   LQQRVDKMQRPYEMAQQAWNRATDNYRPFLMALTRIEHELRLADYNNWGQPEDLCIAYA
FT                   NVEKRAEPYKKSLLEIRQVLEDYAKLRSAISFIQDKRLWIEKESEDLRILINPFFSSFH
FT                   WEDDAGGSREMNKYVPWWQLSRVTRKDLLAALVFGIRIALVVAGIGITIALAIGIMIGL
FT                   VSGYFGGTVDMILSRFTEIWETMPVLFILMLVISITQQKSLLLNTVLLGCFSWTGFSRY
FT                   VRIEVLKQRDRGYVLAATNLGYSHYYIMVHQILPNAIVPVISLVPFAMMAMISCEAGLT
FT                   FLGLGEESSASWGNLMREGVTGFPAESAVLWPPAIILTMLLIAIALIGDGVRDALDPRL
FT                   QDS"
FT   gene            complement(685538..687019)
FT                   /gene="dppB"
FT                   /locus_tag="CpB0622"
FT   CDS_pept        complement(685538..687019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="CpB0622"
FT                   /product="dipeptide transport system permease protein"
FT                   /note="similar to dipeptide transport system permease
FT                   protein dppB - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98551"
FT                   /protein_id="AAP98551.1"
FT                   /translation="MLKYILKRLVLIPLTLFAIVSINFVILNAAPGDVLEEKSRDALGE
FT                   AGKSDKMRSYKGPDRYLQFREHYGLTLPIFFNTRPKITHKKIQTALQELANANNTTPSA
FT                   KNAAKSLVYWGDCAKFVMPALLFEADDASRDDKYRHIAADLFIRGGVLQGFVGPNLSPE
FT                   QRAQNKEIAESNAFLVRQLNEEDLDTKVEALKGWFQDHGGTEVFCYSSKQFWKTFFLET
FT                   RFARYMSRVLRLDFGTLRNDAHKTVISEVIKRLRCSLVLSILPMIVGFVLCQIFGMIMA
FT                   LKRNRWIDHSLNFIFLILFSIPVFVAVPWILDNFVINKTIPFTTIPMPYSGLRSPPEVF
FT                   NELSTLGRIFDLVSHGFLPFCAVSYGALAAQSRLSRSIFLEVLSQDFICAAKARGLRWF
FT                   DILYKHVGKNAAVSIVTSLASSLGTLLGGALVVETLFNIDGFGNFFYQAILNRDHNVVL
FT                   FSVLVGSALSLVGYLLGDICYVLLDPRVQLEGRRI"
FT   gene            complement(687001..689109)
FT                   /locus_tag="CpB0623"
FT   CDS_pept        complement(687001..689109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0623"
FT                   /product="oligopeptide ABC transporter"
FT                   /note="similar to Bacillus subtilis oligopeptide ABC
FT                   transporter; oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98552"
FT                   /protein_id="AAP98552.1"
FT                   /translation="MLDKILKGIVAGSLILLYWSSDLLERDIKSIKGNVRDIQEDIREI
FT                   SRVVKQQQTSQAIPAAPGVMLAPKLVRDEAFALLFGDPSYPNLLSLDPYKQQTLPELLG
FT                   TNFHPHGILRTAHVGKPENLSPFNGFDYVVGFYDLCIPSLASPHVGKYEEFSPDLAVKI
FT                   EEHLVEDGSGDKEFHIYLRPNVFWRPIDPKALPKHVQLDEVFQRPHPVTAHDIKFFYDA
FT                   VMNPYVATMRAVALRSCYEDVVSVSVENDLKLVVRWKAHTVINEEGKEERKVLYSAFSN
FT                   TLSLQPLPRFVYQYFANGEKIIEDENIDTYRTNSIWAQNFTMHWANNYIVSCGAYYFAG
FT                   MDDEKIVFSRNPDFYDPLAALIDKRFVYFKESTDSLFQDFKTGKIDISYLPPNQRDNFY
FT                   SFMKSSAYNKQVAKGGAVRETVSADRAYTYIGWNCFSLFFQSRQVRCAMNMAIDRERII
FT                   EQCLDGQGYTISGPFASSSPSYNKQIEGWHYSPEEAARLLEEEGWIDTDGDGIREKVID
FT                   GVTVPFRFRLCYYVKSVTAHTIADYVATACKEIGIECSLLGLDMADLSQAFDEKNFDAL
FT                   LMGWCLGIPPEDPRALWHSEGAMEKGSANVVGFHNEEADKIIDRLSYEYDLKERNRLYH
FT                   RFHEIIHEEAPYAFLFSRHCSLLYKDYVKNIFVPTHRTDLIPEAQDETVNVTMVWLEKK
FT                   EDPCLSTS"
FT   gene            complement(689146..689469)
FT                   /locus_tag="CpB0624"
FT   CDS_pept        complement(689146..689469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98553"
FT                   /protein_id="AAP98553.1"
FT                   /translation="MKIKKSFQYSLCQAKRFQNMLPNHFDPCLQPVNLQLKQDRLAYGE
FT                   LIILLSKYQQKTFSSLLKEETCSLNRAKQHLLYKILRDFNTMQHLRSLGLNGWGEIPMS
FT                   PCL"
FT   gene            complement(689783..690229)
FT                   /locus_tag="CpB0625"
FT   CDS_pept        complement(689783..690229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98554"
FT                   /protein_id="AAP98554.1"
FT                   /translation="MCFCCGKYYIYCEPSCSGIYRWLFGFRAFTYPIGYRSTNHRNYSF
FT                   TLWYLLVSSTTRVITLSICFYTFYLQIIFLFLYSAWKPLRQPLFCHRLLIIWPISGLSC
FT                   RILNKENKNEKINVSPSFSSCASCCRFCFWIRILFSTTRRSSRF"
FT   gene            complement(690423..691427)
FT                   /locus_tag="CpB0626"
FT   CDS_pept        complement(690423..691427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0626"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT484 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98555"
FT                   /protein_id="AAP98555.1"
FT                   /translation="MKPLGFQENLEALCNKTSRQLLKYLIKQILFVCGASLLIALEFSF
FT                   FLYFFLFSGKTVIPAFCLACFFLTLFVCLVTRLYLLSGKGDFFEDLASEYLQGAVPPNK
FT                   RSQNIVEEQSHLAAAATKLSINLQNQEYSLLSEIFKFLPKHDLIRKFSCFCFWKDYFLF
FT                   RECLLQKAIEAYIKVVQAIPVDLSAHVSLADAYVALSGLYADPRKYPEFDANYWIPSGR
FT                   YSAEIQEKFFATARRAIEEFQILNEYAPGNAWVHAQLAYSYHDLQMPMEEIQEYEIVLK
FT                   LKPNDVETMSKLGILYFQQGMNAKGLRIYEEIKKRDYKKSQKLIKFYGVEYKY"
FT   gene            691485..692510
FT                   /locus_tag="CpB0627"
FT   CDS_pept        691485..692510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0627"
FT                   /product="ferrochelatase precursor-like protein"
FT                   /note="similar to chloroplast ferrochelatase precursor -
FT                   Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98556"
FT                   /db_xref="GOA:Q9Z7V1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7V1"
FT                   /protein_id="AAP98556.1"
FT                   /translation="MQCLVSLFLAKKVTVTTPAYLLANFGGPRHAKDLQEFLISLLTDR
FT                   DVTGTFLPRVLHRHLFTFIAKKRVPKVLPQYQSLQNWSPIYFDTETLAKTLSEILRAPV
FT                   IPFHRYLPSTHEKTLLALRTLHTRHVIGIPLFPHFTYSVTGSIVRFFMKHVPEIPISWI
FT                   PQFGSDSKFVSLITCHIRDFLQKLGILEKECCFLFSVHGLPVRYISQGDPYSKQCYESF
FT                   SAITTNFKQSENFLCFQSKFGPGKWLSPSTAQLCQNIDTDKPNVIVVPFGFISDHLETL
FT                   YEIERDYLPLLRSRGYRALRIPAIYSSPLWVSTLVDIVKENSTVVAEELIKSGKKHTGI
FT                   R"
FT   gene            complement(692515..693267)
FT                   /locus_tag="CpB0628"
FT   CDS_pept        complement(692515..693267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0628"
FT                   /product="glutamine-binding periplasmic protein precursor"
FT                   /note="similar to glutamine-binding periplasmic protein
FT                   precursor - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98557"
FT                   /protein_id="AAP98557.1"
FT                   /translation="MKIKFSWKVNFLICLLAVGLIFFGCSRVKREVLVGRDATWFPKQF
FT                   GIYTSDTNAFLNDLVSEINYKENLNINIVNQDWVHLFENLDDKKTQGAFTSVLPTLEML
FT                   EHYQFSDPILLTGPVLVVAQDSPYQSIEDLKGRLIGVYKFDSSVLVAQNIPDAVISLYQ
FT                   HVPIALEALTSNCYDALLAPVIEVTALIETAYKGRLKIISKPLNADGLRLAILKGTNGD
FT                   LLEGFNAGLVKTRRSGKYDAIKQRYRLP"
FT   gene            complement(693469..694029)
FT                   /locus_tag="CpB0629"
FT   CDS_pept        complement(693469..694029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0629"
FT                   /product="putative methylase"
FT                   /note="similar to probable methylase - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98558"
FT                   /protein_id="AAP98558.1"
FT                   /translation="MRILAGKYKGKSLKTFSNPHIRPTSGLVKEAFFSICREDIEGAAF
FT                   LDLFAGMGAIGFEALSRGAASVVFVDISIKAIQLIHTNSALLGEQLPVVIFRQDAQSAI
FT                   QRLIKQKRSFDLIYIDPPYELCNCYVETLLQKIVSGNILNPEGTLFLENASDEEIACEG
FT                   LTLRRRRKLGKTYLAEYIVEKDP"
FT   gene            complement(694026..694793)
FT                   /locus_tag="CpB0630"
FT   CDS_pept        complement(694026..694793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0630"
FT                   /product="putative phosphoesterase CT488"
FT                   /note="similar to probable phosphoesterase CT488 -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98559"
FT                   /protein_id="AAP98559.1"
FT                   /translation="MRFYTGSLQMHIYGLADLHLALGVPEKTMEVFGDPWIGYHQKICS
FT                   EWQAVVHPEDIVLLPGDISWAMNLSEAHKDFAFIGDLPGTKYMIRGNHDYWSSASTSKI
FT                   LQALPPSLYYLNQGFALLTPHLAVVGVRLWDSPTICVKKENFLTPSTQEQSYTEQDEKI
FT                   FLRELGRLKRAFAALPKEVTEVIVMTHYPPISSDGTPGPISEFLEADGRVSLCLFGHIH
FT                   KVQRPIDGFGNIRGIHYILVAADYVNFVPQEVM"
FT   gene            complement(694892..696217)
FT                   /locus_tag="CpB0631"
FT   CDS_pept        complement(694892..696217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0631"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="similar to glucose-1-phosphate adenylyltransferase -
FT                   Anabaena sp."
FT                   /db_xref="EnsemblGenomes-Gn:CpB0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98560"
FT                   /protein_id="AAP98560.1"
FT                   /translation="MIENDFPEASNFESSHFYRDKVGVIILCGGEGKRLSPLTNCRCKP
FT                   TVSFGGRYKLIDIPISHAISAGFSKIFVIGQYLTYTLQQHLFKTYFYHGVLQDQIHLLA
FT                   PEARQGDQIWYQGTADAIRKNLLYFEDTEIEYFLILSGDQLYNMDFRSIVDTAIRTHVD
FT                   MVLVAQPIPEKDAYRMGVLDIDSEGKLIDFYEKPQEKEVLKRFQLSSEDRRIHKLTEDS
FT                   GDFLGSMGIYLFRRDSLFSLLREEEGNDFGKHLIQAQMKRGQVQTLLYNGYWADIGTIE
FT                   SYYEANIALTQKPHAEKRGLNCYDDNGMIYSKNHHLPGAIITDSMISSSLLCEGCVINT
FT                   SHVSRSVLGIRSKIGENSVVDQSIIMGNARYGSPSMPSLGIGKDCEIRKAIIDENCCIG
FT                   NGVKLQNLKGYIKYDSPDKKLFVRDNIIIVPQGTHIPDNYIF"
FT   gene            complement(696335..696967)
FT                   /locus_tag="CpB0632"
FT   CDS_pept        complement(696335..696967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0632"
FT                   /product="UMP synthase"
FT                   /note="similar to UMP synthase - Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98561"
FT                   /db_xref="GOA:Q9Z7U6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U6"
FT                   /protein_id="AAP98561.1"
FT                   /translation="MMNYEDAKLRGQAVAILYQIGAIKFGKHILASGEETPLYVDMRLV
FT                   ISSPEVLQTVATLIWRLRPSFNSSLLCGVPYTALTLATSISLKYNIPMVLRRKELQNVD
FT                   PSDAIKVEGLFTPGQTCLVINDMVSSGKSIIETAVALEENGLVVREALVFLDRRKEACQ
FT                   PLGPQGIKVSSVFTVPTLIKALIAYGKLSSGDLTLANKISEILEIES"
FT   gene            697027..697311
FT                   /locus_tag="CpB0633"
FT   CDS_pept        697027..697311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0633"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT490 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98562"
FT                   /protein_id="AAP98562.1"
FT                   /translation="MLIRLFLGISLPKGFPLYLEPPLVLATFQGTQFVGTYSEATNPLY
FT                   IDNLNLNYHYTQELLYKAVPCNYKSIYREIPLIIFPEVLIGSTPTQSTE"
FT   gene            complement(697348..698742)
FT                   /locus_tag="CpB0634"
FT   CDS_pept        complement(697348..698742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0634"
FT                   /product="transcription termination factor rho"
FT                   /note="similar to transcription termination factor rho -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98563"
FT                   /protein_id="AAP98563.1"
FT                   /translation="MKEERSSEILPRVKETKKHAYVSMQEKSCVGECAVVASESEEAES
FT                   VTVTKIAKLQRMGIEELNILARQYGVKNIGSLTKSQVVFEIVKAKSERPDELLIGEGVL
FT                   EVLPDGFGFLRSPTYNYLPSAEDIYVSPAQIRRFDLKKGDTIIGTIRSPKEKEKYFALL
FT                   KVDKINGSTPDKAKERVLFENLTPLYPNQRIVMEMGKDHLAERVLDLTAPIGKGQRGLI
FT                   VAPPRSGKTVILQSIAHAIAVNNPDIVLIVLLIDERPEEVTDMIRQVRGEVVASTFDEQ
FT                   PERHIQVAEMVIEKARRLVEHGNDVVILLDSITRLARAYNTVQPHSGKILTGGVDASAL
FT                   HKPKRFFGAARNIEGGGSLTILATALIDTGSRMDEVIFEEFKGTGNMELVLDRRLSDRR
FT                   TYPAIDLIKSGTRKEELLYHPSELERVYLFRQAIADLTTIDAMHLLLGRLKKTNSNAEF
FT                   LLSLKE"
FT   gene            complement(698739..699356)
FT                   /locus_tag="CpB0635"
FT   CDS_pept        complement(698739..699356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0635"
FT                   /product="putative phosphatase/kinase"
FT                   /note="similar to probable phosphatase/kinase - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98564"
FT                   /db_xref="GOA:Q9Z7U3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U3"
FT                   /protein_id="AAP98564.1"
FT                   /translation="MGRMLKLLKVSITGDLSSGKTEACQVFQELGAYVVSADEISHSFL
FT                   IPHTRIGRRVIDLLGSDVVVDGAFDAQAIAAKVFYNSVLLQGLEAILHPEVCRIIEEQY
FT                   HQSIQDGNYPLFVAEVPLLYEIHYAKWFDSVILVMANEDIRRERFMKKTGRSSEDFDQR
FT                   CSRFLNVEEKLAQADVVVENNGTKKELHQKIEEYFYALKGAL"
FT   gene            complement(699341..701953)
FT                   /locus_tag="CpB0636"
FT   CDS_pept        complement(699341..701953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0636"
FT                   /product="DNA-directed DNA polymerase I"
FT                   /note="similar to DNA-directed DNA polymerase I - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98565"
FT                   /protein_id="AAP98565.1"
FT                   /translation="MKKLFVLDASGFIFRAYFALPEMKNHQGQATQAVFGFIRSLNKLI
FT                   KEFSPEYMISVFDGPNNKQSRQAIYADYKSNRQKKFEDIPPQIALVKEYCSLIGLAYLE
FT                   KESVEADDVIASIAKKAREENYKVYVCTADKDLLQLVNDHVVAWNPWADQGVVGISEVI
FT                   ERYGIPPGNIPDYLALVGDSSDNIPGLPGCGPKKAAALLKQFGSVEGLLENLDAVKGLS
FT                   QTMLSERQETLKLSKRLALLDSNIPIPVPIESLTFPQHPVDEEKLIHFYIQQGFKTLVP
FT                   SKQTEAATVDVQIIKDAESLTNILNLVQGGDIAFAVAYTGNHLLSLKLEGLALTQGSGV
FT                   FFIALEEEGTKILPILKDFFLREDLTFYGYNLKRDCHALLNAGIVIREISYDLALAEHL
FT                   TNGGGKISFQSLLVNHGFTETAHRFAKEWGNSGLPIGRLPEQPEQYFGEFVAYLPIIKD
FT                   AILEEINRKNLNHILSDIEMPLEKVLFSMERAGVPLDVEELAILEALFETELAVLTEEI
FT                   YDLSGGPFNIKSPKQLSDILYNELGLRPIDKAKSTRAEVLEALRSEHPIIEKLLAFRTI
FT                   EKLLSTYVKALPKQVDSHTQRIHPSFDQTGAVTGRLACRDPNLQNIPIRSERGILLRKA
FT                   FRLSEKNSYFLSADYSQIELRFLAHLSQDKSLKFAFESGEDIHAFTASQVFHVPLEQVS
FT                   KEQRMQAKTVNFGIVYGQQAFGLAKVLKISIGEAQELIQAYFSRYPEIAHFVEETIQQA
FT                   AKDLRVTTMLGRERIIDSWNEFPGSRAASGRFAVNTRIQGSAAELIKLAMLDISQAIKQ
FT                   QQMKSRMLLQIHDELLFEVPEEEIEEMQRLVREKMESAMTLSVPIVVNILIGKNWAEC"
FT   gene            complement(701977..702969)
FT                   /locus_tag="CpB0637"
FT   CDS_pept        complement(701977..702969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0637"
FT                   /product="proteinase IV"
FT                   /note="similar to proteinase IV family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98566"
FT                   /protein_id="AAP98566.1"
FT                   /translation="MWHFVSKAFLSIVGLCCGVVLAFVVIFALIASSLGNGDATFVSLP
FT                   DAQGEVKDLGKTAPIIAVIEMKDVIASSKNTAKTIQNILEGFEKAPLKDRVKGIVIDMD
FT                   CPGGEVFEIDRIYSMLRFWKERKGFPIYIYVNGLCASGGYYVSCAATKIYATSSSLIGS
FT                   IGVRSGPFFNVKEGLNRYGVESDLLTAGKDKAPMNPYTPWTSHDREERQATLDFLYGQF
FT                   VDIVTQNRPLLTKEKLVHTLGARIFSPEKAKQEGYIDVVGATKEQVLQDIVAVCKIEDN
FT                   YRVIGSGGDGWWKRVASAAASSPLVTGMIKHDILPLSHDAAYIPPYLAL"
FT   gene            complement(703102..704724)
FT                   /locus_tag="CpB0638"
FT   CDS_pept        complement(703102..704724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0638"
FT                   /product="plastidic ATP/ADP-transporter"
FT                   /note="similar to plastidic ATP/ADP-transporter - Solanum
FT                   tuberosum"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98567"
FT                   /db_xref="GOA:Q9Z7U0"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7U0"
FT                   /protein_id="AAP98567.1"
FT                   /translation="MQSSEVKPFSRLRAYLCPIYKSEFSKFVPLFLLAFFVGFNYCLLK
FT                   NMKDTLVIVGSDAGAEVIPFLKVWGIVPGAVIVTMVYGWLGSRYPRDTVFYCFMAAFLG
FT                   FFFLFAVIIYPVGDSLHLNSLADKLQELLPQGLRGFIVMVRYWSYSIYYVMSELWSSVV
FT                   LSMLFWGLANQITTITEAGRFYALINTGLNLSSICAGEISYWMGKQTFVAYSFACDSWH
FT                   SVMLNLTMLITCSGLIMIWLYRRIHHLTIDTSIPPSRRVLAEEGAATANLKEKKKPKAK
FT                   ARNLFLHLIQSRYLLGLAIIVLSYNLVIHLFEVVWKDQVSQIYSSHVEFNGYMSRITTL
FT                   IGVVSVLAAVLLTGQCIRKWGWTVGALVTPLVMLVSGLLFFGTIFAAKRDISIFGGVLG
FT                   MTPLALAAWTGGMQNVLSRGTKFTFFDQTKEMAFIPLSPEDKNHGKAAIDGVVSRIGKS
FT                   GGSLIYQGLLVIFSSVAASLNVIALVLLIIMVVWIAVVAYIGKEYYSRAADAVATLKQP
FT                   KEPSSSIVREAQESVEQEEMAVL"
FT   gene            complement(704953..705459)
FT                   /locus_tag="CpB0639"
FT   CDS_pept        complement(704953..705459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0639"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="similar to CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase (phosphatidylglycerophosphate
FT                   synthase) (PGP synthase) - Pseudomonas fluorescens"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98568"
FT                   /protein_id="AAP98568.1"
FT                   /translation="MRQFCNLLSLSRLWLALYFCQEKLHIRLLAIVGAMLSDVLDGYLA
FT                   RRYKATSRLGSILDPITDKVFVFVCITVLYMEGSLSIAHLFFICARDLFLIIFVCYLSL
FT                   VKGWKGYDYGSLFWGKIFTVVQFIILLGVTAGGEIPWTGLVPLVALGFLYFLERIMDYK
FT                   KQFLR"
FT   gene            complement(705677..705764)
FT                   /locus_tag="CpBt20"
FT   tRNA            complement(705677..705764)
FT                   /locus_tag="CpBt20"
FT                   /product="tRNA-Ser"
FT                   /note="GCT"
FT   gene            complement(705823..705978)
FT                   /locus_tag="CpB0640"
FT   CDS_pept        complement(705823..705978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98569"
FT                   /protein_id="AAP98569.1"
FT                   /translation="MLVAQRDFRGTAQNLLLQVSKSIGSSEVNFKRLPSFFLVRFAQVD
FT                   IFHFDS"
FT   gene            706056..707462
FT                   /gene="dnaB"
FT                   /locus_tag="CpB0641"
FT   CDS_pept        706056..707462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="CpB0641"
FT                   /product="replicative DNA helicase"
FT                   /note="similar to replicative DNA helicase DnaB -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98570"
FT                   /protein_id="AAP98570.1"
FT                   /translation="MDKSTGVPLPSPPHSKESEMIVLGCMLTGVHYLNLAANQLYEEDF
FT                   YYLEHKIIFRVLQDAFKQDKPIDVHLAGEELKRHNQITVIGGPSYLITLAEFAGTAAYL
FT                   EEYVDIIRSKSILRKMISTAKEIEKRALEQPKNVAEALDEAQNSFFKISQSTSVSQYTL
FT                   VADKLRGLTTTTDKPYLVQLQERQELFLQNAQGDNKSFFTGIPTHFIDLDQLIHGFSPS
FT                   NLMILAARPAMGKTALALNIAENLCFQNRLPIGIFSLEMTVDQLIHRMICSRSEVDSKK
FT                   ISIGDLSGHDFQRIVSVINEMQEHTLLIDDQPGLKVSDLRARARRMKESYDIQFLIIDY
FT                   LQLLSGSGTLRATESRQTEISEISRMLKTLARELNIPILCLSQLSRKVEDRANHRPMMS
FT                   DLRESGSIEQDSDLVMFLLRREYYDPNDKPGTAELIIAKNRHGSIGSVPLVFEKELARF
FT                   RNYSAFECIS"
FT   gene            complement(707591..707749)
FT                   /locus_tag="CpB0642"
FT   CDS_pept        complement(707591..707749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98571"
FT                   /protein_id="AAP98571.1"
FT                   /translation="MCLAILSLRFFLTDDIISLWLTYRFDIPFVISDEDSSYSNRSLNF
FT                   SGGTLVQ"
FT   gene            707806..709641
FT                   /gene="gidA"
FT                   /locus_tag="CpB0643"
FT   CDS_pept        707806..709641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="CpB0643"
FT                   /product="GidA"
FT                   /note="similar to gidA protein - Pseudomonas putida"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98572"
FT                   /db_xref="GOA:Q9Z7T7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T7"
FT                   /protein_id="AAP98572.1"
FT                   /translation="MWTHPIAYDVIVVGAGHAGCEAAYCSAKMGVSVLMLTSNLDTIAK
FT                   LSCNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQL
FT                   YHIHMKRLLENTPGLHIMQATVESLLDKEGVISGVTTKEGWMFSGKTVVLSSGTFMRGL
FT                   IHIGDRNFSGGRLGDPSSQGLSEDLKKRGFPISRLKTGTPPRLLASSINFSCMEEQPGD
FT                   LGVGFVHRTEPFQPPLPQLSCFITHTMEKTKAIISANLHRSALYGGCIEGVGPRYCPSI
FT                   EDKIVKFSDKERHHVFLEPEGLHTQEIYANGLSTSMPFDVQYDMIRSVLGLENAIITRP
FT                   AYAIEYDYIHGNVIHPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVFNR
FT                   PPFIPSRQESYIGVMLDDLTTQILDEPYRMFTGRAEHRLLLRQDNACARLSHYGYELGL
FT                   LSEERYELVKKQNQLLEEEKVRLQKTFRQYGQSVVSLAKALSRPEVSYDMLREAFPNDI
FT                   RDLGAVLNASLEMEIKYSGYIDRQKILIQSLEKAESLLIPEDLDYKQITALSLEAQEKL
FT                   AKFTPRTLGSASRISGIASADIQVLMIALKKHAHH"
FT   gene            709628..710335
FT                   /locus_tag="CpB0644"
FT   CDS_pept        709628..710335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0644"
FT                   /product="lipoate--protein ligase A"
FT                   /note="similar to lipoate--protein ligase A - Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98573"
FT                   /protein_id="AAP98573.1"
FT                   /translation="MPTTNCIFLDLRGHSILHQLQIEEALLRVANQNFCIINSGAKDSI
FT                   VLGISRNLNQDVHISRAQADHIPIIRRYSGGGTVFIDSNTLMVSWIMNSSEASAQPQEL
FT                   LAWTYGIYSPLLPNTFSIRENDYVLGHKKIGGNAQYIQRHRWVHHTTFLWDIDLDKLSY
FT                   YLPIPQQQPTYRNQRSHEEFLTTLRPWFPSRDDFLERIKASGSLLFTWEEFLDNELEEI
FT                   LAQPHRKATTVLN"
FT   gene            complement(710332..710766)
FT                   /locus_tag="CpB0645"
FT   CDS_pept        complement(710332..710766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0645"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="similar to nucleoside diphosphate kinase -
FT                   Myxococcus xanthus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98574"
FT                   /db_xref="GOA:Q9Z7T5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T5"
FT                   /protein_id="AAP98574.1"
FT                   /translation="MEQTLSIIKPDSVSKAHIGEILSIFEQSGLRIAAMKMMHLSQTEA
FT                   EGFYFVHRERPFFQELVDFMVSGPVVVLVLEGANAVSRNRELMGATNPAEAASGTIRAK
FT                   FGESIGVNAVHGSDTLENAAVEIAYFFSKIEVVNASKPLV"
FT   gene            complement(710838..711461)
FT                   /gene="ruvA"
FT                   /locus_tag="CpB0646"
FT   CDS_pept        complement(710838..711461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="CpB0646"
FT                   /product="RuvA"
FT                   /note="similar to ruvA protein - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98575"
FT                   /db_xref="GOA:Q9Z7T4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T4"
FT                   /protein_id="AAP98575.1"
FT                   /translation="MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQD
FT                   FLVFTHVIFRETEHLLYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLCSVVR
FT                   SEDIRALASVSGIGKKTAEKLMVELKQKLPDLLPLDSRVETSQTHTTSSCLEEGIQALA
FT                   ALGYSKIAAERMIAEAIKDLPEGSSLTDILPIALKKNFSGVNKD"
FT   gene            complement(711463..711969)
FT                   /gene="ruvC"
FT                   /locus_tag="CpB0647"
FT   CDS_pept        complement(711463..711969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="CpB0647"
FT                   /product="RuvC"
FT                   /note="DNA repair protein; similar to DNA repair protein
FT                   ruvC - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98576"
FT                   /db_xref="GOA:Q9Z7T3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T3"
FT                   /protein_id="AAP98576.1"
FT                   /translation="MSELIIGVDPGTIVAGYAIIAVEQRYQLRPYSYGAIRLSSDMPLP
FT                   MRYKTLFEQLSGVLDDTQPNAMVLETQFVNKNPQSTMKLAMARGIVLLAAAQRDILIFE
FT                   YAPNVAKKAVVGKGHASKRQVQVMVSKILNVPEVLHPSNEDIADAFALAICHTHVARSP
FT                   LCGVR"
FT   gene            complement(712112..713074)
FT                   /locus_tag="CpB0648"
FT   CDS_pept        complement(712112..713074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0648"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT503 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98577"
FT                   /protein_id="AAP98577.1"
FT                   /translation="MRLLSILKLHLFSLRSSSSLSPHYYHSCSRSMLHLLCRWKDADIM
FT                   EWQQICNILSGVCSRMSGKLVSLQKETQDSCHQEHERIHLQYREQLSALEEEYRRREEA
FT                   KNQDLEKLQQENTWLQNRLAEKLQQIRHQSDIIDEIKKELLQSVQRTEISEGRRLCYEH
FT                   KIKQLEEQLQRYVSQHGAPSIEIEEDKSSAAYAEINRLKKSLIDLQQEKDIYIKTYHSE
FT                   IAKLREKLQRQEGAQTSSEVCSIEKLTEVQTDLAEKKKAIALLQDIVEDQYCQLRDLHK
FT                   EKGMAMPSNTKLDHLKGLLGKEPESEVDVVFSESKSLGS"
FT   gene            complement(713212..713294)
FT                   /locus_tag="CpBt21"
FT   tRNA            complement(713212..713294)
FT                   /locus_tag="CpBt21"
FT                   /product="tRNA-Leu"
FT                   /note="TAA"
FT   gene            complement(713482..714315)
FT                   /locus_tag="CpB0649"
FT   CDS_pept        complement(713482..714315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0649"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT504 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T1"
FT                   /protein_id="AAP98578.1"
FT                   /translation="MYFTRDPIIETVITSREGYKLSVRNTKHFSQDPFMVEAIEVISLG
FT                   NICFFRNCDHSKPFLVPAGDYEVMEVRDTKINLKAVGLDRGVKIAGGREALIKLTKSTP
FT                   LPVIDEKPLADSPEEGTEPTSPSKKEKKEARKDSFKGEKWKEKKKLSRRRNHKEIAEVT
FT                   GASQEILDTVKEELWEESQENEIVEQKKFSLLPPPAKLISEVISQTVVDPVVTSADLNE
FT                   SLQALVRESSDLINALLSADDAIHFPETEEEPTSASFEESSAMFFPETSSATEEE"
FT   gene            complement(714330..715337)
FT                   /locus_tag="CpB0650"
FT   CDS_pept        complement(714330..715337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0650"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase
FT                   cytosolic"
FT                   /note="similar to glyceraldehyde-3-phosphate dehydrogenase,
FT                   cytosolic - Trypanosoma brucei"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98579"
FT                   /db_xref="GOA:Q9Z7T0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7T0"
FT                   /protein_id="AAP98579.1"
FT                   /translation="MKVVINGFGRIGRLVLRQILKRNSSVEVLAINDLVPGDALTYLFK
FT                   FDSTHGRFPEDVRCEADHLIVGKRKIQFLSERNVQNLPWKDLGVDLVIECTGLFTKKED
FT                   AEKHIQAGAKRVLISAPGKGDIPTFVMGVNHKTFNPEKDFVISNASCTTNCLAPIAKVL
FT                   LDNFGITEGLMTTVHAATATQLVVDGPSKKDWRGGRGCLQNIIPASTGAAKAVTLCLPE
FT                   LKGKLTGMAFRVPIEDVSVVDLTVRLDKSTTYDDICKAMKQASETDLKGILDYTDEQVV
FT                   SSDFIGSEYSSIFDALAGIALNDRFFKLVAWYDNETGYATRIVDLLEYVEKNSK"
FT   gene            complement(715379..715807)
FT                   /locus_tag="CpB0651"
FT   CDS_pept        complement(715379..715807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0651"
FT                   /product="ribosomal protein L17"
FT                   /note="similar to ribosomal protein L17 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98580"
FT                   /db_xref="GOA:Q9Z7S9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S9"
FT                   /protein_id="AAP98580.1"
FT                   /translation="MQHARKKFRVGRTSSHNRCMLANMLKSLIHYERIETTLPKAKELR
FT                   RHADKMITLAKKNSLAARRIAIGRLMVRYNKLTSKEARQAKGGDTSVYNVDRLVVNKLF
FT                   DELGNRFVERKGGYTRILKLQNRIGDNAQKCIIEFLAS"
FT   gene            complement(715814..716938)
FT                   /locus_tag="CpB0652"
FT   CDS_pept        complement(715814..716938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0652"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /note="similar to DNA-directed RNA polymerase alpha chain -
FT                   Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98581"
FT                   /db_xref="GOA:Q9Z7S8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S8"
FT                   /protein_id="AAP98581.1"
FT                   /translation="MSDNAHNLLYDKFELPEAVKMLPVEGLPIDKHARFIAEPLERGMG
FT                   HTLGNALRRALLIGLEAPAIISFAMTGVLHEYMAIEGVIEDVTNIILNLKGALLKKYPM
FT                   QDSSLGRTTQVLKASISIDASDLAAANGQKEVTLQDLLQEGDFEAVNPDQVIFTVTQPI
FT                   QLEVVLRIAFGRGYTPSERIVLEDKGVYEIVLDAAFSPVTLVNYFVEDTRVGQDTDFDR
FT                   LVLIVETDGRVTPKEALAFSTQILTKHFSIFENMDEKKIVFEEAISIEKENKDDILHKL
FT                   ILGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEMKL
FT                   ELGMDLTQFGVGLDNVKEKMKWYAEKIRAKNTKG"
FT   gene            complement(716959..717360)
FT                   /locus_tag="CpB0653"
FT   CDS_pept        complement(716959..717360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0653"
FT                   /product="ribosomal protein S11"
FT                   /note="similar to ribosomal protein S11 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98582"
FT                   /db_xref="GOA:Q9Z7S7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S7"
FT                   /protein_id="AAP98582.1"
FT                   /translation="MVKNQAQAKKSVKRKQLKNIPSGVVHVKATFNNTIVSITDPAGNV
FT                   ISWASAGKVGYSGSRKSSAFAATVAAQDAAKTAMNSGLKEVEVCLKGTGAGRESAVRAL
FT                   ISAGLVVSVIRDETPVPHNGCRPRKRRRV"
FT   gene            complement(717382..717750)
FT                   /locus_tag="CpB0654"
FT   CDS_pept        complement(717382..717750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0654"
FT                   /product="ribosomal protein S13"
FT                   /note="similar to ribosomal protein S13 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98583"
FT                   /db_xref="GOA:Q9Z7S6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S6"
FT                   /protein_id="AAP98583.1"
FT                   /translation="MPRIIGIDIPAKKKLKISLTYIYGIGSARSDEIIKKLKLDPEARA
FT                   SELTEEEVGRLNSLLQSEYTVEGDLRRRVQSDIKRLIAIHSYRGQRHRLSLPVRGQRTK
FT                   TNSRTRKGKRKTVAGKKK"
FT   gene            complement(717806..719179)
FT                   /gene="secY"
FT                   /locus_tag="CpB0655"
FT   CDS_pept        complement(717806..719179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CpB0655"
FT                   /product="SecY"
FT                   /note="similar to SecY protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98584"
FT                   /db_xref="GOA:Q9Z7S5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S5"
FT                   /protein_id="AAP98584.1"
FT                   /translation="MTTLRQFFLITELRQKLFYTFALLTACRVGVFIPVPGINGELAVA
FT                   YFKQLLGSGQNLFQLADIFSGGAFAQMTVIALGVVPYISASIIVQLFLVFMPALQREMR
FT                   ESSDQGKRRIGRLTRLFTVALAVIQSLLFAKFALRMNLTIPGIVLPTLLSSKLFGVPWI
FT                   FYITTVVVMTTGTLLLMWIGEQISDKGIGNGISLIIALGILSSFPSVLGSIVNKLNLGS
FT                   QDSSDLGLISILILALVFVFVLITTILIIEGVRKIPVQYARRVIGRREVPGGGSYLPLK
FT                   VNYAGVIPVIFASSLLMFPATIGQFIASESSWMKRIAALLAPGSLVYSICYVLLIIFFT
FT                   YFWTATQFHPEQIASEMKKNNAFIPGIRQGKPTQHYLEYTMNRVTLLGALFLAAIAILP
FT                   SLLGCLLRVDSNVSYFLGGTAMLIVVGVVLDTMKQVDAFLLMRRYDSVLKTDRTKGRH"
FT   gene            complement(719204..719638)
FT                   /locus_tag="CpB0656"
FT   CDS_pept        complement(719204..719638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0656"
FT                   /product="ribosomal protein L15"
FT                   /note="similar to ribosomal protein L15 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98585"
FT                   /db_xref="GOA:Q9Z7S4"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S4"
FT                   /protein_id="AAP98585.1"
FT                   /translation="MIKLESLFDISERKRRKKLLGRGPSSGHGKTSGRGHKGDGSRSGY
FT                   KRRFGYEGGGVPLYRRVPTRGFSHKRFDKCVEEITTGRLAELFQEGEAITLDALKAKKA
FT                   IARQAVRVKVILKGDLEKTFVWQDTAVVLSQGVQNLLGIT"
FT   gene            complement(719631..720128)
FT                   /locus_tag="CpB0657"
FT   CDS_pept        complement(719631..720128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0657"
FT                   /product="ribosomal protein S5"
FT                   /note="similar to ribosomal protein S5 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98586"
FT                   /db_xref="GOA:Q9Z7S3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S3"
FT                   /protein_id="AAP98586.1"
FT                   /translation="MSLSKNSHKEDQLEEKVLVVNRCSKVVKGGRKFSFSALILVGDGK
FT                   GRLGYGFAKANELTDAIRKGGEAAKKNLMKIEALEDGSIPHEVLVHHDGAQLLLKPAKP
FT                   GTGIVAGSRIRLILEMAGIKDIVAKSFGSNNPMNQVKAAFKALTGLSPRKDLLRRGAAI
FT                   ND"
FT   gene            complement(720146..720517)
FT                   /locus_tag="CpB0658"
FT   CDS_pept        complement(720146..720517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0658"
FT                   /product="ribosomal protein L18"
FT                   /note="similar to ribosomal protein L18 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98587"
FT                   /db_xref="GOA:Q9Z7S2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S2"
FT                   /protein_id="AAP98587.1"
FT                   /translation="MESSLCKKSLMKRRRALRVRKVLKGSPTKPRLSVVKTNKHIYVQL
FT                   IDDSIGKTLASVSTLSKLNKSQGLTKKNQEVAKVLGTQIAELGKNLQLDRVVFDRGPFK
FT                   YHGIVSMVADGAREGGLQF"
FT   gene            complement(720528..721079)
FT                   /locus_tag="CpB0659"
FT   CDS_pept        complement(720528..721079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0659"
FT                   /product="ribosomal protein L6"
FT                   /note="similar to ribosomal protein L6 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98588"
FT                   /db_xref="GOA:Q9Z7S1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S1"
FT                   /protein_id="AAP98588.1"
FT                   /translation="MSRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITL
FT                   KDNSIFVHAAPHVVDRPSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQGAFL
FT                   DLSIGVSHPTKIPIPSTLQVSVEKNTLISVKGLDKQLVGEFAASIRAKRPPEPYKGKGI
FT                   RYENEYVRRKAGKAAKTGKK"
FT   gene            complement(721106..721507)
FT                   /locus_tag="CpB0660"
FT   CDS_pept        complement(721106..721507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0660"
FT                   /product="ribosomal protein S8"
FT                   /note="similar to ribosomal protein S8 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98589"
FT                   /db_xref="GOA:Q9Z7S0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7S0"
FT                   /protein_id="AAP98589.1"
FT                   /translation="MGMTSDSIADLLTRIRNALMAEHLYVDVEHSKMREAIVKILKHKG
FT                   FVAHYLVKEENRKRAMRVFLQYSDDRKPVIHQLKRVSKPSRRVYVSAAKIPYVFGNMGI
FT                   SVLSTSQGVMEGSLARSKNIGGELLCLVW"
FT   gene            complement(721525..722067)
FT                   /locus_tag="CpB0661"
FT   CDS_pept        complement(721525..722067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0661"
FT                   /product="ribosomal protein L5"
FT                   /note="similar to ribosomal protein L5 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98590"
FT                   /db_xref="GOA:Q9Z7R9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R9"
FT                   /protein_id="AAP98590.1"
FT                   /translation="MSRLKKFYTEEIRKSLFEKFGYANKMQIPVLKKIVLSMGLAEAAK
FT                   DKNLFQAHLEELTMISGQKPLVTKARNSIAGFKLREGQGIGAKVTLRGIRMYDFMDRFC
FT                   NIVSPRIRDFRGFSNKGDGRGCYSVGLDDQQIFPEINLDRVKRTQGLNITWVTTAQTDD
FT                   ECTTLLELMGLRFKKAQ"
FT   gene            complement(722069..722404)
FT                   /locus_tag="CpB0662"
FT   CDS_pept        complement(722069..722404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0662"
FT                   /product="ribosomal protein L24"
FT                   /note="similar to ribosomal protein L24 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98591"
FT                   /db_xref="GOA:Q9Z7R8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R8"
FT                   /protein_id="AAP98591.1"
FT                   /translation="MKKQNIRVGDKVFILAGNDKGKEGKVLSLTEDKVVVEGVNVRIKN
FT                   IKRSQQNPKGKRISIEAPIHISNVRLTIAGEPAKLSVKVTEQGRELWQRRPDGTSQLYR
FT                   LVRGKKG"
FT   gene            complement(722418..722786)
FT                   /locus_tag="CpB0663"
FT   CDS_pept        complement(722418..722786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0663"
FT                   /product="ribosomal protein L14"
FT                   /note="similar to ribosomal protein L14 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98592"
FT                   /db_xref="GOA:Q9Z7R7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R7"
FT                   /protein_id="AAP98592.1"
FT                   /translation="MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRD
FT                   VEPNSSIKKGDVIKAVIVRTRRHITRKDGSTLKFDTNSCVIIDDKGNPKGTRIFGPVAR
FT                   EIRDRGFIKISSLAPEVI"
FT   gene            complement(722809..723069)
FT                   /locus_tag="CpB0664"
FT   CDS_pept        complement(722809..723069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0664"
FT                   /product="ribosomal protein S17"
FT                   /note="similar to ribosomal protein S17 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98593"
FT                   /db_xref="GOA:Q9Z7R6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R6"
FT                   /protein_id="AAP98593.1"
FT                   /translation="MASEPRGSRKVKIGVVVSAKMEKTVVVRVERIFSHPQYLKVVRSS
FT                   KKYYAHTELKVSEGDKVKIQETRPLSKLKRWRVIEHVGVVS"
FT   gene            complement(723062..723280)
FT                   /locus_tag="CpB0665"
FT   CDS_pept        complement(723062..723280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0665"
FT                   /product="ribosomal protein L29"
FT                   /note="similar to ribosomal protein L29 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98594"
FT                   /db_xref="GOA:Q9Z7R5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R5"
FT                   /protein_id="AAP98594.1"
FT                   /translation="MAAKKDLLTQLRGKGDDDLDAYVHENKKALFALRAENLLQNKVVK
FT                   VHMFSTHKKNIARALTVKQERKGKVHG"
FT   gene            complement(723283..723699)
FT                   /locus_tag="CpB0666"
FT   CDS_pept        complement(723283..723699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0666"
FT                   /product="ribosomal protein L16"
FT                   /note="similar to ribosomal protein L16 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98595"
FT                   /db_xref="GOA:Q9Z7R4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R4"
FT                   /protein_id="AAP98595.1"
FT                   /translation="MLMPKRTKFRKQQKGQFAGLSKGATFVDFGEYAMQTLERGWVTSR
FT                   QIEACRVAINRYLKRRGKVWIRIFPDKSVTKKPAETRMGKGKGAPDHWVAVVRPGRILF
FT                   EVANVSKEDAQDALRRAAAKLGIKTRFVKRVERV"
FT   gene            complement(723728..724399)
FT                   /locus_tag="CpB0667"
FT   CDS_pept        complement(723728..724399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0667"
FT                   /product="ribosomal protein S3"
FT                   /note="similar to ribosomal protein S3 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98596"
FT                   /db_xref="GOA:Q9Z7R3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R3"
FT                   /protein_id="AAP98596.1"
FT                   /translation="MGQKGCPIGFRTGVTKKWRSLWYGNKQEFGKFLIEDVRIRQFLRK
FT                   KPSCQGAAGFVVRRMSGKIEVTIQTARPGLVIGKKGAEVDLLKEELRALTGKEVWLEIA
FT                   EIKRPELNAKLVADNIARQIERRVSFRRAMKKAMQSVMDAGAVGVKIQVSGRLAGAEIA
FT                   RSEWYKNGRVPLHTLRADIDYATACAETTYGIIGIKVWINLGENSSSTTPNNPAAPSAA
FT                   A"
FT   gene            complement(724415..724750)
FT                   /locus_tag="CpB0668"
FT   CDS_pept        complement(724415..724750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0668"
FT                   /product="ribosomal protein L22"
FT                   /note="similar to ribosomal protein L22 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98597"
FT                   /db_xref="GOA:Q9Z7R2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R2"
FT                   /protein_id="AAP98597.1"
FT                   /translation="MFKATARYIRVQPRKARLAAGLMRNLSVQEAEEQLGFSQLKAGRC
FT                   LKKVLNSAVANAELHENIKRENLSVTEVRVDAGPVYKRSKSKSRGGRSPILKRTSHLTV
FT                   IVGEKER"
FT   gene            complement(724769..725035)
FT                   /locus_tag="CpB0669"
FT   CDS_pept        complement(724769..725035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0669"
FT                   /product="ribosomal protein S19"
FT                   /note="similar to ribosomal protein S19 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98598"
FT                   /db_xref="GOA:Q9Z7R1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R1"
FT                   /protein_id="AAP98598.1"
FT                   /translation="MSRSLRKGPFVDHHLLKKVRAMNIEEKKTPIKTWSRRSMITPEMI
FT                   GHTFEVHNGKKFLTVFVSETMVGHKLGEFSPTRIFKSHPVKKG"
FT   gene            complement(725041..725895)
FT                   /locus_tag="CpB0670"
FT   CDS_pept        complement(725041..725895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0670"
FT                   /product="ribosomal protein L2"
FT                   /note="similar to ribosomal protein L2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98599"
FT                   /db_xref="GOA:Q9Z7R0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7R0"
FT                   /protein_id="AAP98599.1"
FT                   /translation="MFKKFKPVTPGTRQLVLPAFDELTTRGELRGTKSKRSLRPNKKLS
FT                   FFKKSSGGRDNLGHISCRHRGGGAKQLYRVVDFKRNKDGITAKVVTVEYDPNRSAYIAL
FT                   LSYEDGEKRYILAPKGIQRGDVVVSGEGSPFKPGCCMTLKSIPLGLSVHNIEMRPSSGG
FT                   KLVRSAGLAAQVIAKSPGYVTLKMPSGEFRMLNEGCRATIGEVSNADHNLRVDGKAGRR
FT                   RWMGVRPTVRGTAMNPVDHPHGGGEGRHNGYIPRTPWGKVTKGLKTRDKNKSNKWIVKD
FT                   RRK"
FT   gene            complement(725917..726252)
FT                   /locus_tag="CpB0671"
FT   CDS_pept        complement(725917..726252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0671"
FT                   /product="ribosomal protein L23"
FT                   /note="similar to ribosomal protein L23 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98600"
FT                   /db_xref="GOA:Q9Z7Q9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q9"
FT                   /protein_id="AAP98600.1"
FT                   /translation="MKDPYDVIKRHYVTEKAKMLEHLSAGTGEGKKKGSFCKDPKFVFI
FT                   VSHDATKPLIAQALEAIYVDKNVKVKSVNTINVKPQPARMFRGRRKGKTSGFKKAIVTF
FT                   YQGHSVG"
FT   gene            complement(726269..726943)
FT                   /locus_tag="CpB0672"
FT   CDS_pept        complement(726269..726943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0672"
FT                   /product="ribosomal protein L4"
FT                   /note="similar to ribosomal protein L4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98601"
FT                   /db_xref="GOA:Q9Z7Q8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q8"
FT                   /protein_id="AAP98601.1"
FT                   /translation="MVLLSKFDFSGNKIGEVEVADSLFADEGDGLQLIKDYIVAIRANK
FT                   RQWSACTRNRSEVSHSTKKPFKQKGTGNARQGCLASPQFRGGGIVFGPKPKFNQHVRIN
FT                   RKERKAAIRLLLAQKIQTNKLTVVDDTVFVDALTAPKTQSALRFLKDCNVECRSILFID
FT                   HLDHVEKNENLRLSLRNLTAVKGFVYGININGYDLASAHNIVISKKALQELVERLVSET
FT                   KD"
FT   gene            complement(726976..727683)
FT                   /locus_tag="CpB0673"
FT   CDS_pept        complement(726976..727683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0673"
FT                   /product="ribosomal protein L3"
FT                   /note="similar to ribosomal protein L3 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98602"
FT                   /db_xref="GOA:Q9Z7Q7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q7"
FT                   /protein_id="AAP98602.1"
FT                   /translation="MFLQEESKSLLLMDKFMRSHISVMGKKEGMIHIFDKDGSLVACSV
FT                   IRVEPNVVTQIKTKESDGYFSLQIGAEEMNAPAHTITKRVSKPKLGHLRKAGGRVFRFL
FT                   KEVRGSEEALNGVSLGDAFGLEVFEDVSSVDVRGISKGKGFQGVMKKFGFRGGPGSHGS
FT                   GFHRHAGSIGMRSTPGRCFPGSKRPSHMGAENVTVKNLEVIKVDLEKKVLLVKGAIPGA
FT                   RGSIVIVKHSSRT"
FT   gene            complement(727924..728925)
FT                   /locus_tag="CpB0674"
FT   CDS_pept        complement(727924..728925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0674"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98603"
FT                   /protein_id="AAP98603.1"
FT                   /translation="MATNAIRSTGSAASKMLLPVAKEPAAVSSFAQKGIYCIQQFFTNP
FT                   GNKLAKFVGATKSLDKCFKLSKAVSDCVVGSLEEAGCTGDALTSARNAQGMLKTTREVV
FT                   ALANVLNGAVPSIVNSTQRCYQYTRQAFELGSKTKERKTPGEYSKMLLTRGDYLLAASR
FT                   EACTAVGATTYSATFGVLRPLMLINKLTAKPFLDKATVGNFGTAVAGIMTINHMAGVAG
FT                   AVGGIALEQKLFKRAKESLYNERCALENQQSQLSGDVILSAERALRKEHVATLKRNVLT
FT                   LLEKALELVVDGVKLIPLPITVACSAAISGALTAASAGIGLYSIWQKTKSGK"
FT   gene            complement(729029..729994)
FT                   /locus_tag="CpB0675"
FT   CDS_pept        complement(729029..729994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0675"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="similar to methionyl-tRNA formyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98604"
FT                   /db_xref="GOA:Q9Z7Q5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q5"
FT                   /protein_id="AAP98604.1"
FT                   /translation="MNLKVVYFGTPTFAATVLQDLLHHKIQITAVVTRVDKPQKRSAQL
FT                   IPSPVKTIALTHGLPLLQPSKASDPQFIEELRAFNADVFIVVAYGAILRQIVLDIPRYG
FT                   CYNLHAGLLPAYRGAAPIQRCIMEGATESGNTVIRMDAGMDTGDMANITRVPIGPDMTS
FT                   GELADALASQGAEVLIKTLQQIESGQLQLVSQDAALATIAPKLSKEEGQVPWDKPAKEA
FT                   YAHIRGVTPAPGAWTLFSFSEKAPKRLMIRKASLLAEAGRYGAPGTVVVTDRQELAIAC
FT                   SEGAICLHEVQVEGKGSTNSKSFLNGYPAKKLKIVFTLNN"
FT   gene            complement(729984..730823)
FT                   /locus_tag="CpB0676"
FT   CDS_pept        complement(729984..730823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0676"
FT                   /product="acyl-UDP-N-acetylglucosamine acyltransferase"
FT                   /note="similar to acyl-UDP-N-acetylglucosamine
FT                   acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98605"
FT                   /db_xref="GOA:Q9Z7Q4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q4"
FT                   /protein_id="AAP98605.1"
FT                   /translation="MASIHPTAIIEPGAKIGKDVVIEPYVVIKATVTLCDNVVVKSYAY
FT                   IDGNTTIGKGTTIWPSAMIGNKPQDLKYQGEKTYVTIGENCEIREFAIITSSTFEGTTV
FT                   SIGNNCLIMPWAHVAHNCTIGNNVVLSNHAQLAGHVQVGDYAILGGMVGVHQFVRIGAH
FT                   AMVGALSGIRRDVPPYTIGSGNPYQLAGINKVGLQRRQVPFATRLALIKAFKKIYRADG
FT                   CFFESLEETLEEYGDIPEVKNFIEFCQSPSKRGIERSIDKQALEEESADKEGVLIES"
FT   gene            complement(730836..731297)
FT                   /locus_tag="CpB0677"
FT   CDS_pept        complement(730836..731297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0677"
FT                   /product="hydroxymyristoyl dehydratase"
FT                   /note="similar to hydroxymyristoyl dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98606"
FT                   /db_xref="GOA:Q9Z7Q3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q3"
FT                   /protein_id="AAP98606.1"
FT                   /translation="MNQPSVIKLRELLDLLPHRYPFLLVDKVLSYDIEARSITAQKNVT
FT                   INEPFFMGHFPNAPIMPGVLILEALAQAAGVLIGLVLENDRNKRIALFLGIQKAKFRQA
FT                   VRPGDVLTLQADFSLISSKGGKAWAQARVDSQLVTEAELSFALVDKESI"
FT   gene            complement(731309..732157)
FT                   /locus_tag="CpB0678"
FT   CDS_pept        complement(731309..732157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0678"
FT                   /product="UDP-3-O-acyl-GlcNAc deacetylase"
FT                   /note="similar to UDP-3-O-acyl-GlcNAc deacetylase -
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98607"
FT                   /db_xref="GOA:Q9Z7Q2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q2"
FT                   /protein_id="AAP98607.1"
FT                   /translation="MLERTQRTLKREVRYSGVGIHLGKSSTLHLQPAQTNTGIVFQRQS
FT                   ASGNYENVPALLDHVYTTGRSTTLSRGSAVIATVEHLMAALRSNNIDNLIIQCSGEEIP
FT                   IGDGSSNVFVELIDQAGICEQEDKVSIARLTRPVYYQHQDIFLAAFPSDELKISYTLHY
FT                   PQSSTIGTQYKSLVINEESFRQEIAPCRTFALYNELCFLMEKGLIGGGCLDNAVVFKDD
FT                   GIISRGQLRFADEPVRHKILDLIGDLSLVGRPFVAHVLAVGSGHSSNIAFGKKILEALE
FT                   L"
FT   gene            complement(732187..733812)
FT                   /locus_tag="CpB0679"
FT   CDS_pept        complement(732187..733812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0679"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="similar to apolipoprotein N-acyltransferase -
FT                   Rickettsia prowazekii"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98608"
FT                   /db_xref="GOA:Q9Z7Q1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q1"
FT                   /protein_id="AAP98608.1"
FT                   /translation="MLRIFCFVISWCLIAFAQPDLSGFVSILGAACGYGFFWYSLEPLK
FT                   KPSLPLRTLFVSCFFWIFTIEGIHFSWMLSDQYIGKLIYLVWLTLITILSVLFSGFSCL
FT                   LVAIVRQKRTAFLWSLPGVWVAIEMLRFYGIFSGMSFDYLGWPMTASAYGRQFGGFLGW
FT                   AGQSFAVIAVNMSFYCLLLKKPHAKMLWVLTLLLPYTFGAIHYEYLKHAFQQDKRALRV
FT                   AVVQPAHPPIRPKLKSPIVVWEQLLQLVSPIQQPIDLLIFPEVVVPFGKHRQVYPYESC
FT                   AHLLSSFAPLPEGKAFLSNSDCATALSQHFQCPVIIGLERWVKKENVLYWYNSAEVISH
FT                   KGISVGYDKRILVPGGEYIPGGKFGSLICRQLFPKYALGCKRLPGRRSGVVQVRGLPRI
FT                   GITICYEETFGYRLQSYKRQGAELLVNLTNDGWYPESRLPKVHFLHGMLRNQEFGMPCV
FT                   RACQTGVTAAVDSLGRILKILPYDTRETKAPSGVLETSLPLFNYKTLYGYCGDYPMILI
FT                   AFCAVSYLGGGFLGYRLLAKKEIR"
FT   gene            complement(733822..734289)
FT                   /locus_tag="CpB0680"
FT   CDS_pept        complement(733822..734289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0680"
FT                   /product="palmitoyl-CoA hydrolase"
FT                   /note="similar to palmitoyl-CoA hydrolase and cytosolic
FT                   acyl coenzyme A thioester hydrolase - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98609"
FT                   /db_xref="GOA:Q9Z7Q0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7Q0"
FT                   /protein_id="AAP98609.1"
FT                   /translation="MLKKKPVSFSCIDGHIYKIFPNDLNANNTVFGGLLMSLLDRLALV
FT                   VAERHTESVCVTAFVDALRFYAPAYMGENLICKAAVNRTWRTSLEVGVKVWAENIYKQE
FT                   RRHITSAYFTFVAVNEDNQPIPVHQIVPETPEEKRRYNEADRRRQARLELK"
FT   gene            complement(734420..735169)
FT                   /locus_tag="CpB0681"
FT   CDS_pept        complement(734420..735169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0681"
FT                   /product="DNA polymerase III"
FT                   /note="similar to DNA polymerase III - Thermotoga maritima"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98610"
FT                   /protein_id="AAP98610.1"
FT                   /translation="MSLLKDTVFTCLDCEMTGLDVKKDRIIEIAAVRFTFDSVISSIEF
FT                   LINPERVVSAESQRVHHISNAMLRDQPKIAEVFPQIKAFFKEGDYIVGHSVGFDLQVLA
FT                   QEMERIGETFLSKYTIIDTLRLAKEYGDSPNNSLESLAVHFNVPYDGNHRAMKDVEINI
FT                   NIFKHLCKRFRTLEQLKQVLAKPIKMKYMPLGKHKGRCFSEIPLAYLQWASKMDFDSDL
FT                   LFSIRHEIKHRQKGTGFSQVNNPFMEL"
FT   gene            735194..735373
FT                   /locus_tag="CpB0682"
FT   CDS_pept        735194..735373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98611"
FT                   /protein_id="AAP98611.1"
FT                   /translation="MFDILLTVEGFLCLTLYFASVQRMPCEQKRVPGNLYYYYIAAHSS
FT                   LCLSVCKDTMENKD"
FT   gene            complement(735370..735705)
FT                   /locus_tag="CpB0683"
FT   CDS_pept        complement(735370..735705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0683"
FT                   /product="hypothetical protein"
FT                   /note="putative ATPase or kinase; similar to probable
FT                   (ATPase or kinase) - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98612"
FT                   /protein_id="AAP98612.1"
FT                   /translation="MLLFGDYGAGKTEFVRGIVSGYLGDTIAEEVASPSFSILHVYGNE
FT                   PKRLCHYDLYRIDQKNQEYIFQDAEEDDVLCIEWADRLPKPRFCDTINIYITMQTNMER
FT                   EIIIEKR"
FT   gene            complement(735774..736490)
FT                   /locus_tag="CpB0684"
FT   CDS_pept        complement(735774..736490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0684"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT538 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98613"
FT                   /db_xref="InterPro:IPR024484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P6"
FT                   /protein_id="AAP98613.1"
FT                   /translation="MDISGAVKQKLLQFLGKQKKPELLATYLFYLEQALSLRPVVFVRD
FT                   KIIFKTPEDAVRILEQDKKIWRETEIQISSEKPQVNENTKRIYICPFTGKVFADNVYAN
FT                   PQDAIYDWLSSCPQNMEKQGGVRIKRFLVSEDPDVIKEYAVPPKEPIIKTVFASAITGK
FT                   LFHSLPPLLEDFISSYLRPMTLEEVQNQTKFQLESSFLSLLQDALVEDKIAAFIESLAD
FT                   DTAFHVYISQWVDTEE"
FT   gene            736726..736809
FT                   /locus_tag="CpBt22"
FT   tRNA            736726..736809
FT                   /locus_tag="CpBt22"
FT                   /product="tRNA-Leu"
FT                   /note="CAG"
FT   gene            736855..737163
FT                   /locus_tag="CpB0685"
FT   CDS_pept        736855..737163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0685"
FT                   /product="thioredoxin"
FT                   /note="similar to thioredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98614"
FT                   /db_xref="GOA:Q9Z7P5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P5"
FT                   /protein_id="AAP98614.1"
FT                   /translation="MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAEL
FT                   PHVTIGKINIDENSKPAETYEVSSIPTLILFKDGNEVARVVGLKDKEFLTNLINKHA"
FT   gene            complement(737179..737649)
FT                   /locus_tag="CpB0686"
FT   CDS_pept        complement(737179..737649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0686"
FT                   /product="putative rRNA methylase"
FT                   /note="similar to probable rRNA methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98615"
FT                   /protein_id="AAP98615.1"
FT                   /translation="MRVVLHCPDIPQNTGNIGRTCVALGAELILVRPLGFSLADKFVKR
FT                   AGMDYWDKLQLTVVDSIEEALHDVPEDQIFCLSTKGSASYTEFSLPSSGTYVFGSESKG
FT                   LPKEILKKYYKNCLRIPMQQDIRSLNLATSVGIVLYEVVRQKTVALQKNPTV"
FT   gene            complement(737646..738422)
FT                   /locus_tag="CpB0687"
FT   CDS_pept        complement(737646..738422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0687"
FT                   /product="mip protein"
FT                   /note="similar to mip protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98616"
FT                   /db_xref="GOA:Q9Z7P3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P3"
FT                   /protein_id="AAP98616.1"
FT                   /translation="MNRRWNLVLATVALALSVASCDVRSKDKDKDQGSLVEYKDNKDTN
FT                   DIELSDNQKLSRTFGHLLARQLRKSEDMFFDIAEVAKGLQAELVCKSAPLTETEYEEKM
FT                   AEVQKLVFEKKSKENLSLAEKFLKENSKNAGVVEVQPSKLQYKIIKEGAGKAISGKPSA
FT                   LLHYKGSFINGQVFSSSEGNNEPILLPLGQTIPGFALGMQGMKEGETRVLYIHPDLAYG
FT                   TAGQLPPNSLLIFEINLIQASADEVAAVPQEGNQGE"
FT   gene            complement(738491..740245)
FT                   /locus_tag="CpB0688"
FT   CDS_pept        complement(738491..740245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0688"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="similar to aspartyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98617"
FT                   /db_xref="GOA:Q9Z7P2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P2"
FT                   /protein_id="AAP98617.1"
FT                   /translation="MKYRTHRCNELTSNHIGENVQLAGWVHRYRNHGGVVFIDLRDRFG
FT                   ITQIVCREDEQPELHQRLDAVRSEWVLSVRGKVCPRLAGMENPNLATGHIEVEVASFEV
FT                   LSKSQNLPFSIADDHINVNEELRLEYRYLDMRRGDIIEKLLCRHQVMLACRNFMDAQGF
FT                   TEIVTPVLGKSTPEGARDYLVPSRIYPGKFYALPQSPQLFKQLLMVGGLDRYFQIATCF
FT                   RDEDLRADRQPEFAQIDIEMSFGDTQDLLPIIEQLVATLFATQGIEIPLPLAKMTYQEA
FT                   KDSYGTDKPDLRFDLKLKDCRDYAKRSSFSIFLDQLAHGGTIKGFCVPGGATMSRKQLD
FT                   GYTEFVKRYGAMGLVWIKNQEGKVASNIAKFMDEEVFHELFAYFDAKDQDILLLIAAPE
FT                   SVANQSLDHLRRLIAKERELYSDNQYNFVWITDFPLFSLEDGKIVAEHHPFTAPLEEDI
FT                   PLLETDPLAVRSSSYDLVLNGYEIASGSQRIHNPDLQSQIFTILKISPESIQEKFGFFI
FT                   KALSFGTPPHLGIALGLDRLVMVLTAAESIREVIAFPKTQKASDLMMNAPSEIMSSQLK
FT                   ELSIKVAF"
FT   gene            complement(740220..741512)
FT                   /locus_tag="CpB0689"
FT   CDS_pept        complement(740220..741512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0689"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="similar to histidyl-tRNA synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98618"
FT                   /db_xref="GOA:Q9Z7P1"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7P1"
FT                   /protein_id="AAP98618.1"
FT                   /translation="MTVTLPKGVFDIFPYLADAKQLWRHTSLWHSVEKAIHTVCMLYGF
FT                   CEIRTPIFEKSEVFLHVGEESDVVKKEVYSFLDRKGRSMTLRPEGTAAVVRSFLEHGAS
FT                   HRSDNKFYYILPMFRYERQQAGRYRQHHQFGVEAIGVRHPLRDAEVLALLWDFYSRVGL
FT                   QHMQIQLNFLGGSETRFRYDKVLRAYLKESMGELSALSQQRFSTNVLRILDSKEPEDQE
FT                   IIRQAPPILDYVSDEDLKYFNEILDALRVLEIPYAINPRLVRGLDYYSDLVFEATTTFQ
FT                   EVSYALGGGGRYDGLISAFGGASLPACGFGVGLERAIQTLLAQKRIEPQFPHKLRLIPM
FT                   EPDADQFCLEWSQHLRRLGIPTEVDWSHKKVKGALKAASTEQVSFVCLIGERELISQQL
FT                   VIKNMSLRKEFFGTKEEVEQRLLYEIQNTPL"
FT   gene            complement(741876..742079)
FT                   /locus_tag="CpB0690"
FT   CDS_pept        complement(741876..742079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98619"
FT                   /protein_id="AAP98619.1"
FT                   /translation="MKKLIALIGIFLVPIKGNTNKEHDAHATVLKAARAKYNLFFVQDV
FT                   FPVHEVIEPISPDCLVHYEGWV"
FT   gene            742323..743690
FT                   /gene="uhpC"
FT                   /locus_tag="CpB0691"
FT   CDS_pept        742323..743690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="CpB0691"
FT                   /product="hexose phosphate transport system regulatory
FT                   protein"
FT                   /note="similar to hexose phosphate transport system
FT                   regulatory protein uhpC - Salmonella typhimurium"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98620"
FT                   /db_xref="GOA:Q9Z7N9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7N9"
FT                   /protein_id="AAP98620.1"
FT                   /translation="MNVWTKFFQPPKHIKEIEDQEVVKKKYKYWRIRIFYSMFIGYIFY
FT                   YFTRKSFTFAMPTLIADLGFDKAQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYFMAIG
FT                   LMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPCARLLTHWYAKSERGTWWSVWS
FT                   TSHNIGGALIPILTGFIIDYSGWRGAMYVPGILCIGMGLVLINRLRDTPQSLGLPPIEK
FT                   YKRDPHHAHHEGKSASEGTEEIERELSTREILFTYVLTNQWLWFLAAASFFIYIVRMAV
FT                   NDWSALFLIETKHYAAVKANFCVSLFEIGGLFGMLVAGWLSDKISKGNRGPMNVLFSLG
FT                   LLFAILGMWFSRSHNQWWVDGTLLFVIGFFLYGPQMMIGLAAAELSHKKAAGTASGFTG
FT                   WFAYFGATFAGYPLGKVTDVWGWKGFFIALLACASIALLLFLPTWNATEKNTRSKA"
FT   gene            743710..747432
FT                   /locus_tag="CpB0692"
FT   CDS_pept        743710..747432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0692"
FT                   /product="DNA-directed DNA polymerase III alpha chain"
FT                   /note="similar to DNA-directed DNA polymerase III alpha
FT                   chain family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98621"
FT                   /db_xref="GOA:Q9Z7N8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7N8"
FT                   /protein_id="AAP98621.1"
FT                   /translation="MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLY
FT                   GAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKEKRSRAAHHLILLCKNEQGYRNLCI
FT                   LTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSPEALLLELQWFQD
FT                   LFKDDYFTEVQLHKMSEESIAGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVA
FT                   TNDIHYINANDWQAHEILLNVQSGETVRIAKQNTHIPNPKRKVYRSREYYFKSPAQMAE
FT                   LFKDIPEVISNTLEVAKRCDFTFDFSKKHYPIYVPESLKTLNSYTEEDRYQASAVFLKQ
FT                   LAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDYLLIVWDIIH
FT                   WAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICM
FT                   AGRERVINYAIERHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIPDLN
FT                   TTLSKALETDPDLHQLYINDAESAQVIDMALCLEGSIRNTGVHAAGVIICGDQLTNHIP
FT                   ICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSLAMATLP
FT                   LDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSF
FT                   INRKHGKEIIEYDHPLMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKK
FT                   DFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKFAAYGFNKSHAAAYGLITYTTAYL
FT                   KANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIRFA
FT                   MGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDS
FT                   NRDLLLASVEPLYEAIAKDKKEAASGVMTFFTLGAMDRKNEVPICLPKDIPTRSKKELL
FT                   KKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPHGSVVRTVFIIDKVTTKISSK
FT                   AQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWM
FT                   KDLSIVNENIIYECDQAFDRIKNQVQKMSFTMSTSGKETKAKGNKPNENGHTQALAPVT
FT                   LSLDLNELRHSHLCILKKIVQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDIEELR
FT                   QELVTADLPVRVITV"
FT   gene            complement(747496..748380)
FT                   /locus_tag="CpB0693"
FT   CDS_pept        complement(747496..748380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0693"
FT                   /product="putative OMP"
FT                   /note="similar to probable OMP - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98622"
FT                   /protein_id="AAP98622.1"
FT                   /translation="MKKLILYFAAFVASLFCGVFLWDRVPCAQKIMRLAADHSSEVFSK
FT                   SCRFVRKISGFEELQVFERHVSPEQALALFPEYRDGKSFVELAFIPHTLMHVRFSKEEP
FT                   VKKHIISQEGEILWSLVNGEMVLHTGTWTCSKGFRECLLLHAGKQDMRVIQTLATLGGT
FT                   TSRESLAQALALKNIRAERVIKECQKKKLIFASGNQIGTHFQQFQPIRGCTTTLNNNPV
FT                   WLQKPRHAAVFPAQYSEDRVRHLVKMIFGDNFLIVRSSMVYVPVYKISLVSADNSVRVE
FT                   YINAVTGKSFQDL"
FT   gene            748531..749487
FT                   /locus_tag="CpB0694"
FT   CDS_pept        748531..749487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0694"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT547 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98623"
FT                   /protein_id="AAP98623.1"
FT                   /translation="MKFLLYVPLLLVLVSTGCDAKPVSFEPFSGKLSTQRFEPQHSAEE
FT                   YFSQGQEFLKKGNFRKALLCFGIITHHFPRDILRNQAQYLIGVCYFTQDHPDLADKAFA
FT                   SYLQLPDAEYSEELFQMKYAIAQRFAQGKRKRICRLEGFPKLMNADEDALRIYDEILTA
FT                   FPSKDLGAQALYSKAALLIVKNDLTEATKTLKKLTLQFPLHILSSEAFVRLSEIYLQQA
FT                   KKEPHNLQYLHFAKLNEEAMKKQHPNHPLNEVVSANVGAMREHYARGLYATGRFYEKKK
FT                   KAEAANIYYRTAITNYPDTLLVAKCQKRLDRISKHTS"
FT   gene            749501..750100
FT                   /locus_tag="CpB0695"
FT   CDS_pept        749501..750100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0695"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT548 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98624"
FT                   /protein_id="AAP98624.1"
FT                   /translation="MRLFSLGTIYLFFSLALSSCCGYSILNSPYHLSSLGKSLLQERIF
FT                   IAPIKEDPHGQLCSALTYELSKRSFAISGRSSCAGYTLKVELLNGIDKNIGFTYAPNKL
FT                   GDKTHRHFIVSNEGRLSLSAKVQLINNDTQEVLIDQCVARESVDFDFEPDLGTANAHEF
FT                   ALGQFEMHSEAIKSARRILSIRLAETIAQQVYYDLF"
FT   gene            750069..750521
FT                   /locus_tag="CpB0696"
FT   CDS_pept        750069..750521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0696"
FT                   /product="putative sigma regulatory factor-histidine
FT                   kinase"
FT                   /note="similar to probable sigma regulatory
FT                   factor-histidine kinase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98625"
FT                   /protein_id="AAP98625.1"
FT                   /translation="MLNRYTMTFFEGETVFPAVLSELHSMLDLIKRAGKQSKCPQEKLL
FT                   KLELACEELLVNIISYAYQGENSPGTIAISCISHRGDLEVVIKDHGPSFNPLAVSINIQ
FT                   EDLPLEQRKLGGLGIFLAKSSVDEFLYAREDHCNIVHLKMLNGQHS"
FT   gene            complement(750524..750952)
FT                   /locus_tag="CpB0697"
FT   CDS_pept        complement(750524..750952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0697"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT550 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98626"
FT                   /protein_id="AAP98626.1"
FT                   /translation="MSLDFFEEFYHQSILNTGTSFPEGYLNIAEILSYPHCTDANTDFL
FT                   CSQSDNDFIIAESKDKLTLFNADFAIWLVPELVQGQAVTRGYIAVSQGEGNYEPEMAFE
FT                   ASGQYNQSSLILEALQLYLKDIKDTENALRSFRFNNDH"
FT   gene            751063..752373
FT                   /gene="dacB"
FT                   /locus_tag="CpB0698"
FT   CDS_pept        751063..752373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="CpB0698"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="similar to serine-type D-Ala-D-Ala carboxypeptidase
FT                   dacB family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98627"
FT                   /protein_id="AAP98627.1"
FT                   /translation="MKRPFFTYLCIIFYGSCASLSLHAGLSFPEVRGATAAVVHADSGK
FT                   VFYDKDIDAVIYPASMTKIATALFILKHYPTVLDTLIKVKQDAIASITPQAKKQSGYRS
FT                   PPHWLETDGSTIQLHLREELLGWDLFHALLVCSANDAANVLAMACCGSVEKFMDKLNFF
FT                   LKEEIGCTHTHFNNPHGLHHPNHYTTTRDLISIMRCALKEPPFRGVISTTSYKIGATNL
FT                   HGERILSPTNKLLLPGSTYHYPPALGGKTGTTKTAGKNLIMAAEKNNRLLVTIATGYSG
FT                   PVSDLYQDVIALCETVFNEPLLRKELVPPSDCLQLEIANLGKLSCPLPEGLYYDFYASE
FT                   DREPLSVSFIAHADAFPIEQGDLLGHWVFYDDEGKKISSQPFYAPCRFERTIKPWKLYM
FT                   KRVFTSYRTYMSITMLLMYFRIRKHRKYKNLKHYSKI"
FT   gene            752445..752624
FT                   /locus_tag="CpB0699"
FT   CDS_pept        752445..752624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98628"
FT                   /protein_id="AAP98628.1"
FT                   /translation="MCAHYFAVYLSSLVLLQVMLRYPFLKRILSSLFYCLGTLRENLQK
FT                   EKHTTVSLSKCLLP"
FT   gene            752609..752788
FT                   /locus_tag="CpB0700"
FT   CDS_pept        752609..752788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0700"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT552 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98629"
FT                   /protein_id="AAP98629.1"
FT                   /translation="MSIALNREEVWDNPRHLMFILMQFQQFSGEQDRFGSFLEATIRDR
FT                   VSFLVLQEKIATLK"
FT   gene            complement(752896..753990)
FT                   /locus_tag="CpB0701"
FT   CDS_pept        complement(752896..753990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0701"
FT                   /product="fmu methyltransferase"
FT                   /note="similar to fmu methyltransferase - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98630"
FT                   /protein_id="AAP98630.1"
FT                   /translation="MVPFRQHHAYQLLKQLHTSAISEADRVSYYFKQNRSLGSKDRQWI
FT                   QNIIFNILRHRRLLETLILDSGEQVTPEALVAKVNEGVLENLDSYSAIPWPVRYSISDD
FT                   LAHFLVQDYGEEQAEEIAKIWLTEAPITIRVNTDKISVKELQEKLEYPSSPGELPEALH
FT                   FSKRHPLQSTEAFRRGFFEIQDENSQRISQGISLTDKDIVLDFCAGAGGKSLIFAQKAK
FT                   HVVINDSRKAILQTAKHRLLRAGARNFSLADQLRLGSFSVVIVDAPCSGTGVFRRHPEH
FT                   KWQFSKKLLLNYVRVQKSILKQASAYVGPRGRLVYITCSLLKEENEAHVAYMHSLGWKE
FT                   VHRKTLPLQVGKGDAFFTSHFQKI"
FT   gene            complement(754087..755241)
FT                   /locus_tag="CpB0702"
FT   CDS_pept        complement(754087..755241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0702"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT696 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M9"
FT                   /protein_id="AAP98631.1"
FT                   /translation="MILDFQFSIGYYLRVLELAIRDGTRILAYDRKRLLLDAWPVNDPL
FT                   PTNYDTSVSTIRQVIHELFSWSAISYSISSRLLAIIELRLHEEKPQTGWLYRLFFPSKY
FT                   HIKKAIVDKLCMFKSLILFESKRPVDKIVQAANKVFSKGKSNFSSWEDFTHEVTVSEVQ
FT                   TPLAGEVQRRLAADASLQMIIEALTTLLEGHTAYLPLSLELLNQFIGEKAQPLKTLSEK
FT                   SYVLLRELIQLFSLSAEDFQTIIMSIISDSLSEVLANSLIGNQPLTFHGKTFVGLWQET
FT                   ALASPEDSKLALGFLAEVLRKVIVEKKLHVSKSDNTTPEEVGNIYSIRDQNPALWDKMI
FT                   TMLLMRWLLDYDRDIGIALRKAAEYYNPHPSFWRQFLRLWQRRP"
FT   gene            complement(755370..756539)
FT                   /locus_tag="CpB0703"
FT   CDS_pept        complement(755370..756539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0703"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT695 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98632"
FT                   /protein_id="AAP98632.1"
FT                   /translation="MGTPISGNDGDRNTISDPLEESAAEEGDSDLEDRVSESATQVIET
FT                   IADTGIPEATPSEGTNSDLNSDLVDRVEYEARGSLLTTMLARIRKAVSQIWMHVKTKRH
FT                   PKEQGVRSLGDIPCDLLKATRLPKETAEPPYFYALETALASCRSFFFHVFLRLFTLLRR
FT                   QHPEAPLDLCGTDPISPEAAVAFALILRSCCKWVATDAVQEGLPLEVIEEAGMYNAFSL
FT                   EATTTVEEVSKRLSELLYSDKRIDGLANVRGITKIITSPYLGAGQCVSVVDNLKTYDLG
FT                   RNYTQVLACASQIDEFADKGENEALVMKDILYLVRQDRSKELGDFLMMWSEEHASEVNY
FT                   DVVLAILEVNLPILEEDYRSHPLAYQKKLNYVICQFFCSERLTSIEPKD"
FT   gene            complement(756575..757723)
FT                   /locus_tag="CpB0704"
FT   CDS_pept        complement(756575..757723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0704"
FT                   /product="YwbM"
FT                   /note="similar to hypothetical ywbM protein - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98633"
FT                   /protein_id="AAP98633.1"
FT                   /translation="MGINPSGNRSPDDVWVRGAQGDSSSTQGTGATNSNLGAHNVTTST
FT                   SQPQVASKAKQLWQTVREFFLGKKSPDSSQGASGPAMQSPSGPTIRPTRPAPPPPTTGG
FT                   ANAKRPATHGKGRAPQPPTAGSSSGSEQPTAMSSEVAKLVSELKDAVHSHAESQKVLKK
FT                   VSQELQTKWTDWENNRGPDYLLHGYRVIARALQQTYTEQSMLIEGTLSTGPVPQAVTVA
FT                   KDAVTQTVRGAIKNLENPKPGNDPDGVLMQVVISLGIEGPTLDPGESIQNFLETRVSDF
FT                   GGDDSDIDYTSDIARLGSALDRVRENHPNEMPRIWIALARELGAAVHSHATSVRIANAG
FT                   KNHTRDVVRMANESSRLLQGMKVLSVGAWANTMTVLIGDLFE"
FT   gene            complement(758001..758525)
FT                   /locus_tag="CpB0705"
FT   CDS_pept        complement(758001..758525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98634"
FT                   /protein_id="AAP98634.1"
FT                   /translation="MTASGGRQGLLARIKEAVTGFFSRMSFFRSGAPRGSQQPSAPSAD
FT                   TVRSPLPGGDARATEGAGRNLIKKGYQPGMKVTIPQVPGGGAQRSSGSTTLKPTRPAPP
FT                   PPKTGGTNAKRPATHGKGPAPQPPKTGGTNAKRAATHGKGPAPQPPKGILKQPGQSGTS
FT                   GKKRVSWSDED"
FT   gene            complement(759044..760252)
FT                   /locus_tag="CpB0706"
FT   CDS_pept        complement(759044..760252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0706"
FT                   /product="phosphoglycerate kinase"
FT                   /note="similar to phosphoglycerate kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98635"
FT                   /db_xref="GOA:Q9Z7M5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M5"
FT                   /protein_id="AAP98635.1"
FT                   /translation="MDKLTVQDLSPEEKKVLVRVDFNVPMQDGKILDDIRIRSAMPTIN
FT                   YLLKKHAAVILMSHLGRPKGQGFQEEYSLQPVVDVLEGYLGHHVPLAPDCVGEVARQAV
FT                   AQLSPGRVLLLENLRFHIGEEHPEKDPTFAAELSSYGDFYVNDAFGTSHRKHASVYVVP
FT                   QAFPGRAAAGLLMEKELEFLGRHLLTSPKRPFTAILGGAKISSKIGVIEALLNQVDYLL
FT                   LAGGMGFTFLQALGKSLGNSLVEKSALDLARNVLKIAKSRNVTIVLPSDVKAAENLQSK
FT                   EYSVISIDQGIPPHLQGFDIGPRTTEEFIRIINQSATVFWNGPVGVYEVPPFDSGSIAI
FT                   ANALGNHPSAVTVVGGGDAAAVVALAGCSTKVSHVSTGGGASLEFLEQGFLPGTEVLSP
FT                   SKS"
FT   gene            complement(760290..761570)
FT                   /locus_tag="CpB0707"
FT   CDS_pept        complement(760290..761570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0707"
FT                   /product="phosphate permease"
FT                   /note="similar to phosphate permease family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98636"
FT                   /db_xref="GOA:Q9Z7M4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M4"
FT                   /protein_id="AAP98636.1"
FT                   /translation="MLPLIIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVI
FT                   AAIFEFFGALLLGDRVAGTIESSIVSVTNPMIASGDYMYGMTAALLATGVWLQLASFFG
FT                   WPVSTTHSIVGAVIGFGLVLGKGTIIYWNSVGIILISWILSPFMGGCVAYLIFSFIRRH
FT                   IFYKNDPVLAMVRVAPFLAALVIMTLGTVMISGGVILKVSSTPWAVSGVLVCGLLSYII
FT                   TFYYVHTKHCSYISDTPKKGSLTYRLKERGGNYGRKYLVVERIFAYLQIIVACFMAFAH
FT                   GSNDVANAIAPVAGVLRQAYPASYTSYTLIRLMAFGGIGLVIGLAIWGWRVIETVGCKI
FT                   TELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARGIRAINLNIIKDI
FT                   VLSWFITLPAGALLSILFFFALRALFH"
FT   gene            complement(761577..762251)
FT                   /locus_tag="CpB0708"
FT   CDS_pept        complement(761577..762251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0708"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT691 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98637"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M3"
FT                   /protein_id="AAP98637.1"
FT                   /translation="MQTLARLFGQSPFAPLQAHLEMVVSCVEYMLPIFTALRDGRYEEL
FT                   LEMAKLVSDKEYQADCIKNDMRNHLPAGLFMPISRAGILEIISIQDSIADTAEDVAILL
FT                   TIRRLNFYPSMETLFFRFLEKNLEAFELTMTLLHEFNQLLESSFGGRKADKARLLVGRV
FT                   AKSEHESDVLQRELMQIFFSDDFIIPEKEFYLWLQVIRRTAGISDSSEKLAHRINMTLE
FT                   EK"
FT   gene            762306..763280
FT                   /locus_tag="CpB0709"
FT   CDS_pept        762306..763280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0709"
FT                   /product="dipeptide ABC transporter, ATP-binding protein"
FT                   /note="similar to dipeptide ABC transporter, ATP-binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98638"
FT                   /protein_id="AAP98638.1"
FT                   /translation="MASNPILQIEDLSITLAKQRQQYPIVQSLSFTINEGQTLAIIGES
FT                   GSGKSVSAHAILRLLPCPPFSVSGQVNFQGHNLLTASRSIQKKIIGTEISMIFQNPQAS
FT                   LNPVFTIEQQFREIIHTHLALTAEVAKEKMLYALEETGFHDPRLCLNLYPHQLSGGMLQ
FT                   RICIAMALLCSPKLLIADEPTTALDVSVQYQILQLLKTLQKKTGMSLLIITHNMGVVAE
FT                   TADDVLVLYAGRMVECAPAVQMFHNPSHPYTRDLLASRPSLQPQQLGSFNPIPGQPPHY
FT                   TAFPSGCRYHPRCSKILNRCSAEAPEIYPVREGHKVRCWLYDD"
FT   gene            763270..764244
FT                   /gene="dppF"
FT                   /locus_tag="CpB0710"
FT   CDS_pept        763270..764244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="CpB0710"
FT                   /product="dipeptide transport protein"
FT                   /note="similar to dipeptide transport protein dppF -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98639"
FT                   /protein_id="AAP98639.1"
FT                   /translation="MTTNFPQPLIQATSLTKHYYKRSFWFQGKTIASRPVDDVSFSLYS
FT                   RRAVGLIGESGSGKSTLALALAGLLPLTSGFLTFNGTPIKLHSKHGRHQLRSQVRLVFQ
FT                   NPQASLNPRKTILDSLGHSLLYHKLVPKEKVLATVREYLELVGLSEEYFYRYPHQLSGG
FT                   QQQRVSIARALLGVPQLIICDEIVSALDLSIQAQILNMLAELQKKLSLTYLFISHDLAV
FT                   VRSFCTEVFIMYKGQIVEKGNTKRIFSDPQHPYTRMLLNAQLPETPDQRQSKPIFQEYH
FT                   KDSEESCSTGCYFYNRCPQKQEACKSEIIPNQGDAHHTYRCIH"
FT   gene            764316..764519
FT                   /locus_tag="CpB0712"
FT   CDS_pept        764316..764519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98640"
FT                   /protein_id="AAP98640.1"
FT                   /translation="MMFDFMLARAFRAANTIVNTKQKPFHIHGMATLRPNATSILNIKE
FT                   DALSLGTVGSFASTASIKIDSH"
FT   gene            complement(764500..765360)
FT                   /gene="spoOJ"
FT                   /locus_tag="CpB0711"
FT   CDS_pept        complement(764500..765360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoOJ"
FT                   /locus_tag="CpB0711"
FT                   /product="Soj antagonist"
FT                   /note="similar to Soj antagonist, chromosome positioning
FT                   and transport protein spo0J - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98641"
FT                   /db_xref="GOA:Q9Z7M0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7M0"
FT                   /protein_id="AAP98641.1"
FT                   /translation="MTEEISKDTIIEVAIDDIRVSPFQPRRVFSNEELQELIASIKAVG
FT                   LIHPPVVREICTGDRVLYYELIAGERRWRAMQLAGATTIPVILKHVIADGTAAEATLIE
FT                   NIQRVNLNPIEMAEAFKRLIHVFGLTQDKVAYKVGKKRSTVANYLRLLALSKTIQESLL
FT                   QGQITLGHAKVILTLEDPILREKLNEIIIQEHLAVREAELIAKQLISEEGSSIELKPTP
FT                   LDMAESSKQHEELQQRLSDLCGYKVQIKTRGSKATVSFHLQNTQDLQKLEAWLSSHGTL
FT                   SESLS"
FT   gene            complement(765495..765683)
FT                   /locus_tag="CpB0713"
FT   CDS_pept        complement(765495..765683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98642"
FT                   /protein_id="AAP98642.1"
FT                   /translation="MMRGGRLFRVYQELFFFSSVYVCEQRRPRKLYPSLQHLNFPIEKP
FT                   RFLLKGFKKELHFYNHV"
FT   gene            765886..766539
FT                   /locus_tag="CpB0714"
FT   CDS_pept        765886..766539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0714"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT482 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98643"
FT                   /protein_id="AAP98643.1"
FT                   /translation="MQKLVHNIWKKFYSFSSAIAICIVLASFLSLKIVSNTYKHSQAKR
FT                   NSILLLTRAAEVAVSQGFLPSKSALSSLEQAYHLGGESMKPYAGFLASCFYIHNEPLRG
FT                   AYYAGLAYNNSQALQLPHPIQKLLKEISEAQADQLYDVALSKSYQLLQTANSSPEYPTL
FT                   SFLTLLRVIELKELLHQDVSQDFAALKSSPLFHQFERMYSDGEWTLSKRFGKKG"
FT   gene            766848..767462
FT                   /locus_tag="CpB0715"
FT   CDS_pept        766848..767462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0715"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT481 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98644"
FT                   /protein_id="AAP98644.1"
FT                   /translation="MLTFDFASFDFYTNIFPFLEEQKIPAVVGVASRYIPSNAAQDLHP
FT                   SHRLKPSETLAFQDEIFSNYMPFCCQNELIEMAKSPYIQLASSGFAIRNLMNNPPYLTT
FT                   EILLSRHHIETITGAKPLAFLFPFGKSDPTSRKLAADHYPYSFLLGNTINRKLKTHNIY
FT                   RLDIKPMQYVCPSLFQSSRYLKNWIKEKSKQLYLKKQLPKR"
FT   gene            complement(767506..768726)
FT                   /locus_tag="CpB0716"
FT   CDS_pept        complement(767506..768726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0716"
FT                   /product="putative NifS-related protein"
FT                   /note="similar to probable nifS-related protein - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98645"
FT                   /db_xref="GOA:Q9Z7L5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7L5"
FT                   /protein_id="AAP98645.1"
FT                   /translation="MKNLKEDFPIFAAKAKENEPFIYLDSAATTQKPQQVIDAVANFYT
FT                   SSYATVNRAIYSSSRNVTEAYAAVREKVRKWVSAASDSEIVFTRGTTAGLNLLAISVND
FT                   LWIPKGGVVLVSEAEHHANVLSWEIACRRRGSLVKKIRVHDSGLIDLDDLEKLLNEGAQ
FT                   FVSIPHVSNVTGCVQPLQQVAELVHRYDAYLAVDGAQGAPHLPIDVQLWDVDFYVFSSH
FT                   KIYGPTGIGVLYGKKDLLDQLPPVEGGGDMVAIYDHQNPEYLPAPMKFEAGTPNIAGVL
FT                   GLGAALDYLDGLSAKFIYDKEIALTTYLHKELLEIPGVEILGPSIEEPRGALIGMTIDG
FT                   AHPLDLGFLLDLRGIAVRTGHQCAQPAMERWNVGHVLRVSLGIYNDEDDIDQFILVLQD
FT                   SLDKIRR"
FT   gene            complement(768755..770020)
FT                   /locus_tag="CpB0717"
FT   CDS_pept        complement(768755..770020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0717"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="similar to probable ABC transporter membrane protein
FT                   - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98646"
FT                   /protein_id="AAP98646.1"
FT                   /translation="MLRGDKVLVSIETFSSIASGSPVQKAAEACYTQYSKQPSSKEVLS
FT                   SFSWIQELSLFPDRYNLATGASELIKQHWLHNNHSLAFECILINGKYEPSLSQLPEGVI
FT                   VCGIDEARGSLSSFMQGFDVNKHPLAFLNAVCSEDRGVVIYIPEEMQTSDPIFVRHISF
FT                   PTVSDHDVIFSPRIVVILGQRASAQIQISHDVDLEMVGSSKTIVNGVTELFVGEGADLT
FT                   VFMVPGYSEEDTLSWSTIATVEKDAICRMTQNLLESCQGFGWFDNTSYIVGKKGHAESL
FT                   VLVQSPRKTWVNNLMSHDAEETVSRQNIKSILYSGHFLFEGTISISSQGDLSDANQKHD
FT                   TLLLSSEARVSTFPRLEIETDEVKASHGATVGPLDPQQIFYMRSRGMTEAEAQEKLIHG
FT                   FLKQGLVSDTFLGSSFQLNQTS"
FT   gene            complement(770004..770774)
FT                   /locus_tag="CpB0718"
FT   CDS_pept        complement(770004..770774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0718"
FT                   /product="ABC transporter ATPase"
FT                   /note="similar to ABC transporter ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98647"
FT                   /protein_id="AAP98647.1"
FT                   /translation="MLKIKHLHASCNDVKILDDFNLNIQPGTMHVIMGPNGAGKSTLAK
FT                   ILAGDESVLVSSGEIALQEQNLLSMLPEERSRAGLFVGFQMPPEIPGVNNKMFLRDAYN
FT                   ARRRANQEGDISIDEFNTLLSTVLETYEYNATTDLFLDRNVNEGFSGGERKRNEICQML
FT                   VLEPEMVLLDEPDSGLDVDALRLICRVLEKYRELHPTSSLCIVTHNPKLGNLIRPDVVH
FT                   LLLDGRVALSGDVSLMHELEAKSYQEVTKRVAWR"
FT   gene            complement(770780..772234)
FT                   /locus_tag="CpB0719"
FT   CDS_pept        complement(770780..772234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0719"
FT                   /product="putative ABC transporter"
FT                   /note="similar to probable ABC transporter - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98648"
FT                   /protein_id="AAP98648.1"
FT                   /translation="MGESVKVFLEEREDYPYGFVTPIESQGLTRGLSEETIEEIAALRN
FT                   EPQFIIDFRLQAYRYWKQLHEPAWARLHYGPIAYDDIVYFSSPKQKKPLGRLEDADPEI
FT                   LDTFKKLGIPLDEQKRLLNVENVAVDLVFDSVSIGTTFKEALEKAGVIFCSLGEAIQEH
FT                   PNLVKKYLGSVVSHRDNFFAALNAAVFSDGSFVYVPKGVKCPMDISTYFRINNKEAGQF
FT                   ERTLIVVEDGGYASYLEGCTAPAYSSNQLHAAVVELVAHEHAVIRYSTVQNWYAGDKKT
FT                   GKGGIYNFVTKRGLCAGYRSKISWSQVEVGAAITWKYPSCILKGDESVGEFYSVALTSG
FT                   KMQADTGTKMLHVGKRTTSTVISKGISSDESKNTFRSLVSLGKKAEHSSNYTQCDSMLI
FT                   GKASGAYTDPKIVVENSTSSIEHEATTSKLREDQLLYLRSRGLSPEEAVSLVIHGFCRE
FT                   IIEQLPLEFAQEASKLLLIKLENSVG"
FT   gene            complement(772559..773578)
FT                   /locus_tag="CpB0720"
FT   CDS_pept        complement(772559..773578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0720"
FT                   /product="UDP-N-acetylglucosamine--peptide
FT                   N-acetylglucosaminyltransferase"
FT                   /note="similar to UDP-N-acetylglucosamine--peptide
FT                   N-acetylglucosaminyltransferase - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98649"
FT                   /protein_id="AAP98649.1"
FT                   /translation="MEEAAKHLAKEFLCSGINLFLSGEYEQAEKRLKETLELDSTAALA
FT                   YCYLGIIALETGRVSEALNWCSKGLASEPGDSYLRYCYGVALDRGNQYEAAIEQYSAYV
FT                   ALHPDDVECWFSLGSVYHRLKRLQEALDCFDKILALDPWNPQSLYNKAVILSEMDDEAE
FT                   SIRLLEVAVAKNPLYWKAWVKLGFLLSRSKRWDKATEAYERVVQLRPDLSDGHYNLGLC
FT                   YLTLDKTRLALKAFQEALFLNAEDADAHFYVGLAHLDLKQMREAYEAFNSALSINLEHE
FT                   RAHYLLGYLHHMQGETDKATKELLFLQKKDSTFAPLLQKTVVSDPSSMQFERRLDTIS"
FT   gene            complement(773649..776921)
FT                   /locus_tag="CpB0721"
FT   CDS_pept        complement(773649..776921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0721"
FT                   /product="penicillin-binding protein 2"
FT                   /note="similar to penicillin-binding protein 2 -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98650"
FT                   /protein_id="AAP98650.1"
FT                   /translation="MKRPKKFPIYLSIAQKTNRLLSGIVIAFAVIALRLWYLAVVEHEQ
FT                   KLEEAYKPQIRVLPQYVERATICDRFGKTLAVNQLQYDVSVAYGAIRDLPTRAWRVDEH
FT                   GHKQLIPVRKHYIMCLSELLSQELHLDREAIEDAIHAKASVLGSVPYLVAANVSERTYL
FT                   KLKMLSKDWPGLHVEAVVRRHYPQESVASDILGYVGPISLQEYKRVTQELSQLRECVRA
FT                   YEEGEDPKLPEGLASIDQVRALLESVESNAYSLNALVGKMGVEACWDSKLRGKIGKKPI
FT                   LVDRRGNFIQEMEGAVPEAPGTKLQLTLSAELQAYADALLLEYEKTETFRSAKSLKKRE
FT                   KLPPLFPWIKGGAIIALDPNNGEILAMASSPRYRNNDFVNAKVAEDSKAVRSSIYRWLE
FT                   NKEHIAEIYDRKVPLIRERRNPLTGLCYEEILPLTFDCFLDFLFPENSVIKLQLKRNSF
FT                   VGQAIEVQNLVTRLLSLFPYEEGTCPCSAIFDAVFPNEEGHILIQEVISLREQKWIMEC
FT                   LNQHKADIEELKEALDQVFNELPANYDKILYTDILRLIVDPERFSPVLPSEVHRLSLSE
FT                   FTELQGRYVVLRSAFSTILEDAFIEVHFKSWRKSEFLQYLAAKRQEEALRKQRYPTPYV
FT                   DYLEEEKTRQYKMFCQEHLDTFLAYLFSKTPYKEGLEPYYDILDLWINELDNGAHRALS
FT                   WHEHYLFLKERVSHLSEHLPALFSTFREFNELQRPLLGKYPISIVRNKRQTEQDLAASF
FT                   YPVYGYGYLRPHAYGQAATLGSIFKLVSAYSVLSQRILWGHNEEPANPLVIIDKNSFGY
FT                   RSSKPHVGFFKDGTPIPTFFRGGSLPGNDFMGRGFIDLVSALEMSSNPYFSLLVGEGLG
FT                   DPEDLADAASLFGFGEKTGLGLPGEYAGRVPHDLAYNRSGLYATAIGQHTLVVTPLQTA
FT                   VMLASLVNGGVVYVPKLLLGEWEGEHVSYLSSKKKRTIFMPDAVVEVLKTGMRNVIWGQ
FT                   YGTARAIQSQFPPQLLSRIIGKTSTAESIMRVGLDREYGTMKMKDIWFAAVGFSDQDLS
FT                   LPTIVVIVYLRLGEFGRDAAPMAVKMIDMWEKIQQRESFLRG"
FT   gene            777538..778707
FT                   /locus_tag="CpB0722"
FT   CDS_pept        777538..778707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0722"
FT                   /product="major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98651"
FT                   /db_xref="GOA:P27455"
FT                   /db_xref="InterPro:IPR000604"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27455"
FT                   /protein_id="AAP98651.1"
FT                   /translation="MKKLLKSALLSAAFAGSVGSLQALPVGNPSDPSLLIDGTIWEGAA
FT                   GDPCDPCATWCDAISLRAGFYGDYVFDRILKVDAPKTFSMGAKPTGSAAANYTTAVDRP
FT                   NPAYNKHLHDAEWFTNAGFIALNIWDRFDVFCTLGASNGYIRGNSTAFNLVGLFGVKGT
FT                   TVNANELPNVSLSNGVVELYTDTSFSWSVGARGALWECGCATLGAEFQYAQSKPKVEEL
FT                   NVICNVSQFSVNKPKGYKGVAFPLPTDAGVATATGTKSATINYHEWQVGASLSYRLNSL
FT                   VPYIGVQWSRATFDADNIRIAQPKLPTAVLNLTAWNPSLLGNATALSTTDSFSDFMQIV
FT                   SCQINKFKSRKACGVTVGATLVDADKWSLTAEARLINERAAHVSGQFRF"
FT   gene            778933..779003
FT                   /locus_tag="CpBt23"
FT   tRNA            778933..779003
FT                   /locus_tag="CpBt23"
FT                   /product="tRNA-Gly"
FT                   /note="TCC"
FT   gene            779091..779924
FT                   /locus_tag="CpB0723"
FT   CDS_pept        779091..779924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0723"
FT                   /product="ribosomal protein S2"
FT                   /note="similar to ribosomal protein S2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98652"
FT                   /db_xref="GOA:Q9Z7K9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K9"
FT                   /protein_id="AAP98652.1"
FT                   /translation="MESQSCKLTIKDLMSAGAHFGHQTRRWNPKMKLYIFEEKNGLYII
FT                   NLAKTLQQLRNALPHIRKVIQDNKTVLFVGTKKQAKCVIREAAIEAGEFFIAERWLGGM
FT                   LTNMTTIRNSIKTLDKIEKDLSRNQAYLTKKEAALLAKRHQKLLRNLEGIRYMKKAPGL
FT                   LVVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPIDHVIPCNDDSLKSIRLIINVIKE
FT                   NIIEAKHKLGIEIVSPVKSLEVPDLSAFESSQDDESDEENREEDLLAKKFDGEAN"
FT   gene            779924..780772
FT                   /locus_tag="CpB0724"
FT   CDS_pept        779924..780772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0724"
FT                   /product="translation elongation factor EF-Ts"
FT                   /note="Tsf; similar to translation elongation factor EF-Ts
FT                   tsf - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98653"
FT                   /db_xref="GOA:Q9Z7K8"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K8"
FT                   /protein_id="AAP98653.1"
FT                   /translation="MSDFSMETLKTLRQQTGVGLTKCKEALEACGGNLEEAVVYLRKLG
FT                   LASAGKKEHRETKEGIIAAKTDANGTALIEVNVETDFVANNAVFREFVSNLLNDILKYK
FT                   VDTVEALSQAASSQDPSLSVDELRAVTMQTVGENIRISRVAYFPKATNSTVGIYSHGNG
FT                   KTVALTMLSGSSTADSLAKDIAMHVVAAQPQFLSKESVPAEAIAKEKEVIASQIQGKPQ
FT                   EVIEKIVTGKLNTFFQEACLLEQPFIKNADLSIQSLIDDFSKTSGSSVAIEQFILWKIG
FT                   A"
FT   gene            780780..781526
FT                   /locus_tag="CpB0725"
FT   CDS_pept        780780..781526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0725"
FT                   /product="UMP kinase"
FT                   /note="similar to UMP kinase - Chlamydia trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98654"
FT                   /db_xref="GOA:Q9Z7K7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K7"
FT                   /protein_id="AAP98654.1"
FT                   /translation="MAKQTRRVLFKISGEALSKDSSNRIDEMRLSRLVSELRAVRNNDI
FT                   EIALVIGGGNILRGLAEQKELQINRVSADQMGMLATLINGMAVADALKAEDIPCLLTST
FT                   LSCPQLADLYTPQKSIEALDQGKILICTTGAGSPYLTTDTGAALRACELNVDVLIKATM
FT                   HVDGVYDKDPRLFPDAVKYDFVSYKDFLSNQLGVMDASAISLCMDSHIPIRVFSFLQHS
FT                   LEKALFDPTIGTLVSEDVNHVCSPRH"
FT   gene            781504..782046
FT                   /locus_tag="CpB0726"
FT   CDS_pept        781504..782046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0726"
FT                   /product="ribosome releasing factor"
FT                   /note="similar to ribosome releasing factor - Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98655"
FT                   /db_xref="GOA:Q9Z7K6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K6"
FT                   /protein_id="AAP98655.1"
FT                   /translation="MSVLQDTEKKMAAALDFFHKEVKSFRTGKAHPALVETVVVDVYGT
FT                   TMRLSDIASISVADLRQLVISPYDGNNASAIAKGIIAANLNLQPEVEGSIIRIKVPEPT
FT                   ADYRQEMIKQLRRKCEEAKINVRNIRREANDKLKKDSALTEDVVKGNEKKIQELTDKFC
FT                   KQLDELTKQKEAEIASI"
FT   gene            782145..782219
FT                   /locus_tag="CpBt24"
FT   tRNA            782145..782219
FT                   /locus_tag="CpBt24"
FT                   /product="tRNA-Glu"
FT                   /note="TTC"
FT   gene            782245..782317
FT                   /locus_tag="CpBt25"
FT   tRNA            782245..782317
FT                   /locus_tag="CpBt25"
FT                   /product="tRNA-Lys"
FT                   /note="TTT"
FT   gene            782419..782934
FT                   /locus_tag="CpB0727"
FT   CDS_pept        782419..782934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0727"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT676 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98656"
FT                   /protein_id="AAP98656.1"
FT                   /translation="MVHSPTHQCYHCQQPATICYTEIDKDKVIRSYVCATCPCPSHYYN
FT                   NEHLSLSKGVGVLTLECGNCKTVWHSKQDDEQLLGCHQCYTNFKNQITSKLKSERVVSS
FT                   SFTMEKGQGSLHIGRAPGEASNTNPLLKLIALNEALQDTLEREDYEQAAVIRDQINHLK
FT                   TKNPDDPS"
FT   gene            782921..783997
FT                   /locus_tag="CpB0728"
FT   CDS_pept        782921..783997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0728"
FT                   /product="arginine kinase"
FT                   /note="similar to arginine kinase - Limulus polyphemus"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98657"
FT                   /db_xref="GOA:Q9Z7K4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K4"
FT                   /protein_id="AAP98657.1"
FT                   /translation="MTLPNDLLETLVKRKESPQANKVWPVTTFSLARNLSVSKFLPCLS
FT                   KEQKLEILQFITSHFNHIEGFGEFIVLPLKDTPLWQKEFLLEHFLLPYDLVGNPEGEAL
FT                   VVSRSGDFLAAINFQDHLVLHGIDFQGNVEKTLDQLVQLDSYLHSKLSFAFSSEFGFLT
FT                   TNPKNCGTGLKSQCFLHIPALLYSKEFTNLIDEEVEIITSSLLLGVTGFPGNIVVLSNR
FT                   CSLGLTEELLLSSLRITASKLSVAEVAAKKRLSEENSGDLKNLILRSLGLLTHSCQLEL
FT                   KETLDALSWIQLGIDLGLIKVTENHPLWNPLFWQIRRAHLALQKQAEDSRDLQKDTISH
FT                   LRASVLKELTKGLSPESF"
FT   gene            complement(784031..784103)
FT                   /locus_tag="CpBt26"
FT   tRNA            complement(784031..784103)
FT                   /locus_tag="CpBt26"
FT                   /product="tRNA-Thr"
FT                   /note="CGT"
FT   gene            complement(784248..787007)
FT                   /locus_tag="CpB0729"
FT   CDS_pept        complement(784248..787007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0729"
FT                   /product="outer membrane secretion protein Q"
FT                   /note="similar to outer membrane secretion protein Q -
FT                   Pseudomonas alcaligenes"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98658"
FT                   /protein_id="AAP98658.1"
FT                   /translation="MKTVILNIGRKILQGIKKKKKKIGILSGLFFLDLVLLGVSSQRPT
FT                   ETSANVKHNLRDEKLAACPKNSAASLSAKKSHTKKTTPGSIPSKVFSKFDATQDKTFQK
FT                   TSGSAFPAKPTTLKELEERKKPRPERRTTADVKRSPRFLPTQEVEEPVPAASKEQLDSI
FT                   QVWEEKQNYARRAVNAINLSIKKQLEEQTSTVTEKDVQPKTQATPHASKKNVASPSTSM
FT                   PGIEKAATTVAVPQDKSEEEKVKERLTKRELTCEDLKDNGYTVNFEDISILELLQFVSK
FT                   ISGTNFVFDSNDLQFNVTIVSHDPTSVDDLSTILLQVLKMHDLKVVEQGNNVLIYRNPH
FT                   LSKLSTVVTDSSLKETCEAVVVTRVFRLYSVSPSAAVNIIQPLLSHDAIVSASEATRHV
FT                   IISDIAGNVDKVSDLLAALDCPGTSVDMTEYEVKYANPAALVSYCQDVLGTLAEDDAFQ
FT                   MFIQPGTNKIFVVSSPRLANKAEQLLKSLDVPEMAHTLDDPASTALALGGTGTTSPKSL
FT                   RFFMYKLKYQNGEVIANALQDIGYNLYVTTAMDEDFINTLNSIQWLEVNNSIVIIGNQG
FT                   NVDRVIGLLNGLDLPPKQVYIEVLILDTSLEKSWDFGVQWVALGDEQSKVAYASGLLNN
FT                   TGIATPTKATVPPGTPNPGSIPLPTPGQLTGFSDMLNSSSAFGLGIIGNVLSHKGKSFL
FT                   TLGGLLSALDQDGDTVIVLNPRIMAQDTQQASFFVGQTVPYQTTNTIIQETGTVTQNID
FT                   YEDIGVNLVVTSTVAPNNVVTLQIEQTISELHSASGSLTPVTDKTYAATRLQIPDGCFL
FT                   VMSGHIRDKTTKVVSGVPLLNSIPLIRGLFSRTIDQRQKRNIMMFIKPKVISSFEEGTR
FT                   VTNKEGYRYNWEADEGSMQVAPRHAPECQGPPSLQAESDFKIIEIEAQ"
FT   gene            complement(787004..788512)
FT                   /locus_tag="CpB0730"
FT   CDS_pept        complement(787004..788512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0730"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="similar to serine/threonine-protein kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98659"
FT                   /protein_id="AAP98659.1"
FT                   /translation="MDCRGGIPLPEPQVIGGYHVKKILSKKLRSRVVHGLHPETRHSTV
FT                   IKVFSPSPSFTSRSVYNFLKEAQSLHQITHPNIVKFHRYGKWQDCLYIAMEYIEGISLR
FT                   EYILAQFISLPQAIDIIFDIAQALEHLHSRNILHKDIKPENILITPQGKIKLIDFGLAD
FT                   WDTEIQRAHPSVIGTPYYMSPEQRQGESHSPASDIYALGLLAYELILGHLSLGRVFLSL
FT                   VPERISKILAKALQPSPNNRYSSTREFIQDIHHYRMSGDMQEDLRIKDHTVALYEQLQT
FT                   QRFWLAPETLRFPDFISGVLYHQGYPLYPHAYDTLLEGDVFNLWLGYSPISNATIALSV
FT                   VKSLVCQQDLQRPLLDRVCEINECLIRMKIPIDEMGISILCLEISKENKELSWVACGKT
FT                   VFWIKRQGRVVQDFESFSPGLGKITSLQIRETKVAWEIGDEAVVCTLELEESVASLKTL
FT                   SLAELQDRRQKAIFCPIESIHGGIQSRQHGSNSPSTLISLKRIR"
FT   gene            complement(788528..789643)
FT                   /gene="fliN"
FT                   /locus_tag="CpB0731"
FT   CDS_pept        complement(788528..789643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CpB0731"
FT                   /product="flagellar motor switch protein"
FT                   /note="similar to flagellar motor switch protein fliN -
FT                   Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98660"
FT                   /protein_id="AAP98660.1"
FT                   /translation="MAVAADSSASWLKSRNNFLSSLGKTEEQVAAPEFPKELCQHKIRE
FT                   KFRLEDVQVSIKFRGSITAVEATKEFGVHLLIQPMVVQPWEVENLLFLTSEEDLQELMV
FT                   AVFDDASLASYFYEKDKLLGFHYYFVAEACKLFEELQWVPSLSAKVGGDAIFTATSLQG
FT                   SFQVVDISLRLDGKNVRCRLLLPEDTFQSCQKFFSGLHDESDLHNIDQTQQISLSVEVG
FT                   YSQLTQEEWHQVVPGSFIMLDSCLYDPETEESGALLTVQKHQFFGGRFLTPSSGEFKIT
FT                   SYPNLTHEDPPLPENPQASAAPLPGYSRLVVEVARYSLAVSEFIKLNLGSILSLGNHPA
FT                   YGVDIILDGAKVGRGEIIALGDVLGIRVLEV"
FT   gene            complement(789653..790495)
FT                   /locus_tag="CpB0732"
FT   CDS_pept        complement(789653..790495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0732"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT671 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98661"
FT                   /db_xref="InterPro:IPR035359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7K0"
FT                   /protein_id="AAP98661.1"
FT                   /translation="MELKKTAESLYSAKTDNHTVYQNSPEPRDSRDVKVFSLEGKQTRQ
FT                   EKTTSSKGNTRTESRKFADEEKRVDDEIAEVGSKEEEQESQEFCLAENAFAGMSLIDIA
FT                   AAGSAEAVVEVAPIAVSSIDTQWIENIILSTVESMVISEINGEQLVELVLDASSSVPEA
FT                   FVGANLTLVQSGQDLSVKFSSFVDATQMAEAADLVTNNPSQLSSLVSALKGHQLTLKEF
FT                   SVGNLLVQLPKIEEVQTPLHMIASTIRHREEKDQRDQNQKQKQDDKEQDSYKIEEARL"
FT   gene            complement(790499..791005)
FT                   /locus_tag="CpB0733"
FT   CDS_pept        complement(790499..791005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0733"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT670 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98662"
FT                   /protein_id="AAP98662.1"
FT                   /translation="MAKYPLEPVLAIKKDRVDRAEKVVKEKRRLLEIEQEKLREKEAER
FT                   DKVKNHYMQKIQQLRDLLDEGTTSDAVLQIKSYIKVVAVQLSEEEEKVNKQKEVVLAAS
FT                   KELEKAEVNLAKRRKEEEKTRLHKEEWMKEALKEEARAEEKEQDEMGQLLFQLRQKKKR
FT                   ESGGS"
FT   gene            complement(791023..792351)
FT                   /gene="yopN"
FT                   /locus_tag="CpB0734"
FT   CDS_pept        complement(791023..792351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yopN"
FT                   /locus_tag="CpB0734"
FT                   /product="YopN"
FT                   /note="flagellar-type ATPase; similar to yopN
FT                   (flagellar-type ATPase) proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98663"
FT                   /protein_id="AAP98663.1"
FT                   /translation="MDQLTTDFDTLMSQLGDVNLTTVVGRITEVVGMLIKAVVPNVRVG
FT                   EVCLVKRNGMEPLVTEVVGFTQSFAFLSPLGELSGVSPSSEVIPTGLPLHIRAGNGLLG
FT                   RVLNGLGEPIDVETKGPLQNVDQTFPIFRAPPDPLHRAKLRQILSTGVRCIDGMLTVAR
FT                   GQRIGIFAGAGVGKSSLLGMIARNAEEADVNVIALIGERGREVREFIEGDLGEEGMKRS
FT                   VIVVSTSDQSSQLRLNAAYVGTAIAEYFRDQGKTVVLMMDSVTRFARALREVGLAAGEP
FT                   PARAGYTPSVFSTLPRLLERSGASDKGTITAFYTVLVAGDDMNEPVADEVKSILDGHIV
FT                   LSNALAQAYHYPAIDVLASISRLLTAIVPEEQRRIIGKAREVLAKYKANEMLIRIGEYR
FT                   RGSDREIDFAIDHIDKLNRFLKQDIHEKTNYEEAAQQLRAIFR"
FT   gene            complement(792353..793027)
FT                   /locus_tag="CpB0735"
FT   CDS_pept        complement(792353..793027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0735"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT668 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98664"
FT                   /protein_id="AAP98664.1"
FT                   /translation="MIDPVECFPNLDGDAEAQSITQNSGTPLASELKKDISPFALGSYA
FT                   APKDTTLVQGFKPNPMAMMQDQNSNLIDPELQEALESEELQEQINNLKGRLWDFRSTFE
FT                   DSQTTAQFADEHFQAVGVIIDLINEDLNTIAEHTQQDARKEDKEEGSVTRKIIDWVSSG
FT                   EEVLNRALLYFSDRDGNRESLANFLKVQYAVQRATQRAELFASIVGTSVSSVKTIMTTQ
FT                   LG"
FT   gene            complement(793061..793510)
FT                   /locus_tag="CpB0736"
FT   CDS_pept        complement(793061..793510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0736"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT667 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98665"
FT                   /protein_id="AAP98665.1"
FT                   /translation="MADLEVFQADFALLFEAGLLAIKQGDEDSARKLFQSLHILNPNHY
FT                   GHDLGLALISLHKMDLFDAEERLSALIKGNEDNWSIKAFLSLTHMLIVLHQGSSFEVRR
FT                   ESLESCLKFADQVIANCKIESTRALAQSVLDWHDTLVAKSAGPLG"
FT   gene            complement(793529..793783)
FT                   /locus_tag="CpB0737"
FT   CDS_pept        complement(793529..793783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0737"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT666 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98666"
FT                   /db_xref="InterPro:IPR035365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7J5"
FT                   /protein_id="AAP98666.1"
FT                   /translation="MATNKSCTAFDFNKMLDGVCTYVKGVQQYLTELETSTQGTVDLGT
FT                   MFNLQFRMQILSQYMESVSNILTAVNTEMITMARAVKGS"
FT   gene            complement(793805..794092)
FT                   /locus_tag="CpB0738"
FT   CDS_pept        complement(793805..794092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0738"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT665 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98667"
FT                   /db_xref="InterPro:IPR035336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7J4"
FT                   /protein_id="AAP98667.1"
FT                   /translation="MGFINYLYLGRYSMFNMENTAKEEKNSQPLLDLEQDMQDHDRAQE
FT                   LKASVQDKVHKLHALLREGSDKESFGQQQSLLAGYVALQKVLGRINRKMI"
FT   gene            complement(794100..796622)
FT                   /locus_tag="CpB0739"
FT   CDS_pept        complement(794100..796622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0739"
FT                   /product="Forkhead domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98668"
FT                   /protein_id="AAP98668.1"
FT                   /translation="MAVRLIVDEGPLSGVIFVLEDGISWSIGRDSSANDIPIEDPKLGA
FT                   SQAIINKTDGSYYITNLDDTIPIVVNGVAIQETTQLKNEDTILLGSNQYSFLSDEFDPQ
FT                   DLVYDFDIPEDNFSNDSGDLSDSNEQGKDLEPRQTSETNHSPKPKEKLTKDQGSSDPIT
FT                   SGDQELADAFLASAKAEKNQPRAKVAKKGLKESSNESLNPKEQNAKDSPKGEERTNKPQ
FT                   NAIMEDNGASPRQDPQPKSAEPSLKNTARDETPLKENKPVEEKANKKATPDSPEKKDQP
FT                   EEGSKIEATPLDSQKESEDKEAEEAFVQEEEENLTEDNKEDSDSAADANDDTASDHTAE
FT                   DNKETPKKVENEKSAVLSPFHVQDLFRFDQTIFPAEIDDIAKKNISVDLTQPSRFLLKV
FT                   LAGANIGAEFHLDSGKTYILGTDPTTCDIVFNDLSVSHQHAKITVGNDGGILIEDLDSK
FT                   NGVIVEGRKIDKTSTLSSNQVVALGTTLFLLIDHHAPADTIVASLSPDDYSLFGRQQDA
FT                   EALERQEAQEEEEKQKRATLPAGSFILTLFVGGLAILFGIGTASLFHTKEVVPLENIDY
FT                   QEDLAQVINQFPTVRYTFNKTNSQLFLIGHVKNSTDKSELLYKVDALSFVKSVDDNVID
FT                   DEAVWQEMNILLSKRPEFKGISMHSPEPGKFIITGYVKTEEQAACLVDYLNIHFNYLSL
FT                   LENKVVVETQMLKAIAGHLLQGGFANIHVAFVNGEVILTGYVNNDDAEKFRAVVQELSG
FT                   IPGVRLVKNFAVLLPAEEGIIDLNLRYPNRYRVTGYSRYGEISINVVVNGRILTRGDVI
FT                   DGMTVTSIQPNAIFLEKEGLKYKIDYNK"
FT   gene            complement(796636..797043)
FT                   /locus_tag="CpB0740"
FT   CDS_pept        complement(796636..797043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0740"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CT663 - Chlamydia
FT                   trachomatis"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98669"
FT                   /db_xref="GOA:Q9Z7J2"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7J2"
FT                   /protein_id="AAP98669.1"
FT                   /translation="MENTSMLEKLIKNFATYMGITSTLELDADGAYVLPISEVVKVRAQ
FT                   QNADNEIVLSASLGALPPSADTAKLYLQMMIGNLFGRETGGSALGLDSEGNVVMVRRFS
FT                   GDTTYDDFVRHVESFMNFSETWLSDLGLGKQ"
FT   gene            complement(797395..798414)
FT                   /locus_tag="CpB0741"
FT   CDS_pept        complement(797395..798414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0741"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="similar to glutamyl-tRNA reductase - Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98670"
FT                   /db_xref="GOA:Q9Z7J1"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z7J1"
FT                   /protein_id="AAP98670.1"
FT                   /translation="MVLGVVGISYREAALKERERAIQYLQSFEKNLFLAQRFLGKGGAF
FT                   IPLLTCHRAELYYYSESPEIAQAALLSELTSQGIRPYRHRGLSCFTHLFQVTSGIDSLI
FT                   FGETEIQGQVKRAYLKGSKERELPFDLHFLFQKALKEGKEYRSRIGFPDHQVTIESVVQ
FT                   EILLSYDKSIYTNFLFVGYSDINRKVAAYLYQHGYHRITFCSRQQVTAPYRTLSRETLS
FT                   FRQPYDVIFFGSSESASQFSDLSCESLASIPKRIVFDFNVPRTFLWKETPTGFVYLDID
FT                   FISECVQKRLQCTKEGVNKAKLLLTCAAKKQWEIYEKKSSHITQRQISSPRIPSVLSY"
FT   gene            complement(798694..798912)
FT                   /locus_tag="CpB0742"
FT   CDS_pept        complement(798694..798912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98671"
FT                   /protein_id="AAP98671.1"
FT                   /translation="MLIYFAPRKGTSSTYKFRTKTKLMDLSLGNVSLSHELSFKLHIHP
FT                   LKSYHLRTESLELPEELKTHLTRTSFS"
FT   gene            798964..800772
FT                   /locus_tag="CpB0743"
FT   CDS_pept        798964..800772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CpB0743"
FT                   /product="DNA gyrase subunit B"
FT                   /note="similar to DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CpB0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAP98672"
FT                   /protein_id="