(data stored in ACNUC7421 zone)

EMBL: AE009441

ID   AE009441; SV 1; circular; genomic DNA; STD; PRO; 2222430 BP.
AC   AE009441; AE009746-AE009946;
PR   Project:PRJNA172;
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
DE   Pyrobaculum aerophilum str. IM2, complete genome.
KW   .
OS   Pyrobaculum aerophilum str. IM2
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermoproteaceae;
OC   Pyrobaculum.
RN   [1]
RP   1-2222430
RX   DOI; 10.1073/pnas.241636498.
RX   PUBMED; 11792869.
RA   Fitz-Gibbon S.T., Ladner H., Kim U.J., Stetter K.O., Simon M.I.,
RA   Miller J.H.;
RT   "Genome sequence of the hyperthermophilic crenarchaeon Pyrobaculum
RT   aerophilum";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(2):984-989(2002).
RN   [2]
RP   1-2222430
RA   Fitz-Gibbon S.T., Ladner H., Kim U.-J., Stetter K.O., Simon M.I.,
RA   Miller J.H.;
RT   ;
RL   Submitted (12-DEC-2001) to the INSDC.
RL   Microbiology and Molecular Genetics, University of California, Los Angeles,
RL   405 Hilgard Ave, Los Angeles, CA 90095-1489, USA
DR   MD5; 761ccf9e1b081fbfff69cee9acae3c56.
DR   BioSample; SAMN02604075.
DR   EnsemblGenomes-Gn; EBG00001182398.
DR   EnsemblGenomes-Gn; EBG00001182399.
DR   EnsemblGenomes-Gn; EBG00001182400.
DR   EnsemblGenomes-Gn; EBG00001182401.
DR   EnsemblGenomes-Gn; EBG00001182402.
DR   EnsemblGenomes-Gn; EBG00001182403.
DR   EnsemblGenomes-Gn; EBG00001182404.
DR   EnsemblGenomes-Gn; EBG00001182405.
DR   EnsemblGenomes-Gn; EBG00001182406.
DR   EnsemblGenomes-Gn; EBG00001182407.
DR   EnsemblGenomes-Gn; EBG00001182408.
DR   EnsemblGenomes-Gn; EBG00001182409.
DR   EnsemblGenomes-Gn; EBG00001182410.
DR   EnsemblGenomes-Gn; EBG00001182411.
DR   EnsemblGenomes-Gn; EBG00001182412.
DR   EnsemblGenomes-Gn; EBG00001182413.
DR   EnsemblGenomes-Gn; EBG00001182414.
DR   EnsemblGenomes-Gn; EBG00001182415.
DR   EnsemblGenomes-Gn; EBG00001182416.
DR   EnsemblGenomes-Gn; EBG00001182417.
DR   EnsemblGenomes-Gn; EBG00001182418.
DR   EnsemblGenomes-Gn; EBG00001182419.
DR   EnsemblGenomes-Gn; EBG00001182420.
DR   EnsemblGenomes-Gn; EBG00001182421.
DR   EnsemblGenomes-Gn; EBG00001182422.
DR   EnsemblGenomes-Gn; EBG00001182423.
DR   EnsemblGenomes-Gn; EBG00001182424.
DR   EnsemblGenomes-Gn; EBG00001182425.
DR   EnsemblGenomes-Gn; EBG00001182426.
DR   EnsemblGenomes-Gn; EBG00001182427.
DR   EnsemblGenomes-Gn; EBG00001182428.
DR   EnsemblGenomes-Gn; EBG00001182429.
DR   EnsemblGenomes-Gn; EBG00001182430.
DR   EnsemblGenomes-Gn; EBG00001182431.
DR   EnsemblGenomes-Gn; EBG00001182432.
DR   EnsemblGenomes-Gn; EBG00001182433.
DR   EnsemblGenomes-Gn; EBG00001182434.
DR   EnsemblGenomes-Gn; EBG00001182435.
DR   EnsemblGenomes-Gn; EBG00001182436.
DR   EnsemblGenomes-Gn; EBG00001182437.
DR   EnsemblGenomes-Gn; EBG00001182438.
DR   EnsemblGenomes-Gn; EBG00001182439.
DR   EnsemblGenomes-Gn; EBG00001182440.
DR   EnsemblGenomes-Gn; EBG00001182441.
DR   EnsemblGenomes-Gn; EBG00001182442.
DR   EnsemblGenomes-Gn; EBG00001182443.
DR   EnsemblGenomes-Gn; EBG00001182444.
DR   EnsemblGenomes-Gn; EBG00001182445.
DR   EnsemblGenomes-Gn; EBG00001182446.
DR   EnsemblGenomes-Gn; EBG00001182447.
DR   EnsemblGenomes-Gn; EBG00001182448.
DR   EnsemblGenomes-Gn; EBG00001182449.
DR   EnsemblGenomes-Gn; EBG00001182450.
DR   EnsemblGenomes-Gn; EBG00001182451.
DR   EnsemblGenomes-Gn; EBG00001182452.
DR   EnsemblGenomes-Gn; EBG00001182453.
DR   EnsemblGenomes-Gn; EBG00001182454.
DR   EnsemblGenomes-Gn; EBG00001182455.
DR   EnsemblGenomes-Gn; EBG00001182456.
DR   EnsemblGenomes-Gn; EBG00001182457.
DR   EnsemblGenomes-Gn; EBG00001182458.
DR   EnsemblGenomes-Gn; EBG00001182459.
DR   EnsemblGenomes-Gn; EBG00001182460.
DR   EnsemblGenomes-Gn; EBG00001182461.
DR   EnsemblGenomes-Gn; EBG00001182462.
DR   EnsemblGenomes-Gn; EBG00001182463.
DR   EnsemblGenomes-Gn; EBG00001182464.
DR   EnsemblGenomes-Gn; EBG00001182465.
DR   EnsemblGenomes-Gn; EBG00001182466.
DR   EnsemblGenomes-Gn; EBG00001182467.
DR   EnsemblGenomes-Gn; EBG00001182468.
DR   EnsemblGenomes-Gn; EBG00001182469.
DR   EnsemblGenomes-Gn; EBG00001182470.
DR   EnsemblGenomes-Gn; EBG00001182471.
DR   EnsemblGenomes-Gn; EBG00001182472.
DR   EnsemblGenomes-Gn; EBG00001182473.
DR   EnsemblGenomes-Gn; EBG00001182474.
DR   EnsemblGenomes-Gn; EBG00001182475.
DR   EnsemblGenomes-Gn; EBG00001182477.
DR   EnsemblGenomes-Gn; EBG00001182478.
DR   EnsemblGenomes-Gn; EBG00001182479.
DR   EnsemblGenomes-Gn; EBG00001182480.
DR   EnsemblGenomes-Gn; EBG00001182481.
DR   EnsemblGenomes-Gn; EBG00001182482.
DR   EnsemblGenomes-Gn; EBG00001182483.
DR   EnsemblGenomes-Gn; EBG00001182484.
DR   EnsemblGenomes-Gn; EBG00001182485.
DR   EnsemblGenomes-Gn; EBG00001182486.
DR   EnsemblGenomes-Gn; EBG00001182487.
DR   EnsemblGenomes-Gn; EBG00001182488.
DR   EnsemblGenomes-Gn; EBG00001182489.
DR   EnsemblGenomes-Gn; EBG00001182490.
DR   EnsemblGenomes-Gn; EBG00001182491.
DR   EnsemblGenomes-Gn; EBG00001182492.
DR   EnsemblGenomes-Gn; EBG00001182493.
DR   EnsemblGenomes-Gn; EBG00001182494.
DR   EnsemblGenomes-Gn; EBG00001182495.
DR   EnsemblGenomes-Gn; EBG00001182496.
DR   EnsemblGenomes-Gn; EBG00001182497.
DR   EnsemblGenomes-Gn; EBG00001182498.
DR   EnsemblGenomes-Gn; EBG00001182499.
DR   EnsemblGenomes-Gn; EBG00001182500.
DR   EnsemblGenomes-Gn; EBG00001182501.
DR   EnsemblGenomes-Gn; EBG00001182502.
DR   EnsemblGenomes-Gn; EBG00001182503.
DR   EnsemblGenomes-Gn; EBG00001182504.
DR   EnsemblGenomes-Gn; EBG00001182505.
DR   EnsemblGenomes-Gn; EBG00001182506.
DR   EnsemblGenomes-Gn; EBG00001182507.
DR   EnsemblGenomes-Gn; EBG00001182508.
DR   EnsemblGenomes-Gn; EBG00001182509.
DR   EnsemblGenomes-Gn; EBG00001182510.
DR   EnsemblGenomes-Gn; EBG00001182511.
DR   EnsemblGenomes-Gn; EBG00001182512.
DR   EnsemblGenomes-Gn; EBG00001182513.
DR   EnsemblGenomes-Gn; EBG00001182514.
DR   EnsemblGenomes-Gn; EBG00001182515.
DR   EnsemblGenomes-Gn; EBG00001182516.
DR   EnsemblGenomes-Gn; EBG00001182517.
DR   EnsemblGenomes-Gn; EBG00001182518.
DR   EnsemblGenomes-Gn; EBG00001182519.
DR   EnsemblGenomes-Gn; EBG00001182520.
DR   EnsemblGenomes-Gn; EBG00001182521.
DR   EnsemblGenomes-Gn; EBG00001182522.
DR   EnsemblGenomes-Gn; EBG00001182523.
DR   EnsemblGenomes-Gn; EBG00001182524.
DR   EnsemblGenomes-Gn; EBG00001182525.
DR   EnsemblGenomes-Gn; EBG00001182526.
DR   EnsemblGenomes-Gn; EBG00001182527.
DR   EnsemblGenomes-Gn; EBG00001182528.
DR   EnsemblGenomes-Gn; EBG00001182529.
DR   EnsemblGenomes-Gn; EBG00001182530.
DR   EnsemblGenomes-Gn; EBG00001182531.
DR   EnsemblGenomes-Gn; EBG00001182532.
DR   EnsemblGenomes-Gn; EBG00001182533.
DR   EnsemblGenomes-Gn; EBG00001182534.
DR   EnsemblGenomes-Gn; EBG00001182535.
DR   EnsemblGenomes-Gn; EBG00001182536.
DR   EnsemblGenomes-Gn; EBG00001182537.
DR   EnsemblGenomes-Gn; EBG00001182538.
DR   EnsemblGenomes-Gn; EBG00001182539.
DR   EnsemblGenomes-Gn; EBG00001182540.
DR   EnsemblGenomes-Gn; EBG00001182541.
DR   EnsemblGenomes-Gn; EBG00001182542.
DR   EnsemblGenomes-Gn; EBG00001182543.
DR   EnsemblGenomes-Gn; EBG00001182544.
DR   EnsemblGenomes-Gn; EBG00001182545.
DR   EnsemblGenomes-Gn; EBG00001182546.
DR   EnsemblGenomes-Gn; EBG00001182547.
DR   EnsemblGenomes-Gn; EBG00001182548.
DR   EnsemblGenomes-Gn; EBG00001182549.
DR   EnsemblGenomes-Gn; EBG00001182550.
DR   EnsemblGenomes-Gn; EBG00001182551.
DR   EnsemblGenomes-Gn; EBG00001182552.
DR   EnsemblGenomes-Gn; EBG00001182553.
DR   EnsemblGenomes-Gn; EBG00001182554.
DR   EnsemblGenomes-Gn; EBG00001182555.
DR   EnsemblGenomes-Gn; EBG00001182556.
DR   EnsemblGenomes-Gn; EBG00001182557.
DR   EnsemblGenomes-Gn; EBG00001182558.
DR   EnsemblGenomes-Gn; EBG00001182559.
DR   EnsemblGenomes-Gn; EBG00001182560.
DR   EnsemblGenomes-Gn; EBG00001182561.
DR   EnsemblGenomes-Gn; EBG00001182562.
DR   EnsemblGenomes-Gn; EBG00001182563.
DR   EnsemblGenomes-Gn; EBG00001182564.
DR   EnsemblGenomes-Gn; EBG00001182565.
DR   EnsemblGenomes-Gn; EBG00001182566.
DR   EnsemblGenomes-Gn; EBG00001182567.
DR   EnsemblGenomes-Gn; EBG00001182568.
DR   EnsemblGenomes-Gn; EBG00001182569.
DR   EnsemblGenomes-Gn; EBG00001182570.
DR   EnsemblGenomes-Gn; EBG00001182571.
DR   EnsemblGenomes-Gn; EBG00001182572.
DR   EnsemblGenomes-Gn; EBG00001182573.
DR   EnsemblGenomes-Gn; EBG00001182574.
DR   EnsemblGenomes-Gn; EBG00001182575.
DR   EnsemblGenomes-Gn; PAErR16S.
DR   EnsemblGenomes-Gn; PAErR23S.
DR   EnsemblGenomes-Gn; PAErR5S.
DR   EnsemblGenomes-Gn; PAEsR01.
DR   EnsemblGenomes-Gn; PAEsR02.
DR   EnsemblGenomes-Gn; PAEsR03.
DR   EnsemblGenomes-Gn; PAEsR04.
DR   EnsemblGenomes-Gn; PAEsR05.
DR   EnsemblGenomes-Gn; PAEsR06.
DR   EnsemblGenomes-Gn; PAEsR07.
DR   EnsemblGenomes-Gn; PAEsR08.
DR   EnsemblGenomes-Gn; PAEsR09.
DR   EnsemblGenomes-Gn; PAEsR10.
DR   EnsemblGenomes-Gn; PAEsR11.
DR   EnsemblGenomes-Gn; PAEsR12.
DR   EnsemblGenomes-Gn; PAEsR13.
DR   EnsemblGenomes-Gn; PAEsR14.
DR   EnsemblGenomes-Gn; PAEsR15.
DR   EnsemblGenomes-Gn; PAEsR16.
DR   EnsemblGenomes-Gn; PAEsR17.
DR   EnsemblGenomes-Gn; PAEsR18.
DR   EnsemblGenomes-Gn; PAEsR19.
DR   EnsemblGenomes-Gn; PAEsR20.
DR   EnsemblGenomes-Gn; PAEsR21.
DR   EnsemblGenomes-Gn; PAEsR22.
DR   EnsemblGenomes-Gn; PAEsR23.
DR   EnsemblGenomes-Gn; PAEsR24.
DR   EnsemblGenomes-Gn; PAEsR25.
DR   EnsemblGenomes-Gn; PAEsR26.
DR   EnsemblGenomes-Gn; PAEsR27.
DR   EnsemblGenomes-Gn; PAEsR28.
DR   EnsemblGenomes-Gn; PAEsR29.
DR   EnsemblGenomes-Gn; PAEsR30.
DR   EnsemblGenomes-Gn; PAEsR31.
DR   EnsemblGenomes-Gn; PAEsR32.
DR   EnsemblGenomes-Gn; PAEsR33.
DR   EnsemblGenomes-Gn; PAEsR34.
DR   EnsemblGenomes-Gn; PAEsR35.
DR   EnsemblGenomes-Gn; PAEsR36.
DR   EnsemblGenomes-Gn; PAEsR37.
DR   EnsemblGenomes-Gn; PAEsR38.
DR   EnsemblGenomes-Gn; PAEsR39.
DR   EnsemblGenomes-Gn; PAEsR40.
DR   EnsemblGenomes-Gn; PAEsR41.
DR   EnsemblGenomes-Gn; PAEsR42.
DR   EnsemblGenomes-Gn; PAEsR43.
DR   EnsemblGenomes-Gn; PAEsR44.
DR   EnsemblGenomes-Gn; PAEsR45.
DR   EnsemblGenomes-Gn; PAEsR46.
DR   EnsemblGenomes-Gn; PAEsR47.
DR   EnsemblGenomes-Gn; PAEsR48.
DR   EnsemblGenomes-Gn; PAEsR49.
DR   EnsemblGenomes-Gn; PAEsR50.
DR   EnsemblGenomes-Gn; PAEsR51.
DR   EnsemblGenomes-Gn; PAEtR01.
DR   EnsemblGenomes-Gn; PAEtR03.
DR   EnsemblGenomes-Gn; PAEtR04.
DR   EnsemblGenomes-Gn; PAEtR06.
DR   EnsemblGenomes-Gn; PAEtR07.
DR   EnsemblGenomes-Gn; PAEtR08.
DR   EnsemblGenomes-Gn; PAEtR13.
DR   EnsemblGenomes-Gn; PAEtR14.
DR   EnsemblGenomes-Gn; PAEtR15.
DR   EnsemblGenomes-Gn; PAEtR16.
DR   EnsemblGenomes-Gn; PAEtR17.
DR   EnsemblGenomes-Gn; PAEtR18.
DR   EnsemblGenomes-Gn; PAEtR19.
DR   EnsemblGenomes-Gn; PAEtR20.
DR   EnsemblGenomes-Gn; PAEtR21.
DR   EnsemblGenomes-Gn; PAEtR22.
DR   EnsemblGenomes-Gn; PAEtR24.
DR   EnsemblGenomes-Gn; PAEtR25.
DR   EnsemblGenomes-Gn; PAEtR26.
DR   EnsemblGenomes-Gn; PAEtR29.
DR   EnsemblGenomes-Gn; PAEtR30.
DR   EnsemblGenomes-Gn; PAEtR31.
DR   EnsemblGenomes-Gn; PAEtR32.
DR   EnsemblGenomes-Gn; PAEtR33.
DR   EnsemblGenomes-Gn; PAEtR34.
DR   EnsemblGenomes-Gn; PAEtR35.
DR   EnsemblGenomes-Gn; PAEtR36.
DR   EnsemblGenomes-Gn; PAEtR37.
DR   EnsemblGenomes-Gn; PAEtR38.
DR   EnsemblGenomes-Gn; PAEtR40.
DR   EnsemblGenomes-Gn; PAEtR41.
DR   EnsemblGenomes-Gn; PAEtR43.
DR   EnsemblGenomes-Gn; PAEtR44.
DR   EnsemblGenomes-Gn; PAEtR45.
DR   EnsemblGenomes-Gn; PAEtR46.
DR   EnsemblGenomes-Gn; PAEtRpseudo.
DR   EnsemblGenomes-Tr; EBT00001760682.
DR   EnsemblGenomes-Tr; EBT00001760683.
DR   EnsemblGenomes-Tr; EBT00001760684.
DR   EnsemblGenomes-Tr; EBT00001760685.
DR   EnsemblGenomes-Tr; EBT00001760686.
DR   EnsemblGenomes-Tr; EBT00001760687.
DR   EnsemblGenomes-Tr; EBT00001760688.
DR   EnsemblGenomes-Tr; EBT00001760689.
DR   EnsemblGenomes-Tr; EBT00001760690.
DR   EnsemblGenomes-Tr; EBT00001760691.
DR   EnsemblGenomes-Tr; EBT00001760692.
DR   EnsemblGenomes-Tr; EBT00001760693.
DR   EnsemblGenomes-Tr; EBT00001760694.
DR   EnsemblGenomes-Tr; EBT00001760695.
DR   EnsemblGenomes-Tr; EBT00001760696.
DR   EnsemblGenomes-Tr; EBT00001760697.
DR   EnsemblGenomes-Tr; EBT00001760699.
DR   EnsemblGenomes-Tr; EBT00001760700.
DR   EnsemblGenomes-Tr; EBT00001760701.
DR   EnsemblGenomes-Tr; EBT00001760702.
DR   EnsemblGenomes-Tr; EBT00001760703.
DR   EnsemblGenomes-Tr; EBT00001760704.
DR   EnsemblGenomes-Tr; EBT00001760705.
DR   EnsemblGenomes-Tr; EBT00001760706.
DR   EnsemblGenomes-Tr; EBT00001760707.
DR   EnsemblGenomes-Tr; EBT00001760708.
DR   EnsemblGenomes-Tr; EBT00001760709.
DR   EnsemblGenomes-Tr; EBT00001760710.
DR   EnsemblGenomes-Tr; EBT00001760711.
DR   EnsemblGenomes-Tr; EBT00001760712.
DR   EnsemblGenomes-Tr; EBT00001760713.
DR   EnsemblGenomes-Tr; EBT00001760714.
DR   EnsemblGenomes-Tr; EBT00001760716.
DR   EnsemblGenomes-Tr; EBT00001760718.
DR   EnsemblGenomes-Tr; EBT00001760719.
DR   EnsemblGenomes-Tr; EBT00001760721.
DR   EnsemblGenomes-Tr; EBT00001760724.
DR   EnsemblGenomes-Tr; EBT00001760726.
DR   EnsemblGenomes-Tr; EBT00001760729.
DR   EnsemblGenomes-Tr; EBT00001760730.
DR   EnsemblGenomes-Tr; EBT00001760733.
DR   EnsemblGenomes-Tr; EBT00001760735.
DR   EnsemblGenomes-Tr; EBT00001760738.
DR   EnsemblGenomes-Tr; EBT00001760739.
DR   EnsemblGenomes-Tr; EBT00001760741.
DR   EnsemblGenomes-Tr; EBT00001760743.
DR   EnsemblGenomes-Tr; EBT00001760745.
DR   EnsemblGenomes-Tr; EBT00001760747.
DR   EnsemblGenomes-Tr; EBT00001760748.
DR   EnsemblGenomes-Tr; EBT00001760749.
DR   EnsemblGenomes-Tr; EBT00001760751.
DR   EnsemblGenomes-Tr; EBT00001760753.
DR   EnsemblGenomes-Tr; EBT00001760755.
DR   EnsemblGenomes-Tr; EBT00001760757.
DR   EnsemblGenomes-Tr; EBT00001760760.
DR   EnsemblGenomes-Tr; EBT00001760761.
DR   EnsemblGenomes-Tr; EBT00001760762.
DR   EnsemblGenomes-Tr; EBT00001760764.
DR   EnsemblGenomes-Tr; EBT00001760765.
DR   EnsemblGenomes-Tr; EBT00001760768.
DR   EnsemblGenomes-Tr; EBT00001760769.
DR   EnsemblGenomes-Tr; EBT00001760770.
DR   EnsemblGenomes-Tr; EBT00001760773.
DR   EnsemblGenomes-Tr; EBT00001760774.
DR   EnsemblGenomes-Tr; EBT00001760776.
DR   EnsemblGenomes-Tr; EBT00001760778.
DR   EnsemblGenomes-Tr; EBT00001760780.
DR   EnsemblGenomes-Tr; EBT00001760781.
DR   EnsemblGenomes-Tr; EBT00001760783.
DR   EnsemblGenomes-Tr; EBT00001760785.
DR   EnsemblGenomes-Tr; EBT00001760787.
DR   EnsemblGenomes-Tr; EBT00001760789.
DR   EnsemblGenomes-Tr; EBT00001760791.
DR   EnsemblGenomes-Tr; EBT00001760793.
DR   EnsemblGenomes-Tr; EBT00001760796.
DR   EnsemblGenomes-Tr; EBT00001760798.
DR   EnsemblGenomes-Tr; EBT00001760800.
DR   EnsemblGenomes-Tr; EBT00001760801.
DR   EnsemblGenomes-Tr; EBT00001760804.
DR   EnsemblGenomes-Tr; EBT00001760806.
DR   EnsemblGenomes-Tr; EBT00001760807.
DR   EnsemblGenomes-Tr; EBT00001760809.
DR   EnsemblGenomes-Tr; EBT00001760811.
DR   EnsemblGenomes-Tr; EBT00001760814.
DR   EnsemblGenomes-Tr; EBT00001760816.
DR   EnsemblGenomes-Tr; EBT00001760818.
DR   EnsemblGenomes-Tr; EBT00001760819.
DR   EnsemblGenomes-Tr; EBT00001760822.
DR   EnsemblGenomes-Tr; EBT00001760824.
DR   EnsemblGenomes-Tr; EBT00001760825.
DR   EnsemblGenomes-Tr; EBT00001760827.
DR   EnsemblGenomes-Tr; EBT00001760830.
DR   EnsemblGenomes-Tr; EBT00001760832.
DR   EnsemblGenomes-Tr; EBT00001760834.
DR   EnsemblGenomes-Tr; EBT00001760836.
DR   EnsemblGenomes-Tr; EBT00001760839.
DR   EnsemblGenomes-Tr; EBT00001760840.
DR   EnsemblGenomes-Tr; EBT00001760842.
DR   EnsemblGenomes-Tr; EBT00001760844.
DR   EnsemblGenomes-Tr; EBT00001760846.
DR   EnsemblGenomes-Tr; EBT00001760848.
DR   EnsemblGenomes-Tr; EBT00001760850.
DR   EnsemblGenomes-Tr; EBT00001760853.
DR   EnsemblGenomes-Tr; EBT00001760855.
DR   EnsemblGenomes-Tr; EBT00001760857.
DR   EnsemblGenomes-Tr; EBT00001760859.
DR   EnsemblGenomes-Tr; EBT00001760860.
DR   EnsemblGenomes-Tr; EBT00001760862.
DR   EnsemblGenomes-Tr; EBT00001760863.
DR   EnsemblGenomes-Tr; EBT00001760866.
DR   EnsemblGenomes-Tr; EBT00001760868.
DR   EnsemblGenomes-Tr; EBT00001760870.
DR   EnsemblGenomes-Tr; EBT00001760873.
DR   EnsemblGenomes-Tr; EBT00001760875.
DR   EnsemblGenomes-Tr; EBT00001760877.
DR   EnsemblGenomes-Tr; EBT00001760879.
DR   EnsemblGenomes-Tr; EBT00001760880.
DR   EnsemblGenomes-Tr; EBT00001760882.
DR   EnsemblGenomes-Tr; EBT00001760884.
DR   EnsemblGenomes-Tr; EBT00001760885.
DR   EnsemblGenomes-Tr; EBT00001760887.
DR   EnsemblGenomes-Tr; EBT00001760890.
DR   EnsemblGenomes-Tr; EBT00001760892.
DR   EnsemblGenomes-Tr; EBT00001760895.
DR   EnsemblGenomes-Tr; EBT00001760897.
DR   EnsemblGenomes-Tr; EBT00001760899.
DR   EnsemblGenomes-Tr; EBT00001760901.
DR   EnsemblGenomes-Tr; EBT00001760904.
DR   EnsemblGenomes-Tr; EBT00001760906.
DR   EnsemblGenomes-Tr; EBT00001760908.
DR   EnsemblGenomes-Tr; EBT00001760911.
DR   EnsemblGenomes-Tr; EBT00001760913.
DR   EnsemblGenomes-Tr; EBT00001760915.
DR   EnsemblGenomes-Tr; EBT00001760917.
DR   EnsemblGenomes-Tr; EBT00001760920.
DR   EnsemblGenomes-Tr; EBT00001760923.
DR   EnsemblGenomes-Tr; EBT00001760924.
DR   EnsemblGenomes-Tr; EBT00001760926.
DR   EnsemblGenomes-Tr; EBT00001760928.
DR   EnsemblGenomes-Tr; EBT00001760931.
DR   EnsemblGenomes-Tr; EBT00001760933.
DR   EnsemblGenomes-Tr; EBT00001760935.
DR   EnsemblGenomes-Tr; EBT00001760937.
DR   EnsemblGenomes-Tr; EBT00001760939.
DR   EnsemblGenomes-Tr; EBT00001760941.
DR   EnsemblGenomes-Tr; EBT00001760943.
DR   EnsemblGenomes-Tr; EBT00001760945.
DR   EnsemblGenomes-Tr; EBT00001760948.
DR   EnsemblGenomes-Tr; EBT00001760950.
DR   EnsemblGenomes-Tr; EBT00001760952.
DR   EnsemblGenomes-Tr; EBT00001760955.
DR   EnsemblGenomes-Tr; EBT00001760957.
DR   EnsemblGenomes-Tr; EBT00001760960.
DR   EnsemblGenomes-Tr; EBT00001760962.
DR   EnsemblGenomes-Tr; EBT00001760964.
DR   EnsemblGenomes-Tr; EBT00001760966.
DR   EnsemblGenomes-Tr; EBT00001760969.
DR   EnsemblGenomes-Tr; EBT00001760971.
DR   EnsemblGenomes-Tr; EBT00001760973.
DR   EnsemblGenomes-Tr; EBT00001760975.
DR   EnsemblGenomes-Tr; EBT00001760977.
DR   EnsemblGenomes-Tr; EBT00001760979.
DR   EnsemblGenomes-Tr; EBT00001760981.
DR   EnsemblGenomes-Tr; EBT00001760983.
DR   EnsemblGenomes-Tr; EBT00001760986.
DR   EnsemblGenomes-Tr; EBT00001760987.
DR   EnsemblGenomes-Tr; EBT00001760990.
DR   EnsemblGenomes-Tr; EBT00001760992.
DR   EnsemblGenomes-Tr; EBT00001760994.
DR   EnsemblGenomes-Tr; EBT00001760996.
DR   EnsemblGenomes-Tr; EBT00001760998.
DR   EnsemblGenomes-Tr; EBT00001761000.
DR   EnsemblGenomes-Tr; EBT00001761002.
DR   EnsemblGenomes-Tr; EBT00001761003.
DR   EnsemblGenomes-Tr; EBT00001761006.
DR   EnsemblGenomes-Tr; EBT00001761008.
DR   EnsemblGenomes-Tr; EBT00001761010.
DR   EnsemblGenomes-Tr; PAErR16S-1.
DR   EnsemblGenomes-Tr; PAErR23S-1.
DR   EnsemblGenomes-Tr; PAErR5S-1.
DR   EnsemblGenomes-Tr; PAEsR01-1.
DR   EnsemblGenomes-Tr; PAEsR02-1.
DR   EnsemblGenomes-Tr; PAEsR03-1.
DR   EnsemblGenomes-Tr; PAEsR04-1.
DR   EnsemblGenomes-Tr; PAEsR05-1.
DR   EnsemblGenomes-Tr; PAEsR06-1.
DR   EnsemblGenomes-Tr; PAEsR07-1.
DR   EnsemblGenomes-Tr; PAEsR08-1.
DR   EnsemblGenomes-Tr; PAEsR09-1.
DR   EnsemblGenomes-Tr; PAEsR10-1.
DR   EnsemblGenomes-Tr; PAEsR11-1.
DR   EnsemblGenomes-Tr; PAEsR12-1.
DR   EnsemblGenomes-Tr; PAEsR13-1.
DR   EnsemblGenomes-Tr; PAEsR14-1.
DR   EnsemblGenomes-Tr; PAEsR15-1.
DR   EnsemblGenomes-Tr; PAEsR16-1.
DR   EnsemblGenomes-Tr; PAEsR17-1.
DR   EnsemblGenomes-Tr; PAEsR18-1.
DR   EnsemblGenomes-Tr; PAEsR19-1.
DR   EnsemblGenomes-Tr; PAEsR20-1.
DR   EnsemblGenomes-Tr; PAEsR21-1.
DR   EnsemblGenomes-Tr; PAEsR22-1.
DR   EnsemblGenomes-Tr; PAEsR23-1.
DR   EnsemblGenomes-Tr; PAEsR24-1.
DR   EnsemblGenomes-Tr; PAEsR25-1.
DR   EnsemblGenomes-Tr; PAEsR26-1.
DR   EnsemblGenomes-Tr; PAEsR27-1.
DR   EnsemblGenomes-Tr; PAEsR28-1.
DR   EnsemblGenomes-Tr; PAEsR29-1.
DR   EnsemblGenomes-Tr; PAEsR30-1.
DR   EnsemblGenomes-Tr; PAEsR31-1.
DR   EnsemblGenomes-Tr; PAEsR32-1.
DR   EnsemblGenomes-Tr; PAEsR33-1.
DR   EnsemblGenomes-Tr; PAEsR34-1.
DR   EnsemblGenomes-Tr; PAEsR35-1.
DR   EnsemblGenomes-Tr; PAEsR36-1.
DR   EnsemblGenomes-Tr; PAEsR37-1.
DR   EnsemblGenomes-Tr; PAEsR38-1.
DR   EnsemblGenomes-Tr; PAEsR39-1.
DR   EnsemblGenomes-Tr; PAEsR40-1.
DR   EnsemblGenomes-Tr; PAEsR41-1.
DR   EnsemblGenomes-Tr; PAEsR42-1.
DR   EnsemblGenomes-Tr; PAEsR43-1.
DR   EnsemblGenomes-Tr; PAEsR44-1.
DR   EnsemblGenomes-Tr; PAEsR45-1.
DR   EnsemblGenomes-Tr; PAEsR46-1.
DR   EnsemblGenomes-Tr; PAEsR47-1.
DR   EnsemblGenomes-Tr; PAEsR48-1.
DR   EnsemblGenomes-Tr; PAEsR49-1.
DR   EnsemblGenomes-Tr; PAEsR50-1.
DR   EnsemblGenomes-Tr; PAEsR51-1.
DR   EnsemblGenomes-Tr; PAEtR01-1.
DR   EnsemblGenomes-Tr; PAEtR03-1.
DR   EnsemblGenomes-Tr; PAEtR04-1.
DR   EnsemblGenomes-Tr; PAEtR06-1.
DR   EnsemblGenomes-Tr; PAEtR07-1.
DR   EnsemblGenomes-Tr; PAEtR08-1.
DR   EnsemblGenomes-Tr; PAEtR13-1.
DR   EnsemblGenomes-Tr; PAEtR14-1.
DR   EnsemblGenomes-Tr; PAEtR15-1.
DR   EnsemblGenomes-Tr; PAEtR16-1.
DR   EnsemblGenomes-Tr; PAEtR17-1.
DR   EnsemblGenomes-Tr; PAEtR18-1.
DR   EnsemblGenomes-Tr; PAEtR19-1.
DR   EnsemblGenomes-Tr; PAEtR20-1.
DR   EnsemblGenomes-Tr; PAEtR21-1.
DR   EnsemblGenomes-Tr; PAEtR22-1.
DR   EnsemblGenomes-Tr; PAEtR24-1.
DR   EnsemblGenomes-Tr; PAEtR25-1.
DR   EnsemblGenomes-Tr; PAEtR26-1.
DR   EnsemblGenomes-Tr; PAEtR29-1.
DR   EnsemblGenomes-Tr; PAEtR30-1.
DR   EnsemblGenomes-Tr; PAEtR31-1.
DR   EnsemblGenomes-Tr; PAEtR32-1.
DR   EnsemblGenomes-Tr; PAEtR33-1.
DR   EnsemblGenomes-Tr; PAEtR34-1.
DR   EnsemblGenomes-Tr; PAEtR35-1.
DR   EnsemblGenomes-Tr; PAEtR36-1.
DR   EnsemblGenomes-Tr; PAEtR37-1.
DR   EnsemblGenomes-Tr; PAEtR38-1.
DR   EnsemblGenomes-Tr; PAEtR40-1.
DR   EnsemblGenomes-Tr; PAEtR41-1.
DR   EnsemblGenomes-Tr; PAEtR43-1.
DR   EnsemblGenomes-Tr; PAEtR44-1.
DR   EnsemblGenomes-Tr; PAEtR45-1.
DR   EnsemblGenomes-Tr; PAEtR46-1.
DR   EnsemblGenomes-Tr; PAEtRpseudo-1.
DR   EuropePMC; PMC117417; 11792869.
DR   EuropePMC; PMC1974809; 17504473.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2223247; 18039820.
DR   EuropePMC; PMC2685585; 16877322.
DR   EuropePMC; PMC4168702; 25252700.
DR   EuropePMC; PMC5797428; 29434576.
DR   EuropePMC; PMC6009581; 29771354.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01120; sR33.
DR   RFAM; RF01354; CRISPR-DR45.
DR   RFAM; RF01355; CRISPR-DR26.
DR   RFAM; RF01722; Pyrobac-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE009441.
DR   SILVA-SSU; AE009441.
DR   StrainInfo; 267735; 1.
CC   On or before Feb 25, 2009 this sequence version replaced
CC   gi:18159040, gi:18159060, gi:18159077, gi:18159088, gi:18159101,
CC   gi:18159115, gi:18159126, gi:18159140, gi:18159160, gi:18159175,
CC   gi:18159184, gi:18159200, gi:18159213, gi:18159228, gi:18159241,
CC   gi:18159257, gi:18159274, gi:18159286, gi:18159302, gi:18159315,
CC   gi:18159335, gi:18159353, gi:18159366, gi:18159375, gi:18159391,
CC   gi:18159406, gi:18159419, gi:18159430, gi:18159449, gi:18159462,
CC   gi:18159477, gi:18159494, gi:18159512, gi:18159515, gi:18159531,
CC   gi:18159544, gi:18159556, gi:18159576, gi:18159593, gi:18159606,
CC   gi:18159616, gi:18159632, gi:18159646, gi:18159651, gi:18159665,
CC   gi:18159673, gi:18159691, gi:18159704, gi:18159721, gi:18159738,
CC   gi:18159751, gi:18159769, gi:18159783, gi:18159794, gi:18159812,
CC   gi:18159827, gi:18159840, gi:18159853, gi:18159862, gi:18159871,
CC   gi:18159884, gi:18159899, gi:18159915, gi:18159930, gi:18159943,
CC   gi:18159962, gi:18159975, gi:18159984, gi:18159995, gi:18160004,
CC   gi:18160024, gi:18160038, gi:18160056, gi:18160067, gi:18160079,
CC   gi:18160092, gi:18160110, gi:18160125, gi:18160140, gi:18160155,
CC   gi:18160171, gi:18160189, gi:18160198, gi:18160212, gi:18160229,
CC   gi:18160241, gi:18160256, gi:18160269, gi:18160284, gi:18160300,
CC   gi:18160316, gi:18160332, gi:18160342, gi:18160355, gi:18160372,
CC   gi:18160385, gi:18160399, gi:18160416, gi:18160423, gi:18160437,
CC   gi:18160452, gi:18160463, gi:18160475, gi:18160487, gi:18160501,
CC   gi:18160516, gi:18160530, gi:18160547, gi:18160559, gi:18160570,
CC   gi:18160586, gi:18160599, gi:18160615, gi:18160628, gi:18160644,
CC   gi:18160659, gi:18160671, gi:18160690, gi:18160703, gi:18160718,
CC   gi:18160728, gi:18160745, gi:18160753, gi:18160764, gi:18160776,
CC   gi:18160788, gi:18160805, gi:18160820, gi:18160837, gi:18160854,
CC   gi:18160870, gi:18160878, gi:18160892, gi:18160901, gi:18160909,
CC   gi:18160921, gi:18160939, gi:18160952, gi:18160969, gi:18160984,
CC   gi:18161001, gi:18161018, gi:18161033, gi:18161046, gi:18161063,
CC   gi:18161082, gi:18161096, gi:18161115, gi:18161130, gi:18161146,
CC   gi:18161163, gi:18161177, gi:18161193, gi:18161207, gi:18161224,
CC   gi:18161236, gi:18161249, gi:18161261, gi:18161279, gi:18161294,
CC   gi:18161308, gi:18161325, gi:18161339, gi:18161355, gi:18161365,
CC   gi:18161376, gi:18161397, gi:18161408, gi:18161423, gi:18161437,
CC   gi:18161450, gi:18161464, gi:18161477, gi:18161489, gi:18161503,
CC   gi:18161515, gi:18161526, gi:18161543, gi:18161553, gi:18161570,
CC   gi:18161588, gi:18161597, gi:18161609, gi:18161625, gi:18161635,
CC   gi:18161647, gi:18161659, gi:18161668, gi:18161683, gi:18161701,
CC   gi:18161717, gi:18161728, gi:18161743, gi:18161757, gi:18161773,
CC   gi:18161784, gi:18161793, gi:18161804, gi:18161817, gi:18161829,
CC   gi:18161842.
FH   Key             Location/Qualifiers
FT   source          1..2222430
FT                   /organism="Pyrobaculum aerophilum str. IM2"
FT                   /strain="IM2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:178306"
FT   gene            1..957
FT                   /locus_tag="PAE0001"
FT   CDS_pept        1..957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0001"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62493"
FT                   /db_xref="GOA:Q8ZZZ6"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016653"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ6"
FT                   /protein_id="AAL62493.1"
FT   gene            complement(954..1427)
FT                   /locus_tag="PAE0002"
FT   CDS_pept        complement(954..1427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0002"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62494"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ5"
FT                   /protein_id="AAL62494.1"
FT   gene            complement(1471..2397)
FT                   /locus_tag="PAE0005"
FT   CDS_pept        complement(1471..2397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0005"
FT                   /product="peptidase, putative"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62495"
FT                   /db_xref="GOA:Q8ZZZ4"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR028536"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ4"
FT                   /protein_id="AAL62495.1"
FT   gene            2640..3797
FT                   /locus_tag="PAE0007"
FT   CDS_pept        2640..3797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0007"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62496"
FT                   /db_xref="InterPro:IPR014592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ3"
FT                   /protein_id="AAL62496.1"
FT   gene            3784..4143
FT                   /locus_tag="PAE0008"
FT   CDS_pept        3784..4143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0008"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ2"
FT                   /protein_id="AAL62497.1"
FT                   ELVFINYYKELYNKC"
FT   gene            complement(4316..4456)
FT                   /locus_tag="PAE0009"
FT   CDS_pept        complement(4316..4456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0009"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62498"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZZ1"
FT                   /protein_id="AAL62498.1"
FT                   A"
FT   gene            complement(4483..5151)
FT                   /locus_tag="PAE0010"
FT   CDS_pept        complement(4483..5151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0010"
FT                   /product="coenzyme PQQ synthesis protein, conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Menaquinone and ubiquinone"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62499"
FT                   /db_xref="GOA:Q8ZZZ0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZZ0"
FT                   /protein_id="AAL62499.1"
FT                   "
FT   gene            complement(5152..5586)
FT                   /locus_tag="PAE0012"
FT   CDS_pept        complement(5152..5586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62500"
FT                   /db_xref="InterPro:IPR016618"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY9"
FT                   /protein_id="AAL62500.1"
FT   gene            complement(5759..6184)
FT                   /locus_tag="PAE0013"
FT   CDS_pept        complement(5759..6184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62501"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY8"
FT                   /protein_id="AAL62501.1"
FT   gene            complement(6400..7134)
FT                   /locus_tag="PAE0014"
FT   CDS_pept        complement(6400..7134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0014"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62502"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY7"
FT                   /protein_id="AAL62502.1"
FT   gene            complement(7499..7612)
FT                   /locus_tag="PAE0015"
FT   CDS_pept        complement(7499..7612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0015"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62503"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY6"
FT                   /protein_id="AAL62503.1"
FT   gene            complement(7672..7767)
FT                   /locus_tag="PAE0016"
FT   CDS_pept        complement(7672..7767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0016"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62504"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY5"
FT                   /protein_id="AAL62504.1"
FT                   /translation="MAESLKLLEAEVKTQIQHVAREIDQLRQRIP"
FT   gene            7914..8318
FT                   /locus_tag="PAE0017"
FT   CDS_pept        7914..8318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62505"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY4"
FT                   /protein_id="AAL62505.1"
FT   gene            complement(8315..9208)
FT                   /locus_tag="PAE0019"
FT   CDS_pept        complement(8315..9208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62506"
FT                   /db_xref="GOA:Q8ZZY3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY3"
FT                   /protein_id="AAL62506.1"
FT                   PSGYKPQKDAGEIRCI"
FT   gene            9243..10184
FT                   /locus_tag="PAE0020"
FT   CDS_pept        9243..10184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0020"
FT                   /product="binding protein, putative"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62507"
FT                   /db_xref="GOA:Q8ZZY2"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY2"
FT                   /protein_id="AAL62507.1"
FT   gene            10171..10818
FT                   /locus_tag="PAE0022"
FT   CDS_pept        10171..10818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0022"
FT                   /product="sulfate transport system, permease protein,
FT                   putative"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62508"
FT                   /db_xref="GOA:Q8ZZY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY1"
FT                   /protein_id="AAL62508.1"
FT   gene            10815..11417
FT                   /locus_tag="PAE0023"
FT   CDS_pept        10815..11417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0023"
FT                   /product="sulfate transport system, ATP-binding protein,
FT                   putative"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62509"
FT                   /db_xref="GOA:Q8ZZY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZY0"
FT                   /protein_id="AAL62509.1"
FT   gene            complement(11425..12141)
FT                   /locus_tag="PAE0025"
FT   CDS_pept        complement(11425..12141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0025"
FT                   /product="short chain dehydrogenase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62510"
FT                   /db_xref="GOA:Q8ZZX9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX9"
FT                   /protein_id="AAL62510.1"
FT                   WVTGAVIPADGGRRLL"
FT   gene            complement(12175..12450)
FT                   /locus_tag="PAE0026"
FT   CDS_pept        complement(12175..12450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62511"
FT                   /db_xref="GOA:Q8ZZX8"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX8"
FT                   /protein_id="AAL62511.1"
FT   gene            12553..13302
FT                   /locus_tag="PAE0028"
FT   CDS_pept        12553..13302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0028"
FT                   /product="paREP11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62512"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX7"
FT                   /protein_id="AAL62512.1"
FT   gene            13324..14655
FT                   /locus_tag="PAE0030"
FT   CDS_pept        13324..14655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62513"
FT                   /db_xref="GOA:Q8ZZX6"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZX6"
FT                   /protein_id="AAL62513.1"
FT   gene            14684..14884
FT                   /locus_tag="PAE0030a"
FT   CDS_pept        14684..14884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0030a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0030a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX5"
FT                   /protein_id="AAL62514.1"
FT   gene            14898..15275
FT                   /locus_tag="PAE0033"
FT   CDS_pept        14898..15275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62515"
FT                   /db_xref="GOA:Q8ZZX4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX4"
FT                   /protein_id="AAL62515.1"
FT   gene            complement(15265..16158)
FT                   /locus_tag="PAE0034"
FT   CDS_pept        complement(15265..16158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0034"
FT                   /product="homoserine kinase"
FT                   /note="Amino acid biosynthesis; Aspartate family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62516"
FT                   /db_xref="GOA:Q8ZZX3"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZX3"
FT                   /protein_id="AAL62516.1"
FT                   AEVKIASITEGALASL"
FT   gene            complement(16115..16786)
FT                   /locus_tag="PAE0036"
FT   CDS_pept        complement(16115..16786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62517"
FT                   /db_xref="GOA:Q8ZZX2"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX2"
FT                   /protein_id="AAL62517.1"
FT                   F"
FT   gene            complement(17081..18208)
FT                   /locus_tag="PAE0039"
FT   CDS_pept        complement(17081..18208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62518"
FT                   /db_xref="GOA:Q8ZZX1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX1"
FT                   /protein_id="AAL62518.1"
FT   gene            complement(18189..20180)
FT                   /locus_tag="PAE0040"
FT   CDS_pept        complement(18189..20180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0040"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62519"
FT                   /db_xref="GOA:Q8ZZX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZX0"
FT                   /protein_id="AAL62519.1"
FT   gene            complement(20180..20659)
FT                   /locus_tag="PAE0041"
FT   CDS_pept        complement(20180..20659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0041"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62520"
FT                   /db_xref="GOA:Q8ZZW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW9"
FT                   /protein_id="AAL62520.1"
FT   gene            20731..21765
FT                   /locus_tag="PAE0042"
FT   CDS_pept        20731..21765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0042"
FT                   /product="egghead homolog"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62521"
FT                   /db_xref="GOA:Q8ZZW8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW8"
FT                   /protein_id="AAL62521.1"
FT                   IDKR"
FT   gene            complement(21776..21867)
FT                   /locus_tag="PAEtR42"
FT                   /note="tRNA-His; contains intron"
FT   gene            21915..22319
FT                   /locus_tag="PAE0044"
FT   CDS_pept        21915..22319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62522"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW7"
FT                   /protein_id="AAL62522.1"
FT   gene            22291..22641
FT                   /locus_tag="PAE0045"
FT   CDS_pept        22291..22641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0045"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62523"
FT                   /db_xref="GOA:Q8ZZW6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW6"
FT                   /protein_id="AAL62523.1"
FT                   GKLVWGREVKCR"
FT   gene            22679..23020
FT                   /locus_tag="PAE0046"
FT   CDS_pept        22679..23020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0046"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62524"
FT                   /db_xref="GOA:Q8ZZW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW5"
FT                   /protein_id="AAL62524.1"
FT                   APRRPVAMD"
FT   gene            23050..23250
FT                   /locus_tag="PAE0047"
FT   CDS_pept        23050..23250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0047"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW4"
FT                   /protein_id="AAL62525.1"
FT   gene            complement(23237..24241)
FT                   /locus_tag="PAE0049"
FT   CDS_pept        complement(23237..24241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0049"
FT                   /product="serine protease inhibitor (serpin)"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62526"
FT                   /db_xref="GOA:Q8ZZW3"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZW3"
FT                   /protein_id="AAL62526.1"
FT   gene            complement(24174..24968)
FT                   /locus_tag="PAE0049a"
FT   CDS_pept        complement(24174..24968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0049a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0049a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62527"
FT                   /db_xref="GOA:Q8ZZW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW2"
FT                   /protein_id="AAL62527.1"
FT   gene            complement(25140..25364)
FT                   /locus_tag="PAE0051"
FT   CDS_pept        complement(25140..25364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0051"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW1"
FT                   /protein_id="AAL62528.1"
FT   gene            complement(25782..27665)
FT                   /locus_tag="PAE0055"
FT   CDS_pept        complement(25782..27665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0055"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62529"
FT                   /db_xref="GOA:Q8ZZW0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZW0"
FT                   /protein_id="AAL62529.1"
FT   gene            complement(27665..27799)
FT                   /locus_tag="PAE0056"
FT   CDS_pept        complement(27665..27799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0056"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62530"
FT                   /db_xref="GOA:Q8ZZV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV9"
FT                   /protein_id="AAL62530.1"
FT   gene            complement(27787..28992)
FT                   /locus_tag="PAE0057"
FT   CDS_pept        complement(27787..28992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV8"
FT                   /protein_id="AAL62531.1"
FT                   IS"
FT   gene            29077..30612
FT                   /locus_tag="PAE0061"
FT   CDS_pept        29077..30612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0061"
FT                   /product="extracellular solute binding protein,
FT                   conjectural"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62532"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV7"
FT                   /protein_id="AAL62532.1"
FT   gene            complement(30629..32437)
FT                   /locus_tag="PAE0062"
FT   CDS_pept        complement(30629..32437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0062"
FT                   /product="molybdenum transport system permease protein,
FT                   putative"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62533"
FT                   /db_xref="GOA:Q8ZZV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV6"
FT                   /protein_id="AAL62533.1"
FT   gene            complement(32434..33477)
FT                   /locus_tag="PAE0063"
FT   CDS_pept        complement(32434..33477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0063"
FT                   /product="transporter ATP-binding protein, putative"
FT                   /note="Transport and binding proteins; Anions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62534"
FT                   /db_xref="GOA:Q8ZZV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV5"
FT                   /protein_id="AAL62534.1"
FT                   KAWAFKP"
FT   gene            33561..34796
FT                   /locus_tag="PAE0064"
FT   CDS_pept        33561..34796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0064"
FT                   /product="translation initiation factor aIF-2 gamma
FT                   subunit, putative"
FT                   /note="Protein synthesis; Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62535"
FT                   /db_xref="GOA:Q8ZZV4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV4"
FT                   /protein_id="AAL62535.1"
FT                   YGTLKGGTVALE"
FT   gene            complement(34945..35025)
FT                   /locus_tag="PAE0064a"
FT   CDS_pept        complement(34945..35025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0064a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0064a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62536"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV3"
FT                   /protein_id="AAL62536.1"
FT                   /translation="MALVGPGKTTLTEEVLALDGKGLLPS"
FT   gene            35047..35190
FT                   /locus_tag="PAE0065"
FT   CDS_pept        35047..35190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0065"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62537"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV2"
FT                   /protein_id="AAL62537.1"
FT                   PL"
FT   gene            complement(35472..36290)
FT                   /locus_tag="PAE0067"
FT   CDS_pept        complement(35472..36290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62538"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV1"
FT                   /protein_id="AAL62538.1"
FT   gene            complement(36287..38116)
FT                   /locus_tag="PAE0068"
FT   CDS_pept        complement(36287..38116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0068"
FT                   /product="helicase, probable"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62539"
FT                   /db_xref="GOA:Q8ZZV0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZV0"
FT                   /protein_id="AAL62539.1"
FT   gene            complement(38113..38376)
FT                   /locus_tag="PAE0069"
FT   CDS_pept        complement(38113..38376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0069"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU9"
FT                   /protein_id="AAL62540.1"
FT   gene            38499..39287
FT                   /locus_tag="PAE0070"
FT   CDS_pept        38499..39287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0070"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62541"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU8"
FT                   /protein_id="AAL62541.1"
FT   gene            39500..39829
FT                   /locus_tag="PAE0073"
FT   CDS_pept        39500..39829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0073"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU7"
FT                   /protein_id="AAL62542.1"
FT                   CFNFF"
FT   gene            complement(41005..41745)
FT                   /locus_tag="PAE0075"
FT   CDS_pept        complement(41005..41745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62543"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU6"
FT                   /protein_id="AAL62543.1"
FT   gene            41774..42397
FT                   /locus_tag="PAE0077"
FT   CDS_pept        41774..42397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0077"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62544"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU5"
FT                   /protein_id="AAL62544.1"
FT   gene            complement(42327..42704)
FT                   /locus_tag="PAE0078"
FT   CDS_pept        complement(42327..42704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0078"
FT                   /product="paREP9, associated with SRSRs"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62545"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU4"
FT                   /protein_id="AAL62545.1"
FT   gene            complement(42689..43204)
FT                   /locus_tag="PAE0079"
FT   CDS_pept        complement(42689..43204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62546"
FT                   /db_xref="GOA:Q8ZZU3"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU3"
FT                   /protein_id="AAL62546.1"
FT                   YRAICTPT"
FT   gene            complement(43194..43481)
FT                   /locus_tag="PAE0080"
FT   CDS_pept        complement(43194..43481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62547"
FT                   /db_xref="GOA:Q8ZZU2"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZU2"
FT                   /protein_id="AAL62547.1"
FT   gene            complement(43478..44386)
FT                   /locus_tag="PAE0081"
FT   CDS_pept        complement(43478..44386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62548"
FT                   /db_xref="GOA:Q8ZZU1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZU1"
FT                   /protein_id="AAL62548.1"
FT   gene            complement(44370..45236)
FT                   /locus_tag="PAE0082"
FT   CDS_pept        complement(44370..45236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62549"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZU0"
FT                   /protein_id="AAL62549.1"
FT                   HCHGGSG"
FT   gene            46700..46903
FT                   /locus_tag="PAE0084"
FT   CDS_pept        46700..46903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0084"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62550"
FT                   /db_xref="GOA:Q8ZZT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT9"
FT                   /protein_id="AAL62550.1"
FT   gene            46970..47239
FT                   /locus_tag="PAE0086"
FT   CDS_pept        46970..47239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0086"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT8"
FT                   /protein_id="AAL62551.1"
FT   gene            47280..47747
FT                   /locus_tag="PAE0087"
FT   CDS_pept        47280..47747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0087"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62552"
FT                   /db_xref="GOA:Q8ZZT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT7"
FT                   /protein_id="AAL62552.1"
FT   gene            complement(47753..48766)
FT                   /locus_tag="PAE0088"
FT   CDS_pept        complement(47753..48766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0088"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62553"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT6"
FT                   /protein_id="AAL62553.1"
FT   gene            complement(48829..48975)
FT                   /locus_tag="PAE0089"
FT   CDS_pept        complement(48829..48975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0089"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT5"
FT                   /protein_id="AAL62554.1"
FT                   GYM"
FT   gene            complement(48972..50060)
FT                   /locus_tag="PAE0090"
FT   CDS_pept        complement(48972..50060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT4"
FT                   /protein_id="AAL62555.1"
FT   gene            50152..51057
FT                   /locus_tag="PAE0091"
FT   CDS_pept        50152..51057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0091"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62556"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT3"
FT                   /protein_id="AAL62556.1"
FT   gene            51724..52272
FT                   /locus_tag="PAE0096"
FT   CDS_pept        51724..52272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0096"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62557"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT2"
FT                   /protein_id="AAL62557.1"
FT   gene            complement(52315..52836)
FT                   /locus_tag="PAE0097"
FT   CDS_pept        complement(52315..52836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0097"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62558"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT1"
FT                   /protein_id="AAL62558.1"
FT                   LCNCICCSKC"
FT   gene            complement(52814..53797)
FT                   /locus_tag="PAE0098"
FT   CDS_pept        complement(52814..53797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0098"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62559"
FT                   /db_xref="GOA:Q8ZZT0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZT0"
FT                   /protein_id="AAL62559.1"
FT   gene            54121..54348
FT                   /locus_tag="PAE0100"
FT   CDS_pept        54121..54348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62560"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS9"
FT                   /protein_id="AAL62560.1"
FT   gene            54323..54703
FT                   /locus_tag="PAE0101"
FT   CDS_pept        54323..54703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0101"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62561"
FT                   /db_xref="GOA:Q8ZZS8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS8"
FT                   /protein_id="AAL62561.1"
FT   gene            54939..55859
FT                   /locus_tag="PAE0103"
FT   CDS_pept        54939..55859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0103"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62562"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS7"
FT                   /protein_id="AAL62562.1"
FT   gene            56086..56712
FT                   /locus_tag="PAE0105"
FT   CDS_pept        56086..56712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0105"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS6"
FT                   /protein_id="AAL62563.1"
FT   gene            56712..57329
FT                   /locus_tag="PAE0106"
FT   CDS_pept        56712..57329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0106"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62564"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS5"
FT                   /protein_id="AAL62564.1"
FT   gene            complement(57434..57805)
FT                   /locus_tag="PAE0108"
FT   CDS_pept        complement(57434..57805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0108"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62565"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS4"
FT                   /protein_id="AAL62565.1"
FT   gene            complement(57805..60177)
FT                   /locus_tag="PAE0109"
FT   CDS_pept        complement(57805..60177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62566"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS3"
FT                   /protein_id="AAL62566.1"
FT   gene            complement(60164..61096)
FT                   /locus_tag="PAE0111"
FT   CDS_pept        complement(60164..61096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0111"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS2"
FT                   /protein_id="AAL62567.1"
FT   gene            complement(61084..61968)
FT                   /locus_tag="PAE0112"
FT   CDS_pept        complement(61084..61968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0112"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62568"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS1"
FT                   /protein_id="AAL62568.1"
FT                   CLKKLSPLWIWLS"
FT   gene            complement(61965..62891)
FT                   /locus_tag="PAE0114"
FT   CDS_pept        complement(61965..62891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62569"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZS0"
FT                   /protein_id="AAL62569.1"
FT   gene            complement(62888..63334)
FT                   /locus_tag="PAE0115"
FT   CDS_pept        complement(62888..63334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0115"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62570"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR9"
FT                   /protein_id="AAL62570.1"
FT   gene            63419..64411
FT                   /locus_tag="PAE0116"
FT   CDS_pept        63419..64411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0116"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR8"
FT                   /protein_id="AAL62571.1"
FT   gene            complement(64616..66046)
FT                   /locus_tag="PAE0117"
FT   CDS_pept        complement(64616..66046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0117"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62572"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR7"
FT                   /protein_id="AAL62572.1"
FT                   VVYNGEIVSELVQRLKTN"
FT   gene            66135..66389
FT                   /locus_tag="PAE0118"
FT   CDS_pept        66135..66389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0118"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR6"
FT                   /protein_id="AAL62573.1"
FT   gene            66414..68069
FT                   /locus_tag="PAE0119"
FT   CDS_pept        66414..68069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0119"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62574"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR5"
FT                   /protein_id="AAL62574.1"
FT   gene            complement(68073..68603)
FT                   /locus_tag="PAE0120"
FT   CDS_pept        complement(68073..68603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0120"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR4"
FT                   /protein_id="AAL62575.1"
FT                   SYPKTEELLKYIK"
FT   gene            complement(68735..69724)
FT                   /locus_tag="PAE0121"
FT   CDS_pept        complement(68735..69724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0121"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62576"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR3"
FT                   /protein_id="AAL62576.1"
FT   gene            69828..70814
FT                   /locus_tag="PAE0122"
FT   CDS_pept        69828..70814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0122"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62577"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR2"
FT                   /protein_id="AAL62577.1"
FT   gene            71097..71363
FT                   /locus_tag="PAE0124"
FT   CDS_pept        71097..71363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0124"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR1"
FT                   /protein_id="AAL62578.1"
FT   gene            71374..72024
FT                   /locus_tag="PAE0126"
FT   CDS_pept        71374..72024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62579"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZR0"
FT                   /protein_id="AAL62579.1"
FT   gene            72118..73725
FT                   /locus_tag="PAE0128"
FT   CDS_pept        72118..73725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62580"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ9"
FT                   /protein_id="AAL62580.1"
FT                   AYRHPVYVKVSKNAAHLG"
FT   gene            73722..74171
FT                   /locus_tag="PAE0129"
FT   CDS_pept        73722..74171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62581"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ8"
FT                   /protein_id="AAL62581.1"
FT   gene            74251..74508
FT                   /locus_tag="PAE0131"
FT   CDS_pept        74251..74508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0131"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62582"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ7"
FT                   /protein_id="AAL62582.1"
FT   gene            complement(74890..75330)
FT                   /locus_tag="PAE0133"
FT   CDS_pept        complement(74890..75330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0133"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62583"
FT                   /db_xref="GOA:Q8ZZQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ6"
FT                   /protein_id="AAL62583.1"
FT   gene            complement(75306..75926)
FT                   /locus_tag="PAE0134"
FT   CDS_pept        complement(75306..75926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0134"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ5"
FT                   /protein_id="AAL62584.1"
FT   gene            complement(75923..76297)
FT                   /locus_tag="PAE0135"
FT   CDS_pept        complement(75923..76297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0135"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62585"
FT                   /db_xref="GOA:Q8ZZQ4"
FT                   /db_xref="InterPro:IPR040493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ4"
FT                   /protein_id="AAL62585.1"
FT   gene            complement(76373..76714)
FT                   /locus_tag="PAE0137"
FT   CDS_pept        complement(76373..76714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0137"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62586"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ3"
FT                   /protein_id="AAL62586.1"
FT                   WVKRTINLQ"
FT   gene            complement(77136..77405)
FT                   /locus_tag="PAE0138"
FT   CDS_pept        complement(77136..77405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0138"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ2"
FT                   /protein_id="AAL62587.1"
FT   gene            77455..77640
FT                   /locus_tag="PAE0139"
FT   CDS_pept        77455..77640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0139"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ1"
FT                   /protein_id="AAL62588.1"
FT                   GTEAGVRARRRAWEGS"
FT   gene            complement(77664..77840)
FT                   /locus_tag="PAE0141"
FT   CDS_pept        complement(77664..77840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0141"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62589"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZQ0"
FT                   /protein_id="AAL62589.1"
FT                   QLILQEHKAYDKS"
FT   gene            77849..78304
FT                   /locus_tag="PAE0142"
FT   CDS_pept        77849..78304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0142"
FT                   /product="paREP5a"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62590"
FT                   /db_xref="GOA:Q8ZZP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP9"
FT                   /protein_id="AAL62590.1"
FT   gene            78314..78655
FT                   /locus_tag="PAE0143"
FT   CDS_pept        78314..78655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0143"
FT                   /product="paREP5b"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP8"
FT                   /protein_id="AAL62591.1"
FT                   AKLLSAGTL"
FT   gene            complement(78825..79163)
FT                   /locus_tag="PAE0144"
FT   CDS_pept        complement(78825..79163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62592"
FT                   /db_xref="GOA:Q8ZZP7"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP7"
FT                   /protein_id="AAL62592.1"
FT                   ARESYNCE"
FT   gene            complement(79166..80065)
FT                   /locus_tag="PAE0146"
FT   CDS_pept        complement(79166..80065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0146"
FT                   /product="conserved protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62593"
FT                   /db_xref="GOA:Q8ZZP6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP6"
FT                   /protein_id="AAL62593.1"
FT                   EGLVEVEKRDGRNFVKPR"
FT   gene            complement(80100..81050)
FT                   /locus_tag="PAE0148"
FT   CDS_pept        complement(80100..81050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0148"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62594"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP5"
FT                   /protein_id="AAL62594.1"
FT   gene            81485..81628
FT                   /locus_tag="PAE0150"
FT   CDS_pept        81485..81628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0150"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62595"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP4"
FT                   /protein_id="AAL62595.1"
FT                   AY"
FT   gene            complement(81756..82151)
FT                   /locus_tag="PAE0151"
FT   CDS_pept        complement(81756..82151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62596"
FT                   /db_xref="GOA:Q8ZZP3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="PDB:2FE1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZP3"
FT                   /protein_id="AAL62596.1"
FT   gene            complement(82135..82368)
FT                   /locus_tag="PAE0152"
FT   CDS_pept        complement(82135..82368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62597"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZP2"
FT                   /protein_id="AAL62597.1"
FT   gene            complement(82432..83343)
FT                   /locus_tag="PAE0153"
FT   CDS_pept        complement(82432..83343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0153"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62598"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP1"
FT                   /protein_id="AAL62598.1"
FT   gene            complement(83334..83693)
FT                   /locus_tag="PAE0154"
FT   CDS_pept        complement(83334..83693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0154"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62599"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZP0"
FT                   /protein_id="AAL62599.1"
FT                   THVIAVDGRYWGLCP"
FT   gene            complement(83755..83810)
FT                   /locus_tag="PAEsR12"
FT   ncRNA           complement(83755..83810)
FT                   /locus_tag="PAEsR12"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at G1542"
FT                   /ncRNA_class="other"
FT   gene            83923..84066
FT                   /locus_tag="PAE0157"
FT   CDS_pept        83923..84066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0157"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN9"
FT                   /protein_id="AAL62600.1"
FT                   GA"
FT   gene            complement(84063..84311)
FT                   /locus_tag="PAE0158"
FT   CDS_pept        complement(84063..84311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0158"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62601"
FT                   /db_xref="GOA:Q8ZZN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN8"
FT                   /protein_id="AAL62601.1"
FT   gene            complement(84327..84497)
FT                   /locus_tag="PAE0160"
FT   CDS_pept        complement(84327..84497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0160"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62602"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN7"
FT                   /protein_id="AAL62602.1"
FT                   WRLNPAAKIYT"
FT   gene            complement(84799..84855)
FT                   /locus_tag="PAEsR07"
FT   ncRNA           complement(84799..84855)
FT                   /locus_tag="PAEsR07"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   18S at G1178"
FT                   /ncRNA_class="other"
FT   gene            84923..85396
FT                   /locus_tag="PAE0163"
FT   CDS_pept        84923..85396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0163"
FT                   /product="mutT/nudix family protein"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62603"
FT                   /db_xref="GOA:Q8ZZN6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN6"
FT                   /protein_id="AAL62603.1"
FT   gene            85425..86489
FT                   /locus_tag="PAE0164"
FT   CDS_pept        85425..86489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62604"
FT                   /db_xref="GOA:Q8ZZN5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN5"
FT                   /protein_id="AAL62604.1"
FT                   RYVDRWIVPPGAPI"
FT   gene            86646..86717
FT                   /locus_tag="PAE0164a"
FT   CDS_pept        86646..86717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0164a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0164a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62605"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN4"
FT                   /protein_id="AAL62605.1"
FT                   /translation="MGQGGVDRDYIKTLILDIKTAVE"
FT   gene            86727..87071
FT                   /locus_tag="PAE0165"
FT   CDS_pept        86727..87071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62606"
FT                   /db_xref="GOA:Q8ZZN3"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN3"
FT                   /protein_id="AAL62606.1"
FT                   LQRLEMLYGI"
FT   gene            87061..87432
FT                   /locus_tag="PAE0166"
FT   CDS_pept        87061..87432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0166"
FT                   /product="paREP11"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62607"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN2"
FT                   /protein_id="AAL62607.1"
FT   gene            complement(87429..87824)
FT                   /locus_tag="PAE0167"
FT   CDS_pept        complement(87429..87824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0167"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62608"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN1"
FT                   /protein_id="AAL62608.1"
FT   gene            complement(87794..88186)
FT                   /locus_tag="PAE0168"
FT   CDS_pept        complement(87794..88186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62609"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZN0"
FT                   /protein_id="AAL62609.1"
FT   gene            88245..88883
FT                   /locus_tag="PAE0170"
FT   CDS_pept        88245..88883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0170"
FT                   /product="conserved protein (tenA homolog)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62610"
FT                   /db_xref="GOA:Q8ZZM9"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="PDB:2GM7"
FT                   /db_xref="PDB:2GM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM9"
FT                   /protein_id="AAL62610.1"
FT   gene            88870..89463
FT                   /locus_tag="PAE0171"
FT   CDS_pept        88870..89463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62611"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM8"
FT                   /protein_id="AAL62611.1"
FT   gene            89519..90745
FT                   /locus_tag="PAE0172"
FT   CDS_pept        89519..90745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62612"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM7"
FT                   /protein_id="AAL62612.1"
FT                   AEYLFGEVP"
FT   gene            complement(90760..90972)
FT                   /locus_tag="PAE0173"
FT   CDS_pept        complement(90760..90972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0173"
FT                   /product="ribosomal protein L24, conjectural"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62613"
FT                   /db_xref="GOA:Q8ZZM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM6"
FT                   /protein_id="AAL62613.1"
FT   gene            complement(90956..91741)
FT                   /locus_tag="PAE0175"
FT   CDS_pept        complement(90956..91741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0175"
FT                   /product="thiamine biosynthetic enzyme (thi1)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62614"
FT                   /db_xref="GOA:Q8ZZM5"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZM5"
FT                   /protein_id="AAL62614.1"
FT   gene            91828..93081
FT                   /locus_tag="PAE0176"
FT   CDS_pept        91828..93081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0176"
FT                   /product="metabolite transport protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62615"
FT                   /db_xref="GOA:Q8ZZM4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM4"
FT                   /protein_id="AAL62615.1"
FT                   VWHAKGVESARRELEELA"
FT   gene            93173..93466
FT                   /locus_tag="PAE0178"
FT   CDS_pept        93173..93466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0178"
FT                   /product="P. aerophilum family 562 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62616"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM3"
FT                   /protein_id="AAL62616.1"
FT   gene            93587..94363
FT                   /locus_tag="PAE0180"
FT   CDS_pept        93587..94363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0180"
FT                   /product="P. aerophilum family 577 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62617"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM2"
FT                   /protein_id="AAL62617.1"
FT   gene            complement(94405..95193)
FT                   /locus_tag="PAE0181"
FT   CDS_pept        complement(94405..95193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62618"
FT                   /db_xref="GOA:Q8ZZM1"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM1"
FT                   /protein_id="AAL62618.1"
FT   gene            complement(101069..101641)
FT                   /locus_tag="PAE0198"
FT   CDS_pept        complement(101069..101641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62619"
FT                   /db_xref="GOA:Q8ZZM0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZM0"
FT                   /protein_id="AAL62619.1"
FT   gene            complement(101625..101900)
FT                   /locus_tag="PAE0199"
FT   CDS_pept        complement(101625..101900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62620"
FT                   /db_xref="GOA:Q8ZZL9"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZL9"
FT                   /protein_id="AAL62620.1"
FT   gene            complement(101888..102775)
FT                   /locus_tag="PAE0200"
FT   CDS_pept        complement(101888..102775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62621"
FT                   /db_xref="GOA:Q8ZZL8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZL8"
FT                   /protein_id="AAL62621.1"
FT                   HREARSIAKALCTS"
FT   gene            complement(102756..103604)
FT                   /locus_tag="PAE0201"
FT   CDS_pept        complement(102756..103604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62622"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL7"
FT                   /protein_id="AAL62622.1"
FT                   R"
FT   gene            103683..104288
FT                   /locus_tag="PAE0202"
FT   CDS_pept        103683..104288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62623"
FT                   /db_xref="GOA:Q8ZZL6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL6"
FT                   /protein_id="AAL62623.1"
FT   gene            complement(104858..105754)
FT                   /locus_tag="PAE0204"
FT   CDS_pept        complement(104858..105754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0204"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62624"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL5"
FT                   /protein_id="AAL62624.1"
FT                   YTETIAAIYGVKIIKIS"
FT   gene            complement(105739..106782)
FT                   /locus_tag="PAE0205"
FT   CDS_pept        complement(105739..106782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62625"
FT                   /db_xref="InterPro:IPR010184"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL4"
FT                   /protein_id="AAL62625.1"
FT                   LFTWKLK"
FT   gene            complement(106776..107543)
FT                   /locus_tag="PAE0207"
FT   CDS_pept        complement(106776..107543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62626"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL3"
FT                   /protein_id="AAL62626.1"
FT   gene            complement(107626..109290)
FT                   /locus_tag="PAE0208"
FT   CDS_pept        complement(107626..109290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0208"
FT                   /product="helicase, probable"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62627"
FT                   /db_xref="GOA:Q8ZZL2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL2"
FT                   /protein_id="AAL62627.1"
FT   gene            complement(109280..109972)
FT                   /locus_tag="PAE0209"
FT   CDS_pept        complement(109280..109972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0209"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62628"
FT                   /db_xref="GOA:Q8ZZL1"
FT                   /db_xref="InterPro:IPR010153"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL1"
FT                   /protein_id="AAL62628.1"
FT                   AFPAGHDW"
FT   gene            complement(109969..110946)
FT                   /locus_tag="PAE0210"
FT   CDS_pept        complement(109969..110946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62629"
FT                   /db_xref="InterPro:IPR002764"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZL0"
FT                   /protein_id="AAL62629.1"
FT   gene            complement(110950..111372)
FT                   /locus_tag="PAE0211"
FT   CDS_pept        complement(110950..111372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK9"
FT                   /protein_id="AAL62630.1"
FT   gene            111782..112546
FT                   /locus_tag="PAE0212"
FT   CDS_pept        111782..112546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0212"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62631"
FT                   /db_xref="GOA:Q8ZZK8"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK8"
FT                   /protein_id="AAL62631.1"
FT   gene            complement(112713..113093)
FT                   /locus_tag="PAE0213"
FT   CDS_pept        complement(112713..113093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0213"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62632"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK7"
FT                   /protein_id="AAL62632.1"
FT   gene            complement(113166..113483)
FT                   /locus_tag="PAE0214"
FT   CDS_pept        complement(113166..113483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0214"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK6"
FT                   /protein_id="AAL62633.1"
FT                   S"
FT   gene            complement(113621..114325)
FT                   /locus_tag="PAE0215"
FT   CDS_pept        complement(113621..114325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0215"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (purC)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62634"
FT                   /db_xref="GOA:Q8ZZK5"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZK5"
FT                   /protein_id="AAL62634.1"
FT                   LLQITKETFTRI"
FT   gene            114440..115882
FT                   /locus_tag="PAE0216"
FT   CDS_pept        114440..115882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0216"
FT                   /product="phosphoribosylglycinamide synthetase (GARS)
FT                   (purD)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62635"
FT                   /db_xref="GOA:Q8ZZK4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK4"
FT                   /protein_id="AAL62635.1"
FT   gene            115885..117021
FT                   /locus_tag="PAE0218"
FT   CDS_pept        115885..117021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0218"
FT                   /product="amidophosphoribosyltransferase (purF)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62636"
FT                   /db_xref="GOA:Q8ZZK3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK3"
FT                   /protein_id="AAL62636.1"
FT   gene            117018..117842
FT                   /locus_tag="PAE0219"
FT   CDS_pept        117018..117842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0219"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62637"
FT                   /db_xref="GOA:Q8ZZK2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK2"
FT                   /protein_id="AAL62637.1"
FT   gene            117827..118762
FT                   /locus_tag="PAE0220"
FT   CDS_pept        117827..118762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0220"
FT                   /product="methylenetetrahydrofolate dehydrogenase (folD)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62638"
FT                   /db_xref="GOA:Q8ZZK1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZK1"
FT                   /protein_id="AAL62638.1"
FT   gene            118752..119684
FT                   /locus_tag="PAE0221"
FT   CDS_pept        118752..119684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0221"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase
FT                   (AIRS) (purM)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62639"
FT                   /db_xref="GOA:Q8ZZK0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZK0"
FT                   /protein_id="AAL62639.1"
FT   gene            complement(119681..120319)
FT                   /locus_tag="PAE0222"
FT   CDS_pept        complement(119681..120319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0222"
FT                   /product="phosphoribosylformylglycinamidine synthase I
FT                   (FGAM synthase I) (purQ)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62640"
FT                   /db_xref="GOA:Q8ZZJ9"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZJ9"
FT                   /protein_id="AAL62640.1"
FT   gene            complement(120316..120570)
FT                   /locus_tag="PAE0224"
FT   CDS_pept        complement(120316..120570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62641"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ8"
FT                   /protein_id="AAL62641.1"
FT   gene            120715..122808
FT                   /locus_tag="PAE0225"
FT   CDS_pept        120715..122808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0225"
FT                   /product="phosphoribosylformylglycinamidine synthase II
FT                   (FGAM synthase II) (purL)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62642"
FT                   /db_xref="GOA:Q8ZZJ7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZJ7"
FT                   /protein_id="AAL62642.1"
FT                   LKI"
FT   gene            122811..124073
FT                   /locus_tag="PAE0226"
FT   CDS_pept        122811..124073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0226"
FT                   /product="amidophosphoribosyltransferase (purF)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62643"
FT                   /db_xref="GOA:Q8ZZJ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ6"
FT                   /protein_id="AAL62643.1"
FT   gene            124112..124504
FT                   /locus_tag="PAE0227"
FT   CDS_pept        124112..124504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0227"
FT                   /product="conserved within P. aerophilum, authentic
FT                   frameshift"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ5"
FT                   /protein_id="AAL62644.1"
FT   gene            complement(124738..124851)
FT                   /locus_tag="PAE0228"
FT   CDS_pept        complement(124738..124851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0228"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62645"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ4"
FT                   /protein_id="AAL62645.1"
FT   gene            124986..125468
FT                   /locus_tag="PAE0230"
FT   CDS_pept        124986..125468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0230"
FT                   /product="paREP8"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62646"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ3"
FT                   /protein_id="AAL62646.1"
FT   gene            complement(125655..126794)
FT                   /locus_tag="PAE0232"
FT   CDS_pept        complement(125655..126794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0232"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit (AIRC) (purK)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62647"
FT                   /db_xref="GOA:Q8ZZJ2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ2"
FT                   /protein_id="AAL62647.1"
FT   gene            127002..127232
FT                   /locus_tag="PAE0235"
FT   CDS_pept        127002..127232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0235"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ1"
FT                   /protein_id="AAL62648.1"
FT   gene            complement(127222..127434)
FT                   /locus_tag="PAE0237"
FT   CDS_pept        complement(127222..127434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0237"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62649"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZJ0"
FT                   /protein_id="AAL62649.1"
FT   gene            128019..128900
FT                   /locus_tag="PAE0239"
FT   CDS_pept        128019..128900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62650"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI9"
FT                   /protein_id="AAL62650.1"
FT                   VMRLLKWLEVVK"
FT   gene            128936..129112
FT                   /locus_tag="PAE0240"
FT   CDS_pept        128936..129112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0240"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI8"
FT                   /protein_id="AAL62651.1"
FT                   KEFVLRVGLRRRG"
FT   gene            129407..133126
FT                   /locus_tag="PAE0242"
FT   CDS_pept        129407..133126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0242"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62652"
FT                   /db_xref="GOA:Q8ZZI7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI7"
FT                   /protein_id="AAL62652.1"
FT                   PEGPRRRSTLFGSR"
FT   gene            133123..134535
FT                   /locus_tag="PAE0243"
FT   CDS_pept        133123..134535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0243"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62653"
FT                   /db_xref="GOA:Q8ZZI6"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI6"
FT                   /protein_id="AAL62653.1"
FT                   FPREVLSVRVLP"
FT   gene            complement(134977..136785)
FT                   /locus_tag="PAE0245"
FT   CDS_pept        complement(134977..136785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62654"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI5"
FT                   /protein_id="AAL62654.1"
FT   gene            complement(136775..137797)
FT                   /locus_tag="PAE0246"
FT   CDS_pept        complement(136775..137797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62655"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI4"
FT                   /protein_id="AAL62655.1"
FT                   "
FT   gene            complement(138129..138272)
FT                   /locus_tag="PAE0247"
FT   CDS_pept        complement(138129..138272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0247"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI3"
FT                   /protein_id="AAL62656.1"
FT                   AP"
FT   gene            complement(138506..139126)
FT                   /locus_tag="PAE0249"
FT   CDS_pept        complement(138506..139126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0249"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62657"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI2"
FT                   /protein_id="AAL62657.1"
FT   gene            complement(139466..139954)
FT                   /locus_tag="PAE0250"
FT   CDS_pept        complement(139466..139954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0250"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit (AIRC) (purE)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62658"
FT                   /db_xref="GOA:Q8ZZI1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI1"
FT                   /protein_id="AAL62658.1"
FT   gene            complement(140026..140457)
FT                   /locus_tag="PAE0252"
FT   CDS_pept        complement(140026..140457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0252"
FT                   /product="diadenosine 5'5'''-P1,P4-tetraphosphate
FT                   pyrophosphohydrolase (mutT/nudix family protein)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62659"
FT                   /db_xref="GOA:Q7LX33"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003565"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LX33"
FT                   /protein_id="AAL62659.1"
FT   gene            140551..140814
FT                   /locus_tag="PAE0253"
FT   CDS_pept        140551..140814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0253"
FT                   /product="P. aerophilum family 562 protein, associated with
FT                   P. aerophilum family 577, degenerate"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62660"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZI0"
FT                   /protein_id="AAL62660.1"
FT   gene            140805..141371
FT                   /locus_tag="PAE0254"
FT   CDS_pept        140805..141371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0254"
FT                   /product="P. aerophilum family 577 protein, associated with
FT                   P. aerophilum family 562, degenerate"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH9"
FT                   /protein_id="AAL62661.1"
FT   gene            complement(141637..142059)
FT                   /locus_tag="PAE0256"
FT   CDS_pept        complement(141637..142059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0256"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62662"
FT                   /db_xref="GOA:Q8ZZH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH8"
FT                   /protein_id="AAL62662.1"
FT   gene            complement(142112..143281)
FT                   /locus_tag="PAE0257"
FT   CDS_pept        complement(142112..143281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0257"
FT                   /product="tryptophan synthase beta subunit (trpB),
FT                   authentic frameshift"
FT                   /note="Amino acid biosynthesis; Aromatic amino acid family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62663"
FT                   /db_xref="GOA:Q8ZZH7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH7"
FT                   /protein_id="AAL62663.1"
FT   gene            143521..144135
FT                   /locus_tag="PAE0261"
FT   CDS_pept        143521..144135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0261"
FT                   /product="methylase, conjectural"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62664"
FT                   /db_xref="GOA:Q8ZZH6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH6"
FT                   /protein_id="AAL62664.1"
FT   gene            144159..145166
FT                   /locus_tag="PAE0262"
FT   CDS_pept        144159..145166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0262"
FT                   /product="prohibitin homolog (hflK family)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62665"
FT                   /db_xref="GOA:Q8ZZH5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH5"
FT                   /protein_id="AAL62665.1"
FT   gene            145163..145501
FT                   /locus_tag="PAE0263"
FT   CDS_pept        145163..145501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0263"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62666"
FT                   /db_xref="GOA:Q8ZZH4"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH4"
FT                   /protein_id="AAL62666.1"
FT                   NGEEYYDL"
FT   gene            145542..146108
FT                   /locus_tag="PAE0264"
FT   CDS_pept        145542..146108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0264"
FT                   /product="signal peptidase"
FT                   /note="Protein fate; Protein and peptide secretion and
FT                   trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62667"
FT                   /db_xref="GOA:Q8ZZH3"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH3"
FT                   /protein_id="AAL62667.1"
FT   gene            146662..147021
FT                   /locus_tag="PAE0265"
FT   CDS_pept        146662..147021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0265"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH2"
FT                   /protein_id="AAL62668.1"
FT                   YWVNVGGGNGQICAS"
FT   gene            147290..147880
FT                   /locus_tag="PAE0267"
FT   CDS_pept        147290..147880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0267"
FT                   /product="intracellular protease"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62669"
FT                   /db_xref="GOA:Q8ZZH1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH1"
FT                   /protein_id="AAL62669.1"
FT   gene            complement(148029..148304)
FT                   /locus_tag="PAE0268"
FT   CDS_pept        complement(148029..148304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0268"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62670"
FT                   /db_xref="GOA:Q8ZZH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZH0"
FT                   /protein_id="AAL62670.1"
FT   gene            148392..149345
FT                   /locus_tag="PAE0269"
FT   CDS_pept        148392..149345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0269"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62671"
FT                   /db_xref="GOA:Q8ZZG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG9"
FT                   /protein_id="AAL62671.1"
FT   gene            149342..150106
FT                   /locus_tag="PAE0270"
FT   CDS_pept        149342..150106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0270"
FT                   /product="membrane protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62672"
FT                   /db_xref="GOA:Q8ZZG8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG8"
FT                   /protein_id="AAL62672.1"
FT   gene            150134..150424
FT                   /locus_tag="PAE0272"
FT   CDS_pept        150134..150424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0272"
FT                   /product="Rieske iron sulfur protein, putative"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62673"
FT                   /db_xref="GOA:Q8ZZG7"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG7"
FT                   /protein_id="AAL62673.1"
FT   gene            complement(150417..151154)
FT                   /locus_tag="PAE0273"
FT   CDS_pept        complement(150417..151154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62674"
FT                   /db_xref="GOA:Q8ZZG6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG6"
FT                   /protein_id="AAL62674.1"
FT   gene            151221..151856
FT                   /locus_tag="PAE0274"
FT   CDS_pept        151221..151856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0274"
FT                   /product="superoxide dismutase (sod)"
FT                   /note="Cellular processes; Toxin production and resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62675"
FT                   /db_xref="GOA:O93724"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:1P7G"
FT                   /db_xref="PDB:3EVK"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93724"
FT                   /protein_id="AAL62675.1"
FT   gene            complement(151862..152734)
FT                   /locus_tag="PAE0275"
FT   CDS_pept        complement(151862..152734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0275"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62676"
FT                   /db_xref="GOA:Q8ZZG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG5"
FT                   /protein_id="AAL62676.1"
FT                   YSEEELISA"
FT   gene            152782..153204
FT                   /locus_tag="PAE0276"
FT   CDS_pept        152782..153204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0276"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG4"
FT                   /protein_id="AAL62677.1"
FT   gene            complement(153585..155069)
FT                   /locus_tag="PAE0278"
FT   CDS_pept        complement(153585..155069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0278"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62678"
FT                   /db_xref="GOA:Q8ZZG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG3"
FT                   /protein_id="AAL62678.1"
FT   gene            complement(155066..156349)
FT                   /locus_tag="PAE0279"
FT   CDS_pept        complement(155066..156349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0279"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62679"
FT                   /db_xref="GOA:Q8ZZG2"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG2"
FT                   /protein_id="AAL62679.1"
FT   gene            complement(156806..157387)
FT                   /locus_tag="PAE0280"
FT   CDS_pept        complement(156806..157387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0280"
FT                   /product="P. aerophilum family 70 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62680"
FT                   /db_xref="GOA:Q8ZZG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG1"
FT                   /protein_id="AAL62680.1"
FT   gene            complement(157359..159680)
FT                   /locus_tag="PAE0282"
FT   CDS_pept        complement(157359..159680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0282"
FT                   /product="P. aerophilum family 68 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62681"
FT                   /db_xref="GOA:Q8ZZG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZG0"
FT                   /protein_id="AAL62681.1"
FT   gene            complement(160080..160505)
FT                   /locus_tag="PAE0284"
FT   CDS_pept        complement(160080..160505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62682"
FT                   /db_xref="GOA:Q8ZZF9"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF9"
FT                   /protein_id="AAL62682.1"
FT   gene            complement(160575..160967)
FT                   /locus_tag="PAE0285"
FT   CDS_pept        complement(160575..160967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62683"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF8"
FT                   /protein_id="AAL62683.1"
FT   gene            complement(160952..161050)
FT                   /locus_tag="PAE0286"
FT   CDS_pept        complement(160952..161050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0286"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62684"
FT                   /protein_id="AAL62684.1"
FT                   /translation="MCRKKAERGQVQLDALRRFKALKDVVDQWRRV"
FT   gene            complement(161995..162159)
FT                   /locus_tag="PAE0288"
FT   CDS_pept        complement(161995..162159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0288"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62685"
FT                   /db_xref="GOA:Q8ZZF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF6"
FT                   /protein_id="AAL62685.1"
FT                   IVIGIGIGI"
FT   gene            complement(162146..163159)
FT                   /locus_tag="PAE0289"
FT   CDS_pept        complement(162146..163159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0289"
FT                   /product="metallo cofactor biosynthesis protein,
FT                   conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62686"
FT                   /db_xref="GOA:Q8ZZF5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF5"
FT                   /protein_id="AAL62686.1"
FT   gene            complement(163159..163416)
FT                   /locus_tag="PAE0290"
FT   CDS_pept        complement(163159..163416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0290"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62687"
FT                   /db_xref="GOA:Q8ZZF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF4"
FT                   /protein_id="AAL62687.1"
FT   gene            complement(163413..163982)
FT                   /locus_tag="PAE0292"
FT   CDS_pept        complement(163413..163982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0292"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62688"
FT                   /db_xref="GOA:Q8ZZF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF3"
FT                   /protein_id="AAL62688.1"
FT   gene            164013..164492
FT                   /locus_tag="PAE0293"
FT   CDS_pept        164013..164492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0293"
FT                   /product="P. aerophilum family 321 protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62689"
FT                   /db_xref="GOA:Q8ZZF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF2"
FT                   /protein_id="AAL62689.1"
FT   gene            164489..165313
FT                   /locus_tag="PAE0294"
FT   CDS_pept        164489..165313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0294"
FT                   /product="P. aerophilum family 322 protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62690"
FT                   /db_xref="GOA:Q8ZZF1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF1"
FT                   /protein_id="AAL62690.1"
FT   gene            complement(165416..165508)
FT                   /locus_tag="PAE0294a"
FT   CDS_pept        complement(165416..165508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0294a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0294a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62691"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZF0"
FT                   /protein_id="AAL62691.1"
FT                   /translation="MSEAKASIIMAIVTTAVVALDNAVASLRKL"
FT   gene            165922..166062
FT                   /locus_tag="PAE0294b"
FT   CDS_pept        165922..166062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0294b"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0294b"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62692"
FT                   /db_xref="InterPro:IPR012490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE9"
FT                   /protein_id="AAL62692.1"
FT                   K"
FT   gene            complement(166202..166417)
FT                   /locus_tag="PAE0296"
FT   CDS_pept        complement(166202..166417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0296"
FT                   /product="helix-turn-helix protein, conjectural"
FT                   /note="Transcription; Transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62693"
FT                   /db_xref="GOA:Q8ZZE8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE8"
FT                   /protein_id="AAL62693.1"
FT   gene            complement(166449..167366)
FT                   /locus_tag="PAE0297"
FT   CDS_pept        complement(166449..167366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62694"
FT                   /db_xref="GOA:Q8ZZE7"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE7"
FT                   /protein_id="AAL62694.1"
FT   gene            complement(167453..167508)
FT                   /locus_tag="PAEsR19"
FT   ncRNA           complement(167453..167508)
FT                   /locus_tag="PAEsR19"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   16S at G42"
FT                   /ncRNA_class="other"
FT   gene            complement(167482..167952)
FT                   /locus_tag="PAE0298"
FT   CDS_pept        complement(167482..167952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0298"
FT                   /product="paREP2a"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62695"
FT                   /db_xref="InterPro:IPR012490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE6"
FT                   /protein_id="AAL62695.1"
FT   gene            168033..169259
FT                   /locus_tag="PAE0299"
FT   CDS_pept        168033..169259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0299"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62696"
FT                   /db_xref="InterPro:IPR011689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE5"
FT                   /protein_id="AAL62696.1"
FT                   YAEVMREHR"
FT   gene            169487..169972
FT                   /locus_tag="PAE0301"
FT   CDS_pept        169487..169972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0301"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62697"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE4"
FT                   /protein_id="AAL62697.1"
FT   gene            complement(169961..170437)
FT                   /locus_tag="PAE0302"
FT   CDS_pept        complement(169961..170437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0302"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62698"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE3"
FT                   /protein_id="AAL62698.1"
FT   gene            complement(170456..171220)
FT                   /locus_tag="PAE0303"
FT   CDS_pept        complement(170456..171220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0303"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62699"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE2"
FT                   /protein_id="AAL62699.1"
FT   gene            complement(171205..171357)
FT                   /locus_tag="PAE0304"
FT   CDS_pept        complement(171205..171357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0304"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE1"
FT                   /protein_id="AAL62700.1"
FT                   RWSRR"
FT   gene            complement(171399..171551)
FT                   /locus_tag="PAE0305"
FT   CDS_pept        complement(171399..171551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62701"
FT                   /db_xref="GOA:Q8ZZE0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZE0"
FT                   /protein_id="AAL62701.1"
FT                   KVLQS"
FT   gene            complement(171767..171946)
FT                   /locus_tag="PAE0307"
FT   CDS_pept        complement(171767..171946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0307"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62702"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD9"
FT                   /protein_id="AAL62702.1"
FT                   PVRGVLKEAELYLL"
FT   gene            complement(171931..172116)
FT                   /locus_tag="PAE0308"
FT   CDS_pept        complement(171931..172116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0308"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62703"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD8"
FT                   /protein_id="AAL62703.1"
FT                   QPIKGLRLLEAMWSGM"
FT   gene            172151..173206
FT                   /locus_tag="PAE0309"
FT   CDS_pept        172151..173206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0309"
FT                   /product="chlorohydrolase, conjectural"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62704"
FT                   /db_xref="GOA:Q8ZZD7"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD7"
FT                   /protein_id="AAL62704.1"
FT                   IEGGRLLQAWH"
FT   gene            complement(173486..173884)
FT                   /locus_tag="PAE0311"
FT   CDS_pept        complement(173486..173884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0311"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62705"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD6"
FT                   /protein_id="AAL62705.1"
FT   gene            complement(173878..174126)
FT                   /locus_tag="PAE0312"
FT   CDS_pept        complement(173878..174126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0312"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD5"
FT                   /protein_id="AAL62706.1"
FT   gene            complement(174245..174427)
FT                   /locus_tag="PAE0313"
FT   CDS_pept        complement(174245..174427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0313"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62707"
FT                   /db_xref="GOA:Q8ZZD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD4"
FT                   /protein_id="AAL62707.1"
FT                   VVVGATAPLLLKKFS"
FT   gene            complement(174484..175128)
FT                   /locus_tag="PAE0314"
FT   CDS_pept        complement(174484..175128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0314"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62708"
FT                   /db_xref="GOA:Q8ZZD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD3"
FT                   /protein_id="AAL62708.1"
FT   gene            175597..176487
FT                   /locus_tag="PAE0315"
FT   CDS_pept        175597..176487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0315"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62709"
FT                   /db_xref="GOA:Q8ZZD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD2"
FT                   /protein_id="AAL62709.1"
FT                   VLLTIGRLGEEYEDN"
FT   gene            176474..177199
FT                   /locus_tag="PAE0316"
FT   CDS_pept        176474..177199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0316"
FT                   /product="ABC-2 type transport system, membrane protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62710"
FT                   /db_xref="GOA:Q8ZZD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD1"
FT                   /protein_id="AAL62710.1"
FT   gene            complement(177307..177636)
FT                   /locus_tag="PAE0317"
FT   CDS_pept        complement(177307..177636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0317"
FT                   /product="GTP cyclohydrolase I, conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Folic acid"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62711"
FT                   /db_xref="GOA:Q8ZZD0"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZD0"
FT                   /protein_id="AAL62711.1"
FT                   QPLYI"
FT   gene            177677..179293
FT                   /locus_tag="PAE0318"
FT   CDS_pept        177677..179293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0318"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62712"
FT                   /db_xref="GOA:Q8ZZC9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC9"
FT                   /protein_id="AAL62712.1"
FT   gene            179299..180441
FT                   /locus_tag="PAE0320"
FT   CDS_pept        179299..180441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0320"
FT                   /product="P. aerophilum family 417, putative ATP binding"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62713"
FT                   /db_xref="GOA:Q8ZZC8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC8"
FT                   /protein_id="AAL62713.1"
FT   gene            180435..181586
FT                   /locus_tag="PAE0322"
FT   CDS_pept        180435..181586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0322"
FT                   /product="dihydroorotase (pyrC)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62714"
FT                   /db_xref="GOA:Q8ZZC7"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZC7"
FT                   /protein_id="AAL62714.1"
FT   gene            complement(181627..183009)
FT                   /locus_tag="PAE0323"
FT   CDS_pept        complement(181627..183009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0323"
FT                   /product="iron (II) transporter (feoB-2) part 1,
FT                   conjectural, authentic frameshift"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62715"
FT                   /db_xref="GOA:Q8ZZC6"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC6"
FT                   /protein_id="AAL62715.1"
FT                   PL"
FT   gene            complement(183054..183332)
FT                   /locus_tag="PAE0324"
FT   CDS_pept        complement(183054..183332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0324"
FT                   /product="iron (II) transporter (feoB-2) part 2,
FT                   conjectural, authentic frameshift"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62716"
FT                   /db_xref="GOA:Q8ZZC5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC5"
FT                   /protein_id="AAL62716.1"
FT   gene            183602..184522
FT                   /locus_tag="PAE0328"
FT   CDS_pept        183602..184522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0328"
FT                   /product="thiamine transport ATP-binding protein"
FT                   /note="Transport and binding proteins; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62717"
FT                   /db_xref="GOA:Q8ZZC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC4"
FT                   /protein_id="AAL62717.1"
FT   gene            complement(184519..185967)
FT                   /locus_tag="PAE0329"
FT   CDS_pept        complement(184519..185967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62718"
FT                   /db_xref="GOA:Q8ZZC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC3"
FT                   /protein_id="AAL62718.1"
FT   gene            complement(186079..186945)
FT                   /locus_tag="PAE0331"
FT   CDS_pept        complement(186079..186945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0331"
FT                   /product="thiamine-binding periplasmic protein"
FT                   /note="Transport and binding proteins; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62719"
FT                   /db_xref="GOA:Q8ZZC2"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZC2"
FT                   /protein_id="AAL62719.1"
FT                   GQDLVDP"
FT   gene            187005..187059
FT                   /locus_tag="PAEsR02"
FT   ncRNA           187005..187059
FT                   /locus_tag="PAEsR02"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at C779"
FT                   /ncRNA_class="other"
FT   gene            complement(187058..189280)
FT                   /locus_tag="PAE0332"
FT   CDS_pept        complement(187058..189280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0332"
FT                   /product="translation elongation factor aEF-2"
FT                   /note="Protein synthesis; Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62720"
FT                   /db_xref="GOA:Q8ZZC1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZC1"
FT                   /protein_id="AAL62720.1"
FT   gene            complement(189328..190620)
FT                   /locus_tag="PAE0333"
FT   CDS_pept        complement(189328..190620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0333"
FT                   /product="thiamine biosynthesis protein (thiC)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62721"
FT                   /db_xref="GOA:Q8ZZC0"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZC0"
FT                   /protein_id="AAL62721.1"
FT   gene            190768..191052
FT                   /locus_tag="PAE0335"
FT   CDS_pept        190768..191052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0335"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62722"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB9"
FT                   /protein_id="AAL62722.1"
FT   gene            191049..191489
FT                   /locus_tag="PAE0337"
FT   CDS_pept        191049..191489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62723"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB8"
FT                   /protein_id="AAL62723.1"
FT   gene            191524..191688
FT                   /locus_tag="PAE0338"
FT   CDS_pept        191524..191688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0338"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62724"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB7"
FT                   /protein_id="AAL62724.1"
FT                   QNILRPCAL"
FT   gene            complement(191798..192757)
FT                   /locus_tag="PAE0339"
FT   CDS_pept        complement(191798..192757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0339"
FT                   /product="cobalamin biosynthesis protein G (cbiG)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62725"
FT                   /db_xref="GOA:Q8ZZB6"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB6"
FT                   /protein_id="AAL62725.1"
FT   gene            complement(192744..193385)
FT                   /locus_tag="PAE0340"
FT   CDS_pept        complement(192744..193385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0340"
FT                   /product="cobalamin biosynthesis precorrin-6Y methylase
FT                   (cbiE)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62726"
FT                   /db_xref="GOA:Q8ZZB5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB5"
FT                   /protein_id="AAL62726.1"
FT   gene            193478..193705
FT                   /locus_tag="PAE0341"
FT   CDS_pept        193478..193705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0341"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62727"
FT                   /db_xref="GOA:Q8ZZB4"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB4"
FT                   /protein_id="AAL62727.1"
FT   gene            193746..194294
FT                   /locus_tag="PAE0342"
FT   CDS_pept        193746..194294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0342"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62728"
FT                   /db_xref="GOA:Q8ZZB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB3"
FT                   /protein_id="AAL62728.1"
FT   gene            194282..195235
FT                   /locus_tag="PAE0343"
FT   CDS_pept        194282..195235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0343"
FT                   /product="cobalamin biosynthesis putative precorrin-8X
FT                   methylmutase (precorrin isomerase)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62729"
FT                   /db_xref="GOA:Q8ZZB2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB2"
FT                   /protein_id="AAL62729.1"
FT   gene            195225..195962
FT                   /locus_tag="PAE0344"
FT   CDS_pept        195225..195962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0344"
FT                   /product="cobalamin biosynthesis precorrin-3 methylase
FT                   (cbiF)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62730"
FT                   /db_xref="GOA:Q8ZZB1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZB1"
FT                   /protein_id="AAL62730.1"
FT   gene            195959..196981
FT                   /locus_tag="PAE0346"
FT   CDS_pept        195959..196981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0346"
FT                   /product="cobalamin biosynthesis protein D (cbiD)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62731"
FT                   /db_xref="GOA:Q8ZZB0"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZB0"
FT                   /protein_id="AAL62731.1"
FT                   "
FT   gene            196978..197568
FT                   /locus_tag="PAE0347"
FT   CDS_pept        196978..197568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0347"
FT                   /product="cobalamin biosynthesis precorrin-8W decarboxylase
FT                   (cbiT)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62732"
FT                   /db_xref="GOA:Q8ZZA9"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZA9"
FT                   /protein_id="AAL62732.1"
FT   gene            197561..198187
FT                   /locus_tag="PAE0348"
FT   CDS_pept        197561..198187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0348"
FT                   /product="cobalamin biosynthesis precorrin-3 methylase
FT                   (cbiF)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62733"
FT                   /db_xref="GOA:Q8ZZA8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA8"
FT                   /protein_id="AAL62733.1"
FT   gene            198172..198960
FT                   /locus_tag="PAE0349"
FT   CDS_pept        198172..198960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0349"
FT                   /product="cobalamin biosynthesis precorrin-3 methylase
FT                   (cbiF)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62734"
FT                   /db_xref="GOA:Q8ZZA7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA7"
FT                   /protein_id="AAL62734.1"
FT   gene            complement(199877..200164)
FT                   /locus_tag="PAE0351"
FT   CDS_pept        complement(199877..200164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0351"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62735"
FT                   /db_xref="GOA:Q8ZZA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA6"
FT                   /protein_id="AAL62735.1"
FT   gene            200276..200692
FT                   /locus_tag="PAE0353"
FT   CDS_pept        200276..200692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0353"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62736"
FT                   /db_xref="GOA:Q8ZZA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA5"
FT                   /protein_id="AAL62736.1"
FT   gene            complement(201001..201618)
FT                   /locus_tag="PAE0355"
FT   CDS_pept        complement(201001..201618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62737"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA4"
FT                   /protein_id="AAL62737.1"
FT   gene            complement(202050..203054)
FT                   /locus_tag="PAE0356"
FT   CDS_pept        complement(202050..203054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0356"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62738"
FT                   /db_xref="GOA:Q8ZZA3"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA3"
FT                   /protein_id="AAL62738.1"
FT   gene            complement(203378..204043)
FT                   /locus_tag="PAE0360"
FT   CDS_pept        complement(203378..204043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0360"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62739"
FT                   /db_xref="GOA:Q8ZZA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030283"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA2"
FT                   /protein_id="AAL62739.1"
FT   gene            complement(204046..205620)
FT                   /locus_tag="PAE0362"
FT   CDS_pept        complement(204046..205620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0362"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62740"
FT                   /db_xref="InterPro:IPR011689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA1"
FT                   /protein_id="AAL62740.1"
FT                   QSQMSNK"
FT   gene            205731..205877
FT                   /locus_tag="PAE0364"
FT   CDS_pept        205731..205877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0364"
FT                   /product="paREP2a"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62741"
FT                   /db_xref="InterPro:IPR012490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZA0"
FT                   /protein_id="AAL62741.1"
FT                   DGS"
FT   gene            complement(205916..206833)
FT                   /locus_tag="PAE0366"
FT   CDS_pept        complement(205916..206833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0366"
FT                   /product="iron (III) dicitrate transport system, permease
FT                   protein, putative"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62742"
FT                   /db_xref="GOA:Q8ZZ99"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ99"
FT                   /protein_id="AAL62742.1"
FT   gene            complement(206830..208152)
FT                   /locus_tag="PAE0367"
FT   CDS_pept        complement(206830..208152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62743"
FT                   /db_xref="GOA:Q8ZZ98"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ98"
FT                   /protein_id="AAL62743.1"
FT   gene            complement(208175..209341)
FT                   /locus_tag="PAE0368"
FT   CDS_pept        complement(208175..209341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0368"
FT                   /product="protease"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62744"
FT                   /db_xref="GOA:Q8ZZ97"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ97"
FT                   /protein_id="AAL62744.1"
FT   gene            209386..210216
FT                   /locus_tag="PAE0369"
FT   CDS_pept        209386..210216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0369"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62745"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ96"
FT                   /protein_id="AAL62745.1"
FT   gene            complement(210547..211011)
FT                   /locus_tag="PAE0370"
FT   CDS_pept        complement(210547..211011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0370"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62746"
FT                   /db_xref="GOA:Q8ZZ95"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ95"
FT                   /protein_id="AAL62746.1"
FT   gene            complement(211040..212035)
FT                   /locus_tag="PAE0371"
FT   CDS_pept        complement(211040..212035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62747"
FT                   /db_xref="GOA:Q8ZZ94"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR017577"
FT                   /db_xref="InterPro:IPR021167"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ94"
FT                   /protein_id="AAL62747.1"
FT   gene            complement(212025..213041)
FT                   /locus_tag="PAE0372"
FT   CDS_pept        complement(212025..213041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62748"
FT                   /db_xref="GOA:Q8ZZ93"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZ93"
FT                   /protein_id="AAL62748.1"
FT   gene            213289..213894
FT                   /locus_tag="PAE0374"
FT   CDS_pept        213289..213894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62749"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ92"
FT                   /protein_id="AAL62749.1"
FT   gene            213891..214715
FT                   /locus_tag="PAE0376"
FT   CDS_pept        213891..214715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0376"
FT                   /product="asparagine synthetase (asnB)"
FT                   /note="Amino acid biosynthesis; Aspartate family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62750"
FT                   /db_xref="GOA:Q8ZZ91"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ91"
FT                   /protein_id="AAL62750.1"
FT   gene            214660..215607
FT                   /locus_tag="PAE0377"
FT   CDS_pept        214660..215607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0377"
FT                   /product="cobC aminotransferase, conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62751"
FT                   /db_xref="GOA:Q8ZZ90"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ90"
FT                   /protein_id="AAL62751.1"
FT   gene            215594..216268
FT                   /locus_tag="PAE0379"
FT   CDS_pept        215594..216268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0379"
FT                   /product="cobalamin (5'-phosphate) synthase (cobS)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62752"
FT                   /db_xref="GOA:Q8ZZ89"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZZ89"
FT                   /protein_id="AAL62752.1"
FT                   AF"
FT   gene            216243..217214
FT                   /locus_tag="PAE0381"
FT   CDS_pept        216243..217214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0381"
FT                   /product="cobalamin biosynthesis protein B (cbiB)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62753"
FT                   /db_xref="GOA:Q8ZZ88"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ88"
FT                   /protein_id="AAL62753.1"
FT   gene            217626..217796
FT                   /locus_tag="PAE0384"
FT   CDS_pept        217626..217796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0384"
FT                   /product="paREP4"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62754"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ87"
FT                   /protein_id="AAL62754.1"
FT                   IKVYRLLGKKK"
FT   gene            217818..218105
FT                   /locus_tag="PAE0385"
FT   CDS_pept        217818..218105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0385"
FT                   /product="metal ion binding transcriptional regulator,
FT                   conjectural"
FT                   /note="Regulatory functions; General"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62755"
FT                   /db_xref="GOA:Q8ZZ86"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ86"
FT                   /protein_id="AAL62755.1"
FT   gene            complement(218143..218379)
FT                   /locus_tag="PAE0388"
FT   CDS_pept        complement(218143..218379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0388"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ85"
FT                   /protein_id="AAL62756.1"
FT   gene            complement(218432..219046)
FT                   /locus_tag="PAE0389"
FT   CDS_pept        complement(218432..219046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0389"
FT                   /product="sulfite oxidase, conjectural"
FT                   /note="Central intermediary metabolism; Sulfur metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62757"
FT                   /db_xref="GOA:Q8ZZ84"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ84"
FT                   /protein_id="AAL62757.1"
FT   gene            complement(219219..219353)
FT                   /locus_tag="PAE0390"
FT   CDS_pept        complement(219219..219353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0390"
FT                   /product="paREP1, degenerate"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62758"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ83"
FT                   /protein_id="AAL62758.1"
FT   gene            219654..219962
FT                   /locus_tag="PAE0391a"
FT   CDS_pept        219654..219962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0391a"
FT                   /product="conserved protein, degenerate"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0391a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62759"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ82"
FT                   /protein_id="AAL62759.1"
FT   gene            219938..220237
FT                   /locus_tag="PAE0393"
FT   CDS_pept        219938..220237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0393"
FT                   /product="paREP6"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62760"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ81"
FT                   /protein_id="AAL62760.1"
FT   gene            220346..220633
FT                   /locus_tag="PAE0394"
FT   CDS_pept        220346..220633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0394"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62761"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ80"
FT                   /protein_id="AAL62761.1"
FT   gene            220627..221037
FT                   /locus_tag="PAE0396"
FT   CDS_pept        220627..221037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0396"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ79"
FT                   /protein_id="AAL62762.1"
FT   gene            221058..221297
FT                   /locus_tag="PAE0397"
FT   CDS_pept        221058..221297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0397"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ78"
FT                   /protein_id="AAL62763.1"
FT   gene            221845..222207
FT                   /locus_tag="PAE0398"
FT   CDS_pept        221845..222207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0398"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62764"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ77"
FT                   /protein_id="AAL62764.1"
FT                   WINTPKRYKNFALVEP"
FT   gene            222410..222637
FT                   /locus_tag="PAE0399"
FT   CDS_pept        222410..222637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0399"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ76"
FT                   /protein_id="AAL62765.1"
FT   gene            222640..222990
FT                   /locus_tag="PAE0401"
FT   CDS_pept        222640..222990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62766"
FT                   /db_xref="GOA:Q8ZZ75"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ75"
FT                   /protein_id="AAL62766.1"
FT                   SWNAAFIKKPSG"
FT   gene            222995..224002
FT                   /locus_tag="PAE0402"
FT   CDS_pept        222995..224002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0402"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62767"
FT                   /db_xref="GOA:Q8ZZ74"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ74"
FT                   /protein_id="AAL62767.1"
FT   gene            224428..225429
FT                   /locus_tag="PAE0404"
FT   CDS_pept        224428..225429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0404"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62768"
FT                   /db_xref="GOA:Q8ZZ73"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ73"
FT                   /protein_id="AAL62768.1"
FT   gene            225611..225922
FT                   /locus_tag="PAE0407"
FT   CDS_pept        225611..225922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0407"
FT                   /product="paREP8"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62769"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ72"
FT                   /protein_id="AAL62769.1"
FT   gene            complement(225966..226175)
FT                   /locus_tag="PAE0409"
FT   CDS_pept        complement(225966..226175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0409"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62770"
FT                   /db_xref="GOA:Q8ZZ71"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ71"
FT                   /protein_id="AAL62770.1"
FT   gene            226397..226648
FT                   /locus_tag="PAE0410"
FT   CDS_pept        226397..226648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0410"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62771"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ70"
FT                   /protein_id="AAL62771.1"
FT   gene            226651..226935
FT                   /locus_tag="PAE0411"
FT   CDS_pept        226651..226935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0411"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ69"
FT                   /protein_id="AAL62772.1"
FT   gene            226953..227087
FT                   /locus_tag="PAE0412"
FT   CDS_pept        226953..227087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0412"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62773"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ68"
FT                   /protein_id="AAL62773.1"
FT   gene            227117..227578
FT                   /locus_tag="PAE0413"
FT   CDS_pept        227117..227578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0413"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62774"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ67"
FT                   /protein_id="AAL62774.1"
FT   gene            complement(227611..227850)
FT                   /locus_tag="PAE0415"
FT   CDS_pept        complement(227611..227850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0415"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62775"
FT                   /db_xref="GOA:Q8ZZ66"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ66"
FT                   /protein_id="AAL62775.1"
FT   gene            227875..228441
FT                   /locus_tag="PAE0417"
FT   CDS_pept        227875..228441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0417"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62776"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ65"
FT                   /protein_id="AAL62776.1"
FT   gene            228549..228746
FT                   /locus_tag="PAE0418"
FT   CDS_pept        228549..228746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0418"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ64"
FT                   /protein_id="AAL62777.1"
FT   gene            228788..229885
FT                   /locus_tag="PAE0419"
FT   CDS_pept        228788..229885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0419"
FT                   /product="glycosyl transferase, putative"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62778"
FT                   /db_xref="GOA:Q8ZZ63"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ63"
FT                   /protein_id="AAL62778.1"
FT   gene            229882..230079
FT                   /locus_tag="PAE0420"
FT   CDS_pept        229882..230079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62779"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ62"
FT                   /protein_id="AAL62779.1"
FT   gene            230101..230646
FT                   /locus_tag="PAE0422"
FT   CDS_pept        230101..230646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0422"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62780"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ61"
FT                   /protein_id="AAL62780.1"
FT                   WGNELEKALGGLREKLGA"
FT   gene            230643..231641
FT                   /locus_tag="PAE0423"
FT   CDS_pept        230643..231641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0423"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62781"
FT                   /db_xref="GOA:Q8ZZ60"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ60"
FT                   /protein_id="AAL62781.1"
FT   gene            231720..231935
FT                   /locus_tag="PAE0424a"
FT   CDS_pept        231720..231935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0424a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0424a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62782"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ59"
FT                   /protein_id="AAL62782.1"
FT   gene            232180..232344
FT                   /locus_tag="PAE0426"
FT   CDS_pept        232180..232344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0426"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ58"
FT                   /protein_id="AAL62783.1"
FT                   EKGRWVRVW"
FT   gene            232338..232556
FT                   /locus_tag="PAE0427"
FT   CDS_pept        232338..232556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62784"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ57"
FT                   /protein_id="AAL62784.1"
FT   gene            complement(232836..232889)
FT                   /locus_tag="PAEsR41"
FT   ncRNA           complement(232836..232889)
FT                   /locus_tag="PAEsR41"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at G751"
FT                   /ncRNA_class="other"
FT   gene            232901..233893
FT                   /locus_tag="PAE0430"
FT   CDS_pept        232901..233893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0430"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62785"
FT                   /db_xref="GOA:Q8ZZ56"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ56"
FT                   /protein_id="AAL62785.1"
FT   gene            233901..235070
FT                   /locus_tag="PAE0431"
FT   CDS_pept        233901..235070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0431"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62786"
FT                   /db_xref="GOA:Q8ZZ55"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ55"
FT                   /protein_id="AAL62786.1"
FT   gene            complement(235050..236390)
FT                   /locus_tag="PAE0432"
FT   CDS_pept        complement(235050..236390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0432"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62787"
FT                   /db_xref="GOA:Q8ZZ54"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ54"
FT                   /protein_id="AAL62787.1"
FT   gene            236353..236883
FT                   /locus_tag="PAE0433"
FT   CDS_pept        236353..236883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0433"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62788"
FT                   /db_xref="GOA:Q8ZZ53"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ53"
FT                   /protein_id="AAL62788.1"
FT                   TFLFDQYYAIHGE"
FT   gene            complement(236871..237203)
FT                   /locus_tag="PAE0434"
FT   CDS_pept        complement(236871..237203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0434"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62789"
FT                   /db_xref="GOA:Q8ZZ52"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ52"
FT                   /protein_id="AAL62789.1"
FT                   RAAYSP"
FT   gene            complement(237185..237970)
FT                   /locus_tag="PAE0435"
FT   CDS_pept        complement(237185..237970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0435"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62790"
FT                   /db_xref="GOA:Q8ZZ51"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ51"
FT                   /protein_id="AAL62790.1"
FT   gene            complement(237967..239244)
FT                   /locus_tag="PAE0436"
FT   CDS_pept        complement(237967..239244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0436"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62791"
FT                   /db_xref="GOA:Q8ZZ50"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ50"
FT                   /protein_id="AAL62791.1"
FT   gene            239296..240480
FT                   /locus_tag="PAE0437"
FT   CDS_pept        239296..240480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0437"
FT                   /product="glycosyltransferase (type 2)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62792"
FT                   /db_xref="GOA:Q8ZZ49"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ49"
FT                   /protein_id="AAL62792.1"
FT   gene            240552..240908
FT                   /locus_tag="PAE0438"
FT   CDS_pept        240552..240908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0438"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62793"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ48"
FT                   /protein_id="AAL62793.1"
FT                   WINTPKQWRPQVAD"
FT   gene            241225..242160
FT                   /locus_tag="PAE0439"
FT   CDS_pept        241225..242160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0439"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62794"
FT                   /db_xref="GOA:Q8ZZ47"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ47"
FT                   /protein_id="AAL62794.1"
FT   gene            242168..243250
FT                   /locus_tag="PAE0440"
FT   CDS_pept        242168..243250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0440"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62795"
FT                   /db_xref="GOA:Q8ZZ46"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ46"
FT                   /protein_id="AAL62795.1"
FT   gene            243247..244068
FT                   /locus_tag="PAE0441"
FT   CDS_pept        243247..244068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0441"
FT                   /product="glycosyltransferase (type 2)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62796"
FT                   /db_xref="GOA:Q8ZZ45"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ45"
FT                   /protein_id="AAL62796.1"
FT   gene            244436..245560
FT                   /locus_tag="PAE0442"
FT   CDS_pept        244436..245560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0442"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62797"
FT                   /db_xref="GOA:Q8ZZ44"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ44"
FT                   /protein_id="AAL62797.1"
FT   gene            245595..246314
FT                   /locus_tag="PAE0443"
FT   CDS_pept        245595..246314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0443"
FT                   /product="conserved protein"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62798"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ43"
FT                   /protein_id="AAL62798.1"
FT                   VPALTSNEIKIVYAKRG"
FT   gene            246298..249042
FT                   /locus_tag="PAE0445"
FT   CDS_pept        246298..249042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0445"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62799"
FT                   /db_xref="GOA:Q8ZZ42"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ42"
FT                   /protein_id="AAL62799.1"
FT   gene            249094..249921
FT                   /locus_tag="PAE0446"
FT   CDS_pept        249094..249921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0446"
FT                   /product="glycosyltransferase (type 2)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62800"
FT                   /db_xref="GOA:Q8ZZ41"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ41"
FT                   /protein_id="AAL62800.1"
FT   gene            complement(251058..252212)
FT                   /locus_tag="PAE0455"
FT   CDS_pept        complement(251058..252212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0455"
FT                   /product="conserved within P. aerophilum, degenerate"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62801"
FT                   /db_xref="GOA:Q8ZZ40"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ40"
FT                   /protein_id="AAL62801.1"
FT   gene            252334..252462
FT                   /locus_tag="PAE0457"
FT   CDS_pept        252334..252462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0457"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62802"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ39"
FT                   /protein_id="AAL62802.1"
FT   gene            252540..252743
FT                   /locus_tag="PAE0458"
FT   CDS_pept        252540..252743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0458"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62803"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ38"
FT                   /protein_id="AAL62803.1"
FT   gene            252772..254286
FT                   /locus_tag="PAE0459"
FT   CDS_pept        252772..254286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0459"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62804"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ37"
FT                   /protein_id="AAL62804.1"
FT   gene            255103..255459
FT                   /locus_tag="PAE0462"
FT   CDS_pept        255103..255459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0462"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62805"
FT                   /db_xref="GOA:Q8ZZ36"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ36"
FT                   /protein_id="AAL62805.1"
FT                   LLVLISDYYIKQKF"
FT   gene            255493..256293
FT                   /locus_tag="PAE0463"
FT   CDS_pept        255493..256293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0463"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62806"
FT                   /db_xref="GOA:Q8ZZ35"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ35"
FT                   /protein_id="AAL62806.1"
FT   gene            256569..257102
FT                   /locus_tag="PAE0465"
FT   CDS_pept        256569..257102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0465"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62807"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ34"
FT                   /protein_id="AAL62807.1"
FT                   TRVEVCPAPVGGVV"
FT   gene            257226..258146
FT                   /locus_tag="PAE0466"
FT   CDS_pept        257226..258146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0466"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62808"
FT                   /db_xref="GOA:Q8ZZ33"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ33"
FT                   /protein_id="AAL62808.1"
FT   gene            complement(258622..258960)
FT                   /locus_tag="PAE0467"
FT   CDS_pept        complement(258622..258960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0467"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62809"
FT                   /db_xref="GOA:Q8ZZ32"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ32"
FT                   /protein_id="AAL62809.1"
FT                   LADITLKA"
FT   gene            complement(259081..259293)
FT                   /locus_tag="PAE0468"
FT   CDS_pept        complement(259081..259293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0468"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ31"
FT                   /protein_id="AAL62810.1"
FT   gene            complement(259434..259526)
FT                   /locus_tag="PAE0469"
FT   CDS_pept        complement(259434..259526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0469"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62811"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ30"
FT                   /protein_id="AAL62811.1"
FT                   /translation="MFITGMPLLNNDWDLPAQLSLKSSTYHLST"
FT   gene            259516..259680
FT                   /locus_tag="PAE0470"
FT   CDS_pept        259516..259680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0470"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ29"
FT                   /protein_id="AAL62812.1"
FT                   NSSKFRRPR"
FT   gene            259809..259961
FT                   /locus_tag="PAE0471"
FT   CDS_pept        259809..259961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0471"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62813"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ28"
FT                   /protein_id="AAL62813.1"
FT                   GGAPL"
FT   gene            260079..260423
FT                   /locus_tag="PAE0473"
FT   CDS_pept        260079..260423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0473"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62814"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ27"
FT                   /protein_id="AAL62814.1"
FT                   RTGTVYTGCF"
FT   gene            complement(260877..260975)
FT                   /locus_tag="PAE0475"
FT   CDS_pept        complement(260877..260975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0475"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62815"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ26"
FT                   /protein_id="AAL62815.1"
FT                   /translation="MPIREPSPYRAVSPPGATQPSAIKTAESLIEL"
FT   gene            complement(261049..261144)
FT                   /locus_tag="PAE0476"
FT   CDS_pept        complement(261049..261144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0476"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ25"
FT                   /protein_id="AAL62816.1"
FT                   /translation="MPIPDVNKNKAWGACEYVDPVFRLGCMPLAE"
FT   gene            261302..261634
FT                   /locus_tag="PAE0477"
FT   CDS_pept        261302..261634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0477"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62817"
FT                   /db_xref="GOA:Q8ZZ24"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ24"
FT                   /protein_id="AAL62817.1"
FT                   ALEVYD"
FT   gene            261627..264002
FT                   /locus_tag="PAE0478"
FT   CDS_pept        261627..264002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0478"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62818"
FT                   /db_xref="InterPro:IPR008752"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ23"
FT                   /protein_id="AAL62818.1"
FT   gene            complement(264309..264434)
FT                   /locus_tag="PAE0479"
FT   CDS_pept        complement(264309..264434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0479"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62819"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ22"
FT                   /protein_id="AAL62819.1"
FT   gene            complement(264825..265244)
FT                   /locus_tag="PAE0481"
FT   CDS_pept        complement(264825..265244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0481"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62820"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ21"
FT                   /protein_id="AAL62820.1"
FT   gene            complement(265267..265407)
FT                   /locus_tag="PAE0482"
FT   CDS_pept        complement(265267..265407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0482"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62821"
FT                   /db_xref="GOA:Q8ZZ20"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ20"
FT                   /protein_id="AAL62821.1"
FT                   V"
FT   gene            266150..266257
FT                   /locus_tag="PAE0485"
FT   CDS_pept        266150..266257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0485"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ19"
FT                   /protein_id="AAL62822.1"
FT   gene            266293..266529
FT                   /locus_tag="PAE0486"
FT   CDS_pept        266293..266529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0486"
FT                   /product="paREP8"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ18"
FT                   /protein_id="AAL62823.1"
FT   gene            267069..267302
FT                   /locus_tag="PAE0487"
FT   CDS_pept        267069..267302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0487"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62824"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ17"
FT                   /protein_id="AAL62824.1"
FT   gene            complement(267650..268186)
FT                   /locus_tag="PAE0489"
FT   CDS_pept        complement(267650..268186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0489"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62825"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ16"
FT                   /protein_id="AAL62825.1"
FT                   AELEEALRALREELR"
FT   gene            268243..268494
FT                   /locus_tag="PAE0490"
FT   CDS_pept        268243..268494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0490"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62826"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ15"
FT                   /protein_id="AAL62826.1"
FT   gene            268704..269144
FT                   /locus_tag="PAE0492"
FT   CDS_pept        268704..269144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0492"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62827"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ14"
FT                   /protein_id="AAL62827.1"
FT   gene            270282..270452
FT                   /locus_tag="PAE0496"
FT   CDS_pept        270282..270452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0496"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ13"
FT                   /protein_id="AAL62828.1"
FT                   LRRFIGRWGFT"
FT   gene            270814..271062
FT                   /locus_tag="PAE0497"
FT   CDS_pept        270814..271062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62829"
FT                   /db_xref="GOA:Q8ZZ12"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ12"
FT                   /protein_id="AAL62829.1"
FT   gene            271218..271451
FT                   /locus_tag="PAE0498"
FT   CDS_pept        271218..271451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0498"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62830"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ11"
FT                   /protein_id="AAL62830.1"
FT   gene            271587..271790
FT                   /locus_tag="PAE0499"
FT   CDS_pept        271587..271790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0499"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62831"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ10"
FT                   /protein_id="AAL62831.1"
FT   gene            273325..273663
FT                   /locus_tag="PAE0505"
FT   CDS_pept        273325..273663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0505"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62832"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ09"
FT                   /protein_id="AAL62832.1"
FT                   VRKSALRG"
FT   gene            273975..274706
FT                   /locus_tag="PAE0506"
FT   CDS_pept        273975..274706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0506"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62833"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ08"
FT                   /protein_id="AAL62833.1"
FT   gene            275620..275802
FT                   /locus_tag="PAE0507"
FT   CDS_pept        275620..275802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0507"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ07"
FT                   /protein_id="AAL62834.1"
FT                   VLDELSRNVYINTKL"
FT   gene            276135..276323
FT                   /locus_tag="PAE0510"
FT   CDS_pept        276135..276323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0510"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ06"
FT                   /protein_id="AAL62835.1"
FT                   TGPLKATPVHASLIGAF"
FT   gene            complement(276685..277419)
FT                   /locus_tag="PAE0512"
FT   CDS_pept        complement(276685..277419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0512"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62836"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ05"
FT                   /protein_id="AAL62836.1"
FT   gene            complement(277542..278759)
FT                   /locus_tag="PAE0513"
FT   CDS_pept        complement(277542..278759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0513"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ04"
FT                   /protein_id="AAL62837.1"
FT                   LELSLA"
FT   gene            complement(278747..279382)
FT                   /locus_tag="PAE0514"
FT   CDS_pept        complement(278747..279382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0514"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ03"
FT                   /protein_id="AAL62838.1"
FT   gene            complement(279434..280438)
FT                   /locus_tag="PAE0515"
FT   CDS_pept        complement(279434..280438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0515"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62839"
FT                   /db_xref="GOA:Q8ZZ02"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ02"
FT                   /protein_id="AAL62839.1"
FT   gene            complement(281068..281526)
FT                   /locus_tag="PAE0518"
FT   CDS_pept        complement(281068..281526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62840"
FT                   /db_xref="GOA:Q8ZZ01"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ01"
FT                   /protein_id="AAL62840.1"
FT   gene            281977..282447
FT                   /locus_tag="PAE0522"
FT   CDS_pept        281977..282447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0522"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62841"
FT                   /db_xref="GOA:Q8ZZ00"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZZ00"
FT                   /protein_id="AAL62841.1"
FT   gene            complement(282999..283562)
FT                   /locus_tag="PAE0527"
FT   CDS_pept        complement(282999..283562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0527"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62842"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ9"
FT                   /protein_id="AAL62842.1"
FT   gene            284293..284643
FT                   /locus_tag="PAE0531"
FT   CDS_pept        284293..284643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0531"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62843"
FT                   /db_xref="GOA:Q8ZYZ8"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ8"
FT                   /protein_id="AAL62843.1"
FT                   KLEKTEYYMLYV"
FT   gene            complement(284660..284875)
FT                   /locus_tag="PAE0532"
FT   CDS_pept        complement(284660..284875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0532"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ7"
FT                   /protein_id="AAL62844.1"
FT   gene            complement(284869..285303)
FT                   /locus_tag="PAE0534"
FT   CDS_pept        complement(284869..285303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0534"
FT                   /product="P. aerophilum family 1964 protein, degenerate"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62845"
FT                   /db_xref="GOA:Q8ZYZ6"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ6"
FT                   /protein_id="AAL62845.1"
FT   gene            285455..286018
FT                   /locus_tag="PAE0536"
FT   CDS_pept        285455..286018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0536"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ5"
FT                   /protein_id="AAL62846.1"
FT   gene            286156..286281
FT                   /locus_tag="PAE0538"
FT   CDS_pept        286156..286281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0538"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62847"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ4"
FT                   /protein_id="AAL62847.1"
FT   gene            complement(286523..287941)
FT                   /locus_tag="PAE0539"
FT   CDS_pept        complement(286523..287941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0539"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62848"
FT                   /db_xref="GOA:Q8ZYZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ3"
FT                   /protein_id="AAL62848.1"
FT                   LLKEIINILKRRSN"
FT   gene            287989..289197
FT                   /locus_tag="PAE0540"
FT   CDS_pept        287989..289197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0540"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62849"
FT                   /db_xref="GOA:Q8ZYZ2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ2"
FT                   /protein_id="AAL62849.1"
FT                   TDI"
FT   gene            289194..290345
FT                   /locus_tag="PAE0541"
FT   CDS_pept        289194..290345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0541"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62850"
FT                   /db_xref="GOA:Q8ZYZ1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ1"
FT                   /protein_id="AAL62850.1"
FT   gene            290342..291508
FT                   /locus_tag="PAE0542"
FT   CDS_pept        290342..291508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0542"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62851"
FT                   /db_xref="GOA:Q8ZYZ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYZ0"
FT                   /protein_id="AAL62851.1"
FT   gene            complement(291498..292664)
FT                   /locus_tag="PAE0543"
FT   CDS_pept        complement(291498..292664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0543"
FT                   /product="glycosyltransferase (type 1)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62852"
FT                   /db_xref="GOA:Q8ZYY9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY9"
FT                   /protein_id="AAL62852.1"
FT   gene            complement(292661..293611)
FT                   /locus_tag="PAE0544"
FT   CDS_pept        complement(292661..293611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0544"
FT                   /product="glycosyltransferase (type 2)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62853"
FT                   /db_xref="GOA:Q8ZYY8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY8"
FT                   /protein_id="AAL62853.1"
FT   gene            complement(293608..294663)
FT                   /locus_tag="PAE0545"
FT   CDS_pept        complement(293608..294663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0545"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62854"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY7"
FT                   /protein_id="AAL62854.1"
FT                   NKEKFVEDIRK"
FT   gene            complement(294660..295943)
FT                   /locus_tag="PAE0546"
FT   CDS_pept        complement(294660..295943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62855"
FT                   /db_xref="GOA:Q8ZYY6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY6"
FT                   /protein_id="AAL62855.1"
FT   gene            complement(296071..296583)
FT                   /locus_tag="PAE0548"
FT   CDS_pept        complement(296071..296583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0548"
FT                   /product="paREP7"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62856"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY5"
FT                   /protein_id="AAL62856.1"
FT                   GVEVYRY"
FT   gene            297210..297422
FT                   /locus_tag="PAE0550"
FT   CDS_pept        297210..297422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0550"
FT                   /product="paREP7"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY4"
FT                   /protein_id="AAL62857.1"
FT   gene            297425..297511
FT                   /locus_tag="PAE0551"
FT   CDS_pept        297425..297511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0551"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62858"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY3"
FT                   /protein_id="AAL62858.1"
FT                   /translation="MTVAEIKASVAELKVAVGSLGRRWGRDT"
FT   gene            297519..297857
FT                   /locus_tag="PAE0552"
FT   CDS_pept        297519..297857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62859"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY2"
FT                   /protein_id="AAL62859.1"
FT                   AIYGAVIE"
FT   gene            298492..298839
FT                   /locus_tag="PAE0555"
FT   CDS_pept        298492..298839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0555"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62860"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY1"
FT                   /protein_id="AAL62860.1"
FT                   PLRAEGTVIIR"
FT   gene            298884..300179
FT                   /locus_tag="PAE0556"
FT   CDS_pept        298884..300179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0556"
FT                   /product="amino acid permease"
FT                   /note="Transport and binding proteins; Amino acids,
FT                   peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62861"
FT                   /db_xref="GOA:Q8ZYY0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYY0"
FT                   /protein_id="AAL62861.1"
FT   gene            300890..301762
FT                   /locus_tag="PAE0558"
FT   CDS_pept        300890..301762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0558"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62862"
FT                   /db_xref="GOA:Q8ZYX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX9"
FT                   /protein_id="AAL62862.1"
FT                   RDYYTEAEI"
FT   gene            complement(301759..301935)
FT                   /locus_tag="PAE0559"
FT   CDS_pept        complement(301759..301935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0559"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62863"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX8"
FT                   /protein_id="AAL62863.1"
FT                   ENEWVRILRSRGR"
FT   gene            complement(302385..302807)
FT                   /locus_tag="PAE0562"
FT   CDS_pept        complement(302385..302807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0562"
FT                   /product="paREP8"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62864"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX7"
FT                   /protein_id="AAL62864.1"
FT   gene            complement(302854..303366)
FT                   /locus_tag="PAE0563"
FT   CDS_pept        complement(302854..303366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0563"
FT                   /product="ADP ribose hydrolase, putative (mutT/nudix family
FT                   protein)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62865"
FT                   /db_xref="GOA:Q7LX32"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LX32"
FT                   /protein_id="AAL62865.1"
FT                   AKEKGLL"
FT   gene            complement(303422..303476)
FT                   /locus_tag="PAEsR22"
FT   ncRNA           complement(303422..303476)
FT                   /locus_tag="PAEsR22"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at C791"
FT                   /ncRNA_class="other"
FT   gene            complement(303602..303676)
FT                   /locus_tag="PAEtR41"
FT   tRNA            complement(303602..303676)
FT                   /locus_tag="PAEtR41"
FT                   /product="tRNA-Ala"
FT   gene            303850..304809
FT                   /locus_tag="PAE0564"
FT   CDS_pept        303850..304809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62866"
FT                   /db_xref="GOA:Q8ZYX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX6"
FT                   /protein_id="AAL62866.1"
FT   gene            304862..305839
FT                   /locus_tag="PAE0566"
FT   CDS_pept        304862..305839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0566"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62867"
FT                   /db_xref="GOA:Q8ZYX5"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX5"
FT                   /protein_id="AAL62867.1"
FT   gene            305869..306156
FT                   /locus_tag="PAE0567"
FT   CDS_pept        305869..306156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62868"
FT                   /db_xref="GOA:Q8ZYX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX4"
FT                   /protein_id="AAL62868.1"
FT   gene            complement(306065..307024)
FT                   /locus_tag="PAE0568"
FT   CDS_pept        complement(306065..307024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0568"
FT                   /product="cation efflux system protein, conjectural"
FT                   /note="Transport and binding proteins; Cations"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62869"
FT                   /db_xref="GOA:Q8ZYX3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX3"
FT                   /protein_id="AAL62869.1"
FT   gene            complement(307026..307775)
FT                   /locus_tag="PAE0570"
FT   CDS_pept        complement(307026..307775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0570"
FT                   /product="indole-3-glycerol-phosphate synthase"
FT                   /note="Amino acid biosynthesis; Aromatic amino acid family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62870"
FT                   /db_xref="GOA:Q8ZYX2"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYX2"
FT                   /protein_id="AAL62870.1"
FT   gene            307829..308491
FT                   /locus_tag="PAE0573"
FT   CDS_pept        307829..308491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62871"
FT                   /db_xref="GOA:Q8ZYX1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYX1"
FT                   /protein_id="AAL62871.1"
FT   gene            complement(308481..309281)
FT                   /locus_tag="PAE0576"
FT   CDS_pept        complement(308481..309281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0576"
FT                   /product="bacitracin resistence protein"
FT                   /note="Cellular processes; Toxin production and resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62872"
FT                   /db_xref="GOA:Q8ZYX0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYX0"
FT                   /protein_id="AAL62872.1"
FT   gene            309321..309794
FT                   /locus_tag="PAE0577"
FT   CDS_pept        309321..309794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0577"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW9"
FT                   /protein_id="AAL62873.1"
FT   gene            complement(309881..309934)
FT                   /locus_tag="PAEsR21"
FT   ncRNA           complement(309881..309934)
FT                   /locus_tag="PAEsR21"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at U1979"
FT                   /ncRNA_class="other"
FT   gene            310028..311182
FT                   /locus_tag="PAE0579"
FT   CDS_pept        310028..311182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0579"
FT                   /product="metallo cofactor biosynthesis protein"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62874"
FT                   /db_xref="GOA:Q8ZYW8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW8"
FT                   /protein_id="AAL62874.1"
FT   gene            311160..312053
FT                   /locus_tag="PAE0580"
FT   CDS_pept        311160..312053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0580"
FT                   /product="porphobilinogen deaminase (hemC)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62875"
FT                   /db_xref="GOA:Q8ZYW7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYW7"
FT                   /protein_id="AAL62875.1"
FT                   GRRAAEEIKRVAASVR"
FT   gene            complement(312057..313028)
FT                   /locus_tag="PAE0581"
FT   CDS_pept        complement(312057..313028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0581"
FT                   /product="heme biosynthesis protein"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62876"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW6"
FT                   /protein_id="AAL62876.1"
FT   gene            complement(313492..314502)
FT                   /locus_tag="PAE0583"
FT   CDS_pept        complement(313492..314502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0583"
FT                   /product="porphobilinogen synthase (delta-aminolevulinic
FT                   acid dehydratase) (hemB)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62877"
FT                   /db_xref="GOA:Q8ZYW5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW5"
FT                   /protein_id="AAL62877.1"
FT   gene            complement(314499..315155)
FT                   /locus_tag="PAE0585"
FT   CDS_pept        complement(314499..315155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0585"
FT                   /product="siroheme synthesis protein, conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62878"
FT                   /db_xref="GOA:Q8ZYW4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW4"
FT                   /protein_id="AAL62878.1"
FT   gene            complement(315183..315362)
FT                   /locus_tag="PAE0586"
FT   CDS_pept        complement(315183..315362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0586"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62879"
FT                   /db_xref="GOA:Q8ZSL3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZSL3"
FT                   /protein_id="AAL62879.1"
FT                   NGLVDAVKQLIGLS"
FT   gene            complement(315403..316041)
FT                   /locus_tag="PAE0589"
FT   CDS_pept        complement(315403..316041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0589"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62880"
FT                   /db_xref="GOA:Q8ZYW3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW3"
FT                   /protein_id="AAL62880.1"
FT   gene            complement(316023..316748)
FT                   /locus_tag="PAE0590"
FT   CDS_pept        complement(316023..316748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0590"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62881"
FT                   /db_xref="GOA:Q8ZYW2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW2"
FT                   /protein_id="AAL62881.1"
FT   gene            316934..318205
FT                   /locus_tag="PAE0594"
FT   CDS_pept        316934..318205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0594"
FT                   /product="glutamate-1-semialdehyde aminotransferase (hemL)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62882"
FT                   /db_xref="GOA:Q8ZYW1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYW1"
FT                   /protein_id="AAL62882.1"
FT   gene            318209..319327
FT                   /locus_tag="PAE0596"
FT   CDS_pept        318209..319327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0596"
FT                   /product="metallo cofactor biosynthesis protein"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62883"
FT                   /db_xref="GOA:Q8ZYW0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYW0"
FT                   /protein_id="AAL62883.1"
FT   gene            319683..319928
FT                   /locus_tag="PAE0597"
FT   CDS_pept        319683..319928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0597"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62884"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV9"
FT                   /protein_id="AAL62884.1"
FT   gene            319958..320539
FT                   /locus_tag="PAE0598"
FT   CDS_pept        319958..320539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0598"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62885"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV8"
FT                   /protein_id="AAL62885.1"
FT   gene            320578..320651
FT                   /locus_tag="PAEtR01"
FT   tRNA            320578..320651
FT                   /locus_tag="PAEtR01"
FT                   /product="tRNA-Pro"
FT   gene            320793..321581
FT                   /locus_tag="PAE0600"
FT   CDS_pept        320793..321581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62886"
FT                   /db_xref="GOA:Q8ZYV7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV7"
FT                   /protein_id="AAL62886.1"
FT   gene            complement(321558..322751)
FT                   /locus_tag="PAE0601"
FT   CDS_pept        complement(321558..322751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0601"
FT                   /product="glutamyl tRNA reductase (hemA)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Heme, porphyrin and cobalamin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62887"
FT                   /db_xref="GOA:Q8ZYV6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYV6"
FT                   /protein_id="AAL62887.1"
FT   gene            complement(322879..322956)
FT                   /locus_tag="PAE0602a"
FT   CDS_pept        complement(322879..322956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0602a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0602a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62888"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV5"
FT                   /protein_id="AAL62888.1"
FT                   /translation="MGREASFLVMEREAISKWGSMRLRF"
FT   gene            323299..324339
FT                   /locus_tag="PAE0604"
FT   CDS_pept        323299..324339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62889"
FT                   /db_xref="GOA:Q8ZYV4"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV4"
FT                   /protein_id="AAL62889.1"
FT                   LSEITT"
FT   gene            complement(324319..324549)
FT                   /locus_tag="PAE0605"
FT   CDS_pept        complement(324319..324549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0605"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV3"
FT                   /protein_id="AAL62890.1"
FT   gene            complement(324596..325423)
FT                   /locus_tag="PAE0606"
FT   CDS_pept        complement(324596..325423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0606"
FT                   /product="oxidoreductase, conjectural"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62891"
FT                   /db_xref="GOA:Q8ZYV2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV2"
FT                   /protein_id="AAL62891.1"
FT   gene            complement(325463..326488)
FT                   /locus_tag="PAE0608"
FT   CDS_pept        complement(325463..326488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62892"
FT                   /db_xref="GOA:Q8ZYV1"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYV1"
FT                   /protein_id="AAL62892.1"
FT                   T"
FT   gene            326856..327368
FT                   /locus_tag="PAE0611"
FT   CDS_pept        326856..327368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0611"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62893"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYV0"
FT                   /protein_id="AAL62893.1"
FT                   WHIYGII"
FT   gene            complement(327449..327685)
FT                   /locus_tag="PAE0612"
FT   CDS_pept        complement(327449..327685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0612"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62894"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU9"
FT                   /protein_id="AAL62894.1"
FT   gene            complement(327661..328326)
FT                   /locus_tag="PAE0613"
FT   CDS_pept        complement(327661..328326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0613"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62895"
FT                   /db_xref="GOA:Q8ZYU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU8"
FT                   /protein_id="AAL62895.1"
FT   gene            328374..329423
FT                   /locus_tag="PAE0614"
FT   CDS_pept        328374..329423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62896"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU7"
FT                   /protein_id="AAL62896.1"
FT                   REARGQAAR"
FT   gene            complement(329401..331089)
FT                   /locus_tag="PAE0615"
FT   CDS_pept        complement(329401..331089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0615"
FT                   /product="dihydroxy-acid dehydratase (ilvD)"
FT                   /note="Amino acid biosynthesis; Pyruvate family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62897"
FT                   /db_xref="GOA:Q8ZYU6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYU6"
FT                   /protein_id="AAL62897.1"
FT   gene            complement(331120..332160)
FT                   /locus_tag="PAE0616"
FT   CDS_pept        complement(331120..332160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0616"
FT                   /product="metallo cofactor biosynthesis protein"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62898"
FT                   /db_xref="GOA:Q8ZYU5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU5"
FT                   /protein_id="AAL62898.1"
FT                   ARPLRV"
FT   gene            complement(332161..332664)
FT                   /locus_tag="PAE0617"
FT   CDS_pept        complement(332161..332664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0617"
FT                   /product="oxidoreductase, truncation"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62899"
FT                   /db_xref="GOA:Q8ZYU4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU4"
FT                   /protein_id="AAL62899.1"
FT                   YGKS"
FT   gene            complement(332799..333137)
FT                   /locus_tag="PAE0620"
FT   CDS_pept        complement(332799..333137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0620"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62900"
FT                   /db_xref="GOA:Q8ZYU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU3"
FT                   /protein_id="AAL62900.1"
FT                   PQRTEFDF"
FT   gene            333345..335192
FT                   /locus_tag="PAE0622"
FT   CDS_pept        333345..335192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0622"
FT                   /product="aldehyde ferredoxin oxidoreductase (aor)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62901"
FT                   /db_xref="GOA:Q8ZYU2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU2"
FT                   /protein_id="AAL62901.1"
FT   gene            335264..335989
FT                   /locus_tag="PAE0624"
FT   CDS_pept        335264..335989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62902"
FT                   /db_xref="GOA:Q8ZYU1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU1"
FT                   /protein_id="AAL62902.1"
FT   gene            335986..336321
FT                   /locus_tag="PAE0626"
FT   CDS_pept        335986..336321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0626"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62903"
FT                   /db_xref="GOA:Q8ZYU0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYU0"
FT                   /protein_id="AAL62903.1"
FT                   LGIFYKR"
FT   gene            complement(336309..336998)
FT                   /locus_tag="PAE0627"
FT   CDS_pept        complement(336309..336998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0627"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62904"
FT                   /db_xref="GOA:Q8ZYT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT9"
FT                   /protein_id="AAL62904.1"
FT                   SYLYHLL"
FT   gene            complement(337019..337519)
FT                   /locus_tag="PAE0628"
FT   CDS_pept        complement(337019..337519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62905"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT8"
FT                   /protein_id="AAL62905.1"
FT                   DSI"
FT   gene            337562..338680
FT                   /locus_tag="PAE0630"
FT   CDS_pept        337562..338680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0630"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="Protein synthesis; tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62906"
FT                   /db_xref="GOA:Q8ZYT7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYT7"
FT                   /protein_id="AAL62906.1"
FT   gene            complement(338839..340269)
FT                   /locus_tag="PAE0632"
FT   CDS_pept        complement(338839..340269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62907"
FT                   /db_xref="GOA:Q8ZYT6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT6"
FT                   /protein_id="AAL62907.1"
FT                   IKSVLEPLMDLAIRRISA"
FT   gene            340308..341372
FT                   /locus_tag="PAE0634"
FT   CDS_pept        340308..341372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62908"
FT                   /db_xref="GOA:Q8ZYT5"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT5"
FT                   /protein_id="AAL62908.1"
FT                   AKEVARYLASKALS"
FT   gene            complement(341448..341759)
FT                   /locus_tag="PAE0635"
FT   CDS_pept        complement(341448..341759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0635"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62909"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT4"
FT                   /protein_id="AAL62909.1"
FT   gene            341851..342687
FT                   /locus_tag="PAE0636"
FT   CDS_pept        341851..342687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62910"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT3"
FT                   /protein_id="AAL62910.1"
FT   gene            complement(342684..343706)
FT                   /locus_tag="PAE0637"
FT   CDS_pept        complement(342684..343706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0637"
FT                   /product="peptidase (possible proline dipeptidase)"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62911"
FT                   /db_xref="GOA:Q8ZYT2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT2"
FT                   /protein_id="AAL62911.1"
FT                   "
FT   gene            complement(343729..344103)
FT                   /locus_tag="PAE0638"
FT   CDS_pept        complement(343729..344103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62912"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT1"
FT                   /protein_id="AAL62912.1"
FT   gene            344148..344639
FT                   /locus_tag="PAE0639"
FT   CDS_pept        344148..344639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0639"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62913"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYT0"
FT                   /protein_id="AAL62913.1"
FT                   "
FT   gene            344633..344986
FT                   /locus_tag="PAE0640"
FT   CDS_pept        344633..344986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0640"
FT                   /product="hypothetical protein"
FT                   /note="Transport and binding proteins; Unknown substrate"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62914"
FT                   /db_xref="GOA:Q8ZYS9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS9"
FT                   /protein_id="AAL62914.1"
FT                   VILKRPISEASRA"
FT   gene            complement(344961..345380)
FT                   /locus_tag="PAE0641"
FT   CDS_pept        complement(344961..345380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0641"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS8"
FT                   /protein_id="AAL62915.1"
FT   gene            345590..346087
FT                   /locus_tag="PAE0643"
FT   CDS_pept        345590..346087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0643"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62916"
FT                   /db_xref="GOA:Q8ZYS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS7"
FT                   /protein_id="AAL62916.1"
FT                   RK"
FT   gene            complement(346066..346656)
FT                   /locus_tag="PAE0644"
FT   CDS_pept        complement(346066..346656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0644"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62917"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS6"
FT                   /protein_id="AAL62917.1"
FT   gene            346669..347547
FT                   /locus_tag="PAE0645"
FT   CDS_pept        346669..347547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0645"
FT                   /product="ribosomal protein S6 modification protein (rimK)"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62918"
FT                   /db_xref="GOA:Q8ZYS5"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS5"
FT                   /protein_id="AAL62918.1"
FT                   IAEYIERVVKR"
FT   gene            complement(347756..347971)
FT                   /locus_tag="PAE0648"
FT   CDS_pept        complement(347756..347971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0648"
FT                   /product="paREP10"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS4"
FT                   /protein_id="AAL62919.1"
FT   gene            complement(347965..348633)
FT                   /locus_tag="PAE0649"
FT   CDS_pept        complement(347965..348633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0649"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS3"
FT                   /protein_id="AAL62920.1"
FT                   "
FT   gene            348706..349296
FT                   /locus_tag="PAE0651"
FT   CDS_pept        348706..349296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0651"
FT                   /product="uracil DNA glycosylase (Pa-UDGa)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62921"
FT                   /db_xref="GOA:Q8ZYS2"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYS2"
FT                   /protein_id="AAL62921.1"
FT   gene            349320..350207
FT                   /locus_tag="PAE0652"
FT   CDS_pept        349320..350207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0652"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS1"
FT                   /protein_id="AAL62922.1"
FT                   QKHSSVIRRYIESL"
FT   gene            350204..351814
FT                   /locus_tag="PAE0653"
FT   CDS_pept        350204..351814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62923"
FT                   /db_xref="GOA:Q8ZYS0"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYS0"
FT                   /protein_id="AAL62923.1"
FT   gene            351906..352907
FT                   /locus_tag="PAE0654"
FT   CDS_pept        351906..352907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0654"
FT                   /product="DNA repair protein radA"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62924"
FT                   /db_xref="GOA:Q8ZYR9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYR9"
FT                   /protein_id="AAL62924.1"
FT   gene            complement(352853..353491)
FT                   /locus_tag="PAE0655"
FT   CDS_pept        complement(352853..353491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0655"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR8"
FT                   /protein_id="AAL62925.1"
FT   gene            353595..355193
FT                   /locus_tag="PAE0656"
FT   CDS_pept        353595..355193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62926"
FT                   /db_xref="GOA:Q8ZYR7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR7"
FT                   /protein_id="AAL62926.1"
FT                   KARAASRREILTFAS"
FT   gene            complement(355161..355622)
FT                   /locus_tag="PAE0658"
FT   CDS_pept        complement(355161..355622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0658"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62927"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR6"
FT                   /protein_id="AAL62927.1"
FT   gene            355668..355982
FT                   /locus_tag="PAE0659"
FT   CDS_pept        355668..355982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0659"
FT                   /product="hypothetical protein containing 3 C2H2 zinc
FT                   finger motifs"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62928"
FT                   /db_xref="GOA:Q8ZYR5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR5"
FT                   /protein_id="AAL62928.1"
FT                   "
FT   gene            355982..356476
FT                   /locus_tag="PAE0660"
FT   CDS_pept        355982..356476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0660"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62929"
FT                   /db_xref="GOA:Q8ZYR4"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYR4"
FT                   /protein_id="AAL62929.1"
FT                   W"
FT   gene            356507..356797
FT                   /locus_tag="PAE0661"
FT   CDS_pept        356507..356797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0661"
FT                   /product="H+-transporting ATP synthase subunit F (atpF)"
FT                   /note="Energy metabolism; ATP-proton motive force
FT                   interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62930"
FT                   /db_xref="GOA:Q8ZYR3"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR3"
FT                   /protein_id="AAL62930.1"
FT   gene            356827..357393
FT                   /locus_tag="PAE0662"
FT   CDS_pept        356827..357393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62931"
FT                   /db_xref="GOA:Q8ZYR2"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYR2"
FT                   /protein_id="AAL62931.1"
FT   gene            357390..359171
FT                   /locus_tag="PAE0663"
FT   CDS_pept        357390..359171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0663"
FT                   /product="H+-transporting ATP synthase subunit A (atpA)"
FT                   /note="Energy metabolism; ATP-proton motive force
FT                   interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62932"
FT                   /db_xref="GOA:Q8ZYR1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYR1"
FT                   /protein_id="AAL62932.1"
FT                   FIESLVAEIRATTNRRG"
FT   gene            359243..359470
FT                   /locus_tag="PAE0664"
FT   CDS_pept        359243..359470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0664"
FT                   /product="DNA-directed RNA polymerase subunit H (rpoH)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62933"
FT                   /db_xref="GOA:Q8ZYR0"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYR0"
FT                   /protein_id="AAL62933.1"
FT   gene            359505..362888
FT                   /locus_tag="PAE0665"
FT   CDS_pept        359505..362888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0665"
FT                   /product="DNA-directed RNA polymerase subunit B (rpoB)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62934"
FT                   /db_xref="GOA:Q8ZYQ9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYQ9"
FT                   /protein_id="AAL62934.1"
FT   gene            362969..365623
FT                   /locus_tag="PAE0666"
FT   CDS_pept        362969..365623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0666"
FT                   /product="DNA-directed RNA polymerase subunit A' (rpoA1)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62935"
FT                   /db_xref="GOA:Q8ZYQ8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYQ8"
FT                   /protein_id="AAL62935.1"
FT                   KVVDIKSLKMWIR"
FT   gene            365620..366759
FT                   /locus_tag="PAE0667"
FT   CDS_pept        365620..366759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0667"
FT                   /product="DNA-directed RNA polymerase subunit A'' (rpoA2)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62936"
FT                   /db_xref="GOA:Q8ZYQ7"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ7"
FT                   /protein_id="AAL62936.1"
FT   gene            366801..367109
FT                   /locus_tag="PAE0668"
FT   CDS_pept        366801..367109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0668"
FT                   /product="ribosomal protein L30"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62937"
FT                   /db_xref="GOA:Q8ZYQ6"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ6"
FT                   /protein_id="AAL62937.1"
FT   gene            367102..367536
FT                   /locus_tag="PAE0669"
FT   CDS_pept        367102..367536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0669"
FT                   /product="transcription termination factor NusA, putative"
FT                   /note="Transcription; Transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62938"
FT                   /db_xref="GOA:Q8ZYQ5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYQ5"
FT                   /protein_id="AAL62938.1"
FT   gene            367576..368019
FT                   /locus_tag="PAE0670"
FT   CDS_pept        367576..368019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0670"
FT                   /product="ribosomal protein S12"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62939"
FT                   /db_xref="GOA:Q8ZYQ4"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ4"
FT                   /protein_id="AAL62939.1"
FT   gene            368019..368801
FT                   /locus_tag="PAE0671"
FT   CDS_pept        368019..368801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0671"
FT                   /product="DNA-directed RNA polymerase subunit D (rpoD)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62940"
FT                   /db_xref="GOA:Q8ZYQ3"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR022842"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ3"
FT                   /protein_id="AAL62940.1"
FT   gene            368827..369195
FT                   /locus_tag="PAE0672"
FT   CDS_pept        368827..369195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0672"
FT                   /product="ribosomal protein L18"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62941"
FT                   /db_xref="GOA:Q8ZYQ2"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ2"
FT                   /protein_id="AAL62941.1"
FT                   IPELVRKYPRGSGVRIVI"
FT   gene            369192..369755
FT                   /locus_tag="PAE0673"
FT   CDS_pept        369192..369755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0673"
FT                   /product="ribosomal protein L13"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62942"
FT                   /db_xref="GOA:Q8ZYQ1"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ1"
FT                   /protein_id="AAL62942.1"
FT   gene            369758..370198
FT                   /locus_tag="PAE0674"
FT   CDS_pept        369758..370198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0674"
FT                   /product="ribosomal protein S9"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62943"
FT                   /db_xref="GOA:Q8ZYQ0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYQ0"
FT                   /protein_id="AAL62943.1"
FT   gene            370195..370395
FT                   /locus_tag="PAE0675a"
FT   CDS_pept        370195..370395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0675a"
FT                   /product="DNA-directed RNA polymerase subunit N (rpoN)"
FT                   /note="Transcription; DNA-dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0675a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62944"
FT                   /db_xref="GOA:Q8ZYP9"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYP9"
FT                   /protein_id="AAL62944.1"
FT   gene            370446..370703
FT                   /locus_tag="PAE0676"
FT   CDS_pept        370446..370703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0676"
FT                   /product="small nuclear ribonucleoprotein homolog
FT                   (Sm-like)"
FT                   /note="Transcription; RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62945"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP8"
FT                   /protein_id="AAL62945.1"
FT   gene            370700..371908
FT                   /locus_tag="PAE0677"
FT   CDS_pept        370700..371908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0677"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="Central intermediary metabolism; Other"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62946"
FT                   /db_xref="GOA:Q8ZYP7"
FT                   /db_xref="InterPro:IPR002795"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYP7"
FT                   /protein_id="AAL62946.1"
FT                   SLY"
FT   gene            complement(371905..373668)
FT                   /locus_tag="PAE0678"
FT   CDS_pept        complement(371905..373668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62947"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP6"
FT                   /protein_id="AAL62947.1"
FT                   VQQYRRMLGGV"
FT   gene            complement(373672..374592)
FT                   /locus_tag="PAE0680"
FT   CDS_pept        complement(373672..374592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62948"
FT                   /db_xref="GOA:Q8ZYP5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP5"
FT                   /protein_id="AAL62948.1"
FT   gene            374624..375127
FT                   /locus_tag="PAE0681"
FT   CDS_pept        374624..375127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62949"
FT                   /db_xref="InterPro:IPR005369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYP4"
FT                   /protein_id="AAL62949.1"
FT                   RLLK"
FT   gene            375280..375966
FT                   /locus_tag="PAE0683"
FT   CDS_pept        375280..375966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0683"
FT                   /product="cytidyltransferase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62950"
FT                   /db_xref="GOA:Q8ZYP3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP3"
FT                   /protein_id="AAL62950.1"
FT                   NAANKY"
FT   gene            375947..376594
FT                   /locus_tag="PAE0684"
FT   CDS_pept        375947..376594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0684"
FT                   /product="DNA endonuclease V, conjectural"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62951"
FT                   /db_xref="GOA:Q8ZYP2"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYP2"
FT                   /protein_id="AAL62951.1"
FT   gene            complement(376559..376960)
FT                   /locus_tag="PAE0685"
FT   CDS_pept        complement(376559..376960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0685"
FT                   /product="conserved protein (probable universal stress
FT                   protein homolog)"
FT                   /note="Cellular processes; Adaptations to atypical
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62952"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP1"
FT                   /protein_id="AAL62952.1"
FT   gene            complement(376969..377772)
FT                   /locus_tag="PAE0686"
FT   CDS_pept        complement(376969..377772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0686"
FT                   /product="multiple sugar transport permease protein"
FT                   /note="Transport and binding proteins; Carbohydrates,
FT                   organic alcohols, and acids"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62953"
FT                   /db_xref="GOA:Q8ZYP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYP0"
FT                   /protein_id="AAL62953.1"
FT   gene            complement(377769..378593)
FT                   /locus_tag="PAE0688"
FT   CDS_pept        complement(377769..378593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0688"
FT                   /product="multiple sugar transport permease protein"
FT                   /note="Transport and binding proteins; Carbohydrates,
FT                   organic alcohols, and acids"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62954"
FT                   /db_xref="GOA:Q8ZYN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN9"
FT                   /protein_id="AAL62954.1"
FT   gene            complement(378590..380002)
FT                   /locus_tag="PAE0689"
FT   CDS_pept        complement(378590..380002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0689"
FT                   /product="multiple sugar binding protein"
FT                   /note="Transport and binding proteins; Carbohydrates,
FT                   organic alcohols, and acids"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62955"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN8"
FT                   /protein_id="AAL62955.1"
FT                   KPFGGYQPPWVK"
FT   gene            complement(380200..380284)
FT                   /locus_tag="PAEtR40"
FT   tRNA            complement(380200..380284)
FT                   /locus_tag="PAEtR40"
FT                   /product="tRNA-Ser"
FT   gene            complement(380353..380580)
FT                   /locus_tag="PAE0692"
FT   CDS_pept        complement(380353..380580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0692"
FT                   /product="hypothetical protein with partial (eukaryotic)
FT                   protein kinase domain"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62956"
FT                   /db_xref="GOA:Q8ZYN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN7"
FT                   /protein_id="AAL62956.1"
FT   gene            381568..381765
FT                   /locus_tag="PAE0694"
FT   CDS_pept        381568..381765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0694"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62957"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN6"
FT                   /protein_id="AAL62957.1"
FT   gene            381814..382092
FT                   /locus_tag="PAE0695"
FT   CDS_pept        381814..382092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0695"
FT                   /product="translation elongation factor aEF-1 beta subunit"
FT                   /note="Protein synthesis; Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62958"
FT                   /db_xref="GOA:Q8ZYN5"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYN5"
FT                   /protein_id="AAL62958.1"
FT   gene            382129..384324
FT                   /locus_tag="PAE0696"
FT   CDS_pept        382129..384324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0696"
FT                   /product="AAA family ATPase, possible cell division control
FT                   protein cdc48"
FT                   /note="Cellular processes; Cell division"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62959"
FT                   /db_xref="GOA:Q8ZYN4"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN4"
FT                   /protein_id="AAL62959.1"
FT   gene            384321..384542
FT                   /locus_tag="PAE0697"
FT   CDS_pept        384321..384542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0697"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62960"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN3"
FT                   /protein_id="AAL62960.1"
FT   gene            384568..385608
FT                   /locus_tag="PAE0698"
FT   CDS_pept        384568..385608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0698"
FT                   /product="DNA endonuclease rad2 homolog"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62961"
FT                   /db_xref="GOA:Q8ZYN2"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYN2"
FT                   /protein_id="AAL62961.1"
FT                   SLDSFF"
FT   gene            385708..385875
FT                   /locus_tag="PAE0700"
FT   CDS_pept        385708..385875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0700"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYN1"
FT                   /protein_id="AAL62962.1"
FT                   RTHYRWLKDL"
FT   gene            385857..386474
FT                   /locus_tag="PAE0701"
FT   CDS_pept        385857..386474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0701"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase (PCMT)"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62963"
FT                   /db_xref="GOA:Q8ZYN0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:4O29"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYN0"
FT                   /protein_id="AAL62963.1"
FT   gene            386523..386777
FT                   /locus_tag="PAE0702"
FT   CDS_pept        386523..386777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0702"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62964"
FT                   /db_xref="GOA:Q8ZYM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM9"
FT                   /protein_id="AAL62964.1"
FT   gene            complement(386774..388060)
FT                   /locus_tag="PAE0703"
FT   CDS_pept        complement(386774..388060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0703"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="Protein synthesis; tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62965"
FT                   /db_xref="GOA:Q8ZYM8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:4GLA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYM8"
FT                   /protein_id="AAL62965.1"
FT   gene            complement(388089..388610)
FT                   /locus_tag="PAE0705"
FT   CDS_pept        complement(388089..388610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0705"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM7"
FT                   /protein_id="AAL62966.1"
FT                   ELVKERELRA"
FT   gene            388666..390363
FT                   /locus_tag="PAE0707"
FT   CDS_pept        388666..390363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0707"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62967"
FT                   /db_xref="GOA:Q8ZYM6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM6"
FT                   /protein_id="AAL62967.1"
FT   gene            complement(390344..390538)
FT                   /locus_tag="PAE0708"
FT   CDS_pept        complement(390344..390538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0708"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62968"
FT                   /db_xref="GOA:Q8ZYM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM5"
FT                   /protein_id="AAL62968.1"
FT   gene            complement(390568..390930)
FT                   /locus_tag="PAE0710"
FT   CDS_pept        complement(390568..390930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0710"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62969"
FT                   /db_xref="GOA:Q8ZYM4"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYM4"
FT                   /protein_id="AAL62969.1"
FT                   PDELVDKVTGSLKLYK"
FT   gene            390998..394774
FT                   /locus_tag="PAE0712"
FT   CDS_pept        390998..394774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0712"
FT                   /product="surface layer-associated STABLE protease,
FT                   conjectural"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62970"
FT                   /db_xref="GOA:Q8ZYM3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034041"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM3"
FT                   /protein_id="AAL62970.1"
FT   gene            complement(394771..395208)
FT                   /locus_tag="PAE0714"
FT   CDS_pept        complement(394771..395208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0714"
FT                   /product="diadenosine 5'5'''-P1,P4-tetraphosphate
FT                   pyrophosphohydrolase (mutT/nudix family protein)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62971"
FT                   /db_xref="GOA:Q8ZYM2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003565"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM2"
FT                   /protein_id="AAL62971.1"
FT   gene            complement(395247..395849)
FT                   /locus_tag="PAE0715"
FT   CDS_pept        complement(395247..395849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0715"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62972"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM1"
FT                   /protein_id="AAL62972.1"
FT   gene            395970..397715
FT                   /locus_tag="PAE0716"
FT   CDS_pept        395970..397715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0716"
FT                   /product="succinate dehydrogenase flavoprotein subunit
FT                   (sdhA)"
FT                   /note="Energy metabolism; TCA cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62973"
FT                   /db_xref="GOA:Q8ZYM0"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYM0"
FT                   /protein_id="AAL62973.1"
FT                   EERKY"
FT   gene            397717..398430
FT                   /locus_tag="PAE0717"
FT   CDS_pept        397717..398430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0717"
FT                   /product="succinate dehydrogenase iron-sulfur subunit
FT                   (sdhB)"
FT                   /note="Energy metabolism; TCA cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62974"
FT                   /db_xref="GOA:Q8ZYL9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL9"
FT                   /protein_id="AAL62974.1"
FT                   IQLLKATILRRKRRP"
FT   gene            398427..398849
FT                   /locus_tag="PAE0718"
FT   CDS_pept        398427..398849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0718"
FT                   /product="succinate dehydrogenase cytochrome b subunit
FT                   (sdhC)"
FT                   /note="Energy metabolism; TCA cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62975"
FT                   /db_xref="GOA:Q8ZYL8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL8"
FT                   /protein_id="AAL62975.1"
FT   gene            398840..399196
FT                   /locus_tag="PAE0719"
FT   CDS_pept        398840..399196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0719"
FT                   /product="succinate dehydrogenase subunit D (sdhD)"
FT                   /note="Energy metabolism; TCA cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62976"
FT                   /db_xref="GOA:Q8ZYL7"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL7"
FT                   /protein_id="AAL62976.1"
FT                   ITGIVMFYVLVFVP"
FT   gene            complement(399195..399249)
FT                   /locus_tag="PAEsR28"
FT   ncRNA           complement(399195..399249)
FT                   /locus_tag="PAEsR28"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   16S at A1209"
FT                   /ncRNA_class="other"
FT   gene            complement(399274..400044)
FT                   /locus_tag="PAE0720"
FT   CDS_pept        complement(399274..400044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0720"
FT                   /product="proliferating-cell nuclear antigen homolog
FT                   (PCNA)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62977"
FT                   /db_xref="GOA:Q8ZYL6"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYL6"
FT                   /protein_id="AAL62977.1"
FT   gene            complement(400138..401178)
FT                   /locus_tag="PAE0721"
FT   CDS_pept        complement(400138..401178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0721"
FT                   /product="electron transfer flavoprotein alpha subunit
FT                   (etfA)"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62978"
FT                   /db_xref="GOA:Q8ZYL5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL5"
FT                   /protein_id="AAL62978.1"
FT                   KIRNQR"
FT   gene            complement(401182..401976)
FT                   /locus_tag="PAE0722"
FT   CDS_pept        complement(401182..401976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0722"
FT                   /product="electron transfer flavoprotein beta subunit
FT                   (etfB)"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62979"
FT                   /db_xref="GOA:Q8ZYL4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL4"
FT                   /protein_id="AAL62979.1"
FT   gene            complement(401981..402271)
FT                   /locus_tag="PAE0723"
FT   CDS_pept        complement(401981..402271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0723"
FT                   /product="ferredoxin like protein"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62980"
FT                   /db_xref="GOA:Q8ZYL3"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL3"
FT                   /protein_id="AAL62980.1"
FT   gene            complement(402268..403542)
FT                   /locus_tag="PAE0725"
FT   CDS_pept        complement(402268..403542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0725"
FT                   /product="electron transfer flavoprotein-quinone
FT                   oxidoreductase"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62981"
FT                   /db_xref="GOA:Q8ZYL2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL2"
FT                   /protein_id="AAL62981.1"
FT   gene            403769..404458
FT                   /locus_tag="PAE0727"
FT   CDS_pept        403769..404458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0727"
FT                   /product="molybdenum cofactor biosynthesis protein D/E"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62982"
FT                   /db_xref="GOA:Q8ZYL1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL1"
FT                   /protein_id="AAL62982.1"
FT                   IPRNPQP"
FT   gene            complement(404439..404825)
FT                   /locus_tag="PAE0728"
FT   CDS_pept        complement(404439..404825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0728"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62983"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYL0"
FT                   /protein_id="AAL62983.1"
FT   gene            404887..405663
FT                   /locus_tag="PAE0729"
FT   CDS_pept        404887..405663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0729"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62984"
FT                   /db_xref="GOA:Q8ZYK9"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK9"
FT                   /protein_id="AAL62984.1"
FT   gene            405821..406195
FT                   /locus_tag="PAE0730"
FT   CDS_pept        405821..406195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0730"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK8"
FT                   /protein_id="AAL62985.1"
FT   gene            406222..406458
FT                   /locus_tag="PAE0731"
FT   CDS_pept        406222..406458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0731"
FT                   /product="transcriptional regulatory protein, conjectural"
FT                   /note="Regulatory functions; General"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62986"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK7"
FT                   /protein_id="AAL62986.1"
FT   gene            406526..406729
FT                   /locus_tag="PAE0732"
FT   CDS_pept        406526..406729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0732"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62987"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK6"
FT                   /protein_id="AAL62987.1"
FT   gene            406763..407434
FT                   /locus_tag="PAE0733"
FT   CDS_pept        406763..407434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0733"
FT                   /product="ribosomal protein S7"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62988"
FT                   /db_xref="GOA:Q8ZYK5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYK5"
FT                   /protein_id="AAL62988.1"
FT                   R"
FT   gene            407465..408454
FT                   /locus_tag="PAE0734"
FT   CDS_pept        407465..408454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0734"
FT                   /product="replication factor C small subunit"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62989"
FT                   /db_xref="GOA:Q8ZYK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR023748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYK4"
FT                   /protein_id="AAL62989.1"
FT   gene            408454..409722
FT                   /locus_tag="PAE0735"
FT   CDS_pept        408454..409722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0735"
FT                   /product="replication factor C large subunit"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62990"
FT                   /db_xref="GOA:Q8ZYK3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013725"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYK3"
FT                   /protein_id="AAL62990.1"
FT   gene            409722..410018
FT                   /locus_tag="PAE0736"
FT   CDS_pept        409722..410018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0736"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62991"
FT                   /db_xref="InterPro:IPR021540"
FT                   /db_xref="PDB:1RKI"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK2"
FT                   /protein_id="AAL62991.1"
FT   gene            410093..411262
FT                   /locus_tag="PAE0737"
FT   CDS_pept        410093..411262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0737"
FT                   /product="cell division control protein 6 (cdc6), putative"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62992"
FT                   /db_xref="GOA:Q8ZYK1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1FNN"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK1"
FT                   /protein_id="AAL62992.1"
FT   gene            411259..411552
FT                   /locus_tag="PAE0738"
FT   CDS_pept        411259..411552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0738"
FT                   /product="transcriptional regulatory protein
FT                   (helix-turn-helix), putative"
FT                   /note="Regulatory functions; General"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62993"
FT                   /db_xref="GOA:Q8ZYK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYK0"
FT                   /protein_id="AAL62993.1"
FT   gene            411569..412102
FT                   /locus_tag="PAE0739"
FT   CDS_pept        411569..412102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62994"
FT                   /db_xref="GOA:Q8ZYJ9"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ9"
FT                   /protein_id="AAL62994.1"
FT                   KGSPKRLKTWRLYY"
FT   gene            412177..413277
FT                   /locus_tag="PAE0741"
FT   CDS_pept        412177..413277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0741"
FT                   /product="translation initiation factor aIF-2B alpha
FT                   subunit"
FT                   /note="Protein synthesis; Translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62995"
FT                   /db_xref="GOA:Q8ZYJ8"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ8"
FT                   /protein_id="AAL62995.1"
FT   gene            413383..413700
FT                   /locus_tag="PAE0742"
FT   CDS_pept        413383..413700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0742"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ7"
FT                   /protein_id="AAL62996.1"
FT                   Q"
FT   gene            413700..414839
FT                   /locus_tag="PAE0743"
FT   CDS_pept        413700..414839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0743"
FT                   /product="RNA binding protein (fmu, PCNA P120 homolog),
FT                   probable"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62997"
FT                   /db_xref="GOA:Q8ZYJ6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ6"
FT                   /protein_id="AAL62997.1"
FT   gene            complement(414823..415050)
FT                   /locus_tag="PAE0744"
FT   CDS_pept        complement(414823..415050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0744"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62998"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ5"
FT                   /protein_id="AAL62998.1"
FT   gene            415095..415736
FT                   /locus_tag="PAE0745"
FT   CDS_pept        415095..415736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0745"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAL62999"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYJ4"
FT                   /protein_id="AAL62999.1"
FT   gene            complement(415842..416306)
FT                   /locus_tag="PAE0746"
FT   CDS_pept        complement(415842..416306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0746"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63000"
FT                   /db_xref="GOA:Q8ZYJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ3"
FT                   /protein_id="AAL63000.1"
FT   gene            complement(416445..416615)
FT                   /locus_tag="PAE0748"
FT   CDS_pept        complement(416445..416615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0748"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63001"
FT                   /db_xref="GOA:Q8ZYJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ2"
FT                   /protein_id="AAL63001.1"
FT                   IKTRRRVVEIK"
FT   gene            complement(416680..417966)
FT                   /locus_tag="PAE0749"
FT   CDS_pept        complement(416680..417966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0749"
FT                   /product="conserved protein (nfeD homolog)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63002"
FT                   /db_xref="GOA:Q8ZYJ1"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ1"
FT                   /protein_id="AAL63002.1"
FT   gene            complement(417963..418751)
FT                   /locus_tag="PAE0750"
FT   CDS_pept        complement(417963..418751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0750"
FT                   /product="conserved protein (band 7 homolog)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63003"
FT                   /db_xref="GOA:Q8ZYJ0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYJ0"
FT                   /protein_id="AAL63003.1"
FT   gene            419345..419662
FT                   /locus_tag="PAE0752"
FT   CDS_pept        419345..419662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0752"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI9"
FT                   /protein_id="AAL63004.1"
FT                   L"
FT   gene            419659..420687
FT                   /locus_tag="PAE0753"
FT   CDS_pept        419659..420687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0753"
FT                   /product="H+-transporting ATP synthase subunit C (atpC)"
FT                   /note="Energy metabolism; ATP-proton motive force
FT                   interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63005"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI8"
FT                   /protein_id="AAL63005.1"
FT                   TR"
FT   gene            complement(420689..420952)
FT                   /locus_tag="PAE0754"
FT   CDS_pept        complement(420689..420952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0754"
FT                   /product="H+-transporting ATP synthase subunit C (atpC)"
FT                   /note="Energy metabolism; ATP-proton motive force
FT                   interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63006"
FT                   /db_xref="GOA:Q8ZYI7"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI7"
FT                   /protein_id="AAL63006.1"
FT   gene            complement(420967..421116)
FT                   /locus_tag="PAE0756"
FT   CDS_pept        complement(420967..421116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0756"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63007"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI6"
FT                   /protein_id="AAL63007.1"
FT                   YLKT"
FT   gene            complement(421335..421934)
FT                   /locus_tag="PAE0758"
FT   CDS_pept        complement(421335..421934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0758"
FT                   /product="H+-transporting ATP synthase subunit D (atpD)"
FT                   /note="Energy metabolism; ATP-proton motive force
FT                   interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63008"
FT                   /db_xref="GOA:Q8ZYI5"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI5"
FT                   /protein_id="AAL63008.1"
FT   gene            421982..422758
FT                   /locus_tag="PAE0759"
FT   CDS_pept        421982..422758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0759"
FT                   /product="GTP binding protein, conjectural"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63009"
FT                   /db_xref="GOA:Q8ZYI4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI4"
FT                   /protein_id="AAL63009.1"
FT   gene            422781..423251
FT                   /locus_tag="PAE0760"
FT   CDS_pept        422781..423251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0760"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63010"
FT                   /db_xref="GOA:Q8ZYI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI3"
FT                   /protein_id="AAL63010.1"
FT   gene            complement(423353..423907)
FT                   /locus_tag="PAE0762"
FT   CDS_pept        complement(423353..423907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0762"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0762"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63011"
FT                   /db_xref="GOA:Q8ZYI2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI2"
FT                   /protein_id="AAL63011.1"
FT   gene            423933..423986
FT                   /locus_tag="PAEsR27"
FT   ncRNA           423933..423986
FT                   /locus_tag="PAEsR27"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   tRNA06(gln) at U34"
FT                   /ncRNA_class="other"
FT   gene            424026..425432
FT                   /locus_tag="PAE0763"
FT   CDS_pept        424026..425432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0763"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0763"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63012"
FT                   /db_xref="GOA:Q8ZYI1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI1"
FT                   /protein_id="AAL63012.1"
FT                   KPQMLYSDTS"
FT   gene            complement(425414..426703)
FT                   /locus_tag="PAE0764"
FT   CDS_pept        complement(425414..426703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0764"
FT                   /product="phosphomannomutase (pmm)"
FT                   /note="Cell envelope; Biosynthesis and degradation of
FT                   surface polysaccharides and lipopolysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0764"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63013"
FT                   /db_xref="GOA:Q8ZYI0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYI0"
FT                   /protein_id="AAL63013.1"
FT   gene            426817..427932
FT                   /locus_tag="PAE0766"
FT   CDS_pept        426817..427932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0766"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0766"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63014"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH9"
FT                   /protein_id="AAL63014.1"
FT   gene            complement(427934..428533)
FT                   /locus_tag="PAE0768"
FT   CDS_pept        complement(427934..428533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0768"
FT                   /product="orotidine-5'-monophosphate decarboxylase (pyrF)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0768"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63015"
FT                   /db_xref="GOA:Q8ZYH8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH8"
FT                   /protein_id="AAL63015.1"
FT   gene            428575..429492
FT                   /locus_tag="PAE0770"
FT   CDS_pept        428575..429492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0770"
FT                   /product="aspartate carbamoyltransferase catalytic subunit
FT                   (pyrB)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0770"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63016"
FT                   /db_xref="GOA:Q8ZYH7"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYH7"
FT                   /protein_id="AAL63016.1"
FT   gene            429489..430019
FT                   /locus_tag="PAE0771"
FT   CDS_pept        429489..430019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0771"
FT                   /product="N-acyltransferase"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0771"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63017"
FT                   /db_xref="GOA:Q8ZYH6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH6"
FT                   /protein_id="AAL63017.1"
FT                   SDGEDAFLMACPL"
FT   gene            430063..431592
FT                   /locus_tag="PAE0772"
FT   CDS_pept        430063..431592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0772"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0772"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63018"
FT                   /db_xref="GOA:Q8ZYH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH5"
FT                   /protein_id="AAL63018.1"
FT   gene            431596..433080
FT                   /locus_tag="PAE0773"
FT   CDS_pept        431596..433080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0773"
FT                   /product="conserved protein (possible type II secretion,
FT                   gsp)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0773"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63019"
FT                   /db_xref="GOA:Q8ZYH4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH4"
FT                   /protein_id="AAL63019.1"
FT   gene            433267..433779
FT                   /locus_tag="PAE0776"
FT   CDS_pept        433267..433779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0776"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0776"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63020"
FT                   /db_xref="GOA:Q8ZYH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH3"
FT                   /protein_id="AAL63020.1"
FT                   ELLDLEP"
FT   gene            433813..435300
FT                   /locus_tag="PAE0777"
FT   CDS_pept        433813..435300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0777"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="Protein synthesis; tRNA and rRNA base modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0777"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63021"
FT                   /db_xref="GOA:Q8ZYH2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004804"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYH2"
FT                   /protein_id="AAL63021.1"
FT   gene            complement(435361..436077)
FT                   /locus_tag="PAE0779"
FT   CDS_pept        complement(435361..436077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0779"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0779"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63022"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYH1"
FT                   /protein_id="AAL63022.1"
FT                   RLEEQSKREESSKLYI"
FT   gene            complement(436074..436586)
FT                   /locus_tag="PAE0781"
FT   CDS_pept        complement(436074..436586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0781"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0781"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63023"
FT                   /db_xref="GOA:Q8ZYH0"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR016481"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYH0"
FT                   /protein_id="AAL63023.1"
FT                   LQKLEKL"
FT   gene            complement(436657..437817)
FT                   /locus_tag="PAE0782"
FT   CDS_pept        complement(436657..437817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0782"
FT                   /product="conserved protein (possible hflX)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0782"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63024"
FT                   /db_xref="GOA:Q8ZYG9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG9"
FT                   /protein_id="AAL63024.1"
FT   gene            complement(437807..438292)
FT                   /locus_tag="PAE0783"
FT   CDS_pept        complement(437807..438292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0783"
FT                   /product="conserved helix-turn-helix protein"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0783"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63025"
FT                   /db_xref="GOA:Q8ZYG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG8"
FT                   /protein_id="AAL63025.1"
FT   gene            438301..438792
FT                   /locus_tag="PAE0786"
FT   CDS_pept        438301..438792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0786"
FT                   /product="conserved protein with predicted RNA binding PUA
FT                   domain"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0786"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63026"
FT                   /db_xref="GOA:Q8ZYG7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG7"
FT                   /protein_id="AAL63026.1"
FT                   "
FT   gene            complement(439023..439313)
FT                   /locus_tag="PAE0789"
FT   CDS_pept        complement(439023..439313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0789"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0789"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63027"
FT                   /db_xref="GOA:Q8ZYG6"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="PDB:2ZYZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG6"
FT                   /protein_id="AAL63027.1"
FT   gene            439522..439764
FT                   /locus_tag="PAE0790"
FT   CDS_pept        439522..439764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0790"
FT                   /product="small nuclear ribonucleoprotein homolog
FT                   (Sm-like)"
FT                   /note="Transcription; RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0790"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63028"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="PDB:1I8F"
FT                   /db_xref="PDB:1LNX"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG5"
FT                   /protein_id="AAL63028.1"
FT   gene            439982..440584
FT                   /locus_tag="PAE0791"
FT   CDS_pept        439982..440584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0791"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0791"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63029"
FT                   /db_xref="GOA:Q8ZYG4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG4"
FT                   /protein_id="AAL63029.1"
FT   gene            440597..441520
FT                   /locus_tag="PAE0793"
FT   CDS_pept        440597..441520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0793"
FT                   /product="conserved protein (possible ATP binding)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0793"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63030"
FT                   /db_xref="GOA:Q8ZYG3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG3"
FT                   /protein_id="AAL63030.1"
FT   gene            complement(441514..441897)
FT                   /locus_tag="PAE0794"
FT   CDS_pept        complement(441514..441897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0794"
FT                   /product="cytidine deaminase"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0794"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63031"
FT                   /db_xref="GOA:Q8ZYG2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG2"
FT                   /protein_id="AAL63031.1"
FT   gene            441935..442873
FT                   /locus_tag="PAE0796"
FT   CDS_pept        441935..442873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0796"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0796"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG1"
FT                   /protein_id="AAL63032.1"
FT   gene            442904..443686
FT                   /locus_tag="PAE0797"
FT   CDS_pept        442904..443686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0797"
FT                   /product="short chain dehydrogenase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0797"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63033"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYG0"
FT                   /protein_id="AAL63033.1"
FT   gene            complement(443675..444967)
FT                   /locus_tag="PAE0798"
FT   CDS_pept        complement(443675..444967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0798"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="Amino acid biosynthesis; Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0798"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63034"
FT                   /db_xref="GOA:Q8ZYF9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF9"
FT                   /protein_id="AAL63034.1"
FT   gene            complement(444998..445732)
FT                   /locus_tag="PAE0799"
FT   CDS_pept        complement(444998..445732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0799"
FT                   /product="molybdenum cofactor biosynthesis protein (moaC)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0799"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63035"
FT                   /db_xref="GOA:Q8ZYF8"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF8"
FT                   /protein_id="AAL63035.1"
FT   gene            complement(445729..446058)
FT                   /locus_tag="PAE0800"
FT   CDS_pept        complement(445729..446058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0800"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0800"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63036"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYF7"
FT                   /protein_id="AAL63036.1"
FT                   ERCLQ"
FT   gene            complement(446088..447146)
FT                   /locus_tag="PAE0801"
FT   CDS_pept        complement(446088..447146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0801"
FT                   /product="conserved protein (possible oxidoreductase)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0801"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63037"
FT                   /db_xref="GOA:Q8ZYF6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF6"
FT                   /protein_id="AAL63037.1"
FT                   LRNWIEQRRLTC"
FT   gene            complement(447146..447886)
FT                   /locus_tag="PAE0803"
FT   CDS_pept        complement(447146..447886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0803"
FT                   /product="ribosomal protein L2"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0803"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63038"
FT                   /db_xref="GOA:Q8ZYF5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF5"
FT                   /protein_id="AAL63038.1"
FT   gene            447931..447986
FT                   /locus_tag="PAEsR49"
FT   ncRNA           447931..447986
FT                   /locus_tag="PAEsR49"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   16S at C1747"
FT                   /ncRNA_class="other"
FT   gene            448017..448232
FT                   /locus_tag="PAE0804"
FT   CDS_pept        448017..448232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0804"
FT                   /product="ribosomal protein S17"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0804"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63039"
FT                   /db_xref="GOA:Q8ZYF4"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF4"
FT                   /protein_id="AAL63039.1"
FT   gene            448235..448924
FT                   /locus_tag="PAE0805"
FT   CDS_pept        448235..448924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0805"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerases"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0805"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63040"
FT                   /db_xref="GOA:Q8ZYF3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYF3"
FT                   /protein_id="AAL63040.1"
FT                   EEVELKA"
FT   gene            448960..449568
FT                   /locus_tag="PAE0807"
FT   CDS_pept        448960..449568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0807"
FT                   /product="proteasome beta subunit"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0807"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63041"
FT                   /db_xref="GOA:Q8ZYF2"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYF2"
FT                   /protein_id="AAL63041.1"
FT   gene            complement(449563..449943)
FT                   /locus_tag="PAE0808"
FT   CDS_pept        complement(449563..449943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0808"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0808"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63042"
FT                   /db_xref="GOA:Q8ZYF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYF1"
FT                   /protein_id="AAL63042.1"
FT   gene            complement(449983..450402)
FT                   /locus_tag="PAE0809"
FT   CDS_pept        complement(449983..450402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0809"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0809"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63043"
FT                   /db_xref="GOA:Q8ZYF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYF0"
FT                   /protein_id="AAL63043.1"
FT   gene            complement(450552..450869)
FT                   /locus_tag="PAE0810"
FT   CDS_pept        complement(450552..450869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0810"
FT                   /product="mutT/nudix family protein"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0810"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63044"
FT                   /db_xref="GOA:Q8ZYE9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYE9"
FT                   /protein_id="AAL63044.1"
FT                   V"
FT   gene            450855..451049
FT                   /locus_tag="PAE0811"
FT   CDS_pept        450855..451049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0811"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0811"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYE8"
FT                   /protein_id="AAL63045.1"
FT   gene            451184..452443
FT                   /locus_tag="PAE0812"
FT   CDS_pept        451184..452443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0812"
FT                   /product="enolase"
FT                   /note="Energy metabolism; Glycolysis/gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0812"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63046"
FT                   /db_xref="GOA:Q8ZYE7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYE7"
FT                   /protein_id="AAL63046.1"
FT   gene            452474..452884
FT                   /locus_tag="PAE0813"
FT   CDS_pept        452474..452884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0813"
FT                   /product="molybdenum-pterin-binding protein, conjectural"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0813"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63047"
FT                   /db_xref="GOA:Q8ZYE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYE6"
FT                   /protein_id="AAL63047.1"
FT   gene            complement(452869..453801)
FT                   /locus_tag="PAE0814"
FT   CDS_pept        complement(452869..453801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0814"
FT                   /product="molybdenum cofactor biosynthesis protein (moaA)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0814"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63048"
FT                   /db_xref="GOA:Q8ZYE5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYE5"
FT                   /protein_id="AAL63048.1"
FT   gene            454218..455327
FT                   /locus_tag="PAE0815"
FT   CDS_pept        454218..455327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0815"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /note="Regulatory functions; General"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0815"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63049"
FT                   /db_xref="GOA:Q8ZYE4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYE4"
FT                   /protein_id="AAL63049.1"
FT   gene            455337..455789
FT                   /locus_tag="PAE0816"
FT   CDS_pept        455337..455789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0816"
FT                   /product="conserved protein with Forkhead-associated (FHA)
FT                   domain"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0816"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63050"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYE3"
FT                   /protein_id="AAL63050.1"
FT   gene            455825..456451
FT                   /locus_tag="PAE0817"
FT   CDS_pept        455825..456451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0817"
FT                   /product="ribosomal protein S2"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0817"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63051"
FT                   /db_xref="GOA:Q8ZYE2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYE2"
FT                   /protein_id="AAL63051.1"
FT   gene            456451..457296
FT                   /locus_tag="PAE0818"
FT   CDS_pept        456451..457296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0818"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0818"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63052"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYE1"
FT                   /protein_id="AAL63052.1"
FT                   "
FT   gene            complement(457293..458678)
FT                   /locus_tag="PAE0819"
FT   CDS_pept        complement(457293..458678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0819"
FT                   /product="pyruvate kinase"
FT                   /note="Energy metabolism; Glycolysis/gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0819"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63053"
FT                   /db_xref="GOA:Q8ZYE0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="PDB:3QTG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYE0"
FT                   /protein_id="AAL63053.1"
FT                   VKL"
FT   gene            complement(458748..460652)
FT                   /locus_tag="PAE0820"
FT   CDS_pept        complement(458748..460652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0820"
FT                   /product="mRNA 3'-end processing factor, conjectural"
FT                   /note="Transcription; RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0820"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63054"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD9"
FT                   /protein_id="AAL63054.1"
FT   gene            460695..462119
FT                   /locus_tag="PAE0821"
FT   CDS_pept        460695..462119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0821"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="Protein synthesis; tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0821"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63055"
FT                   /db_xref="GOA:Q8ZYD8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYD8"
FT                   /protein_id="AAL63055.1"
FT                   ELHDFGQRTYYTYKRR"
FT   gene            complement(462104..462610)
FT                   /locus_tag="PAE0822"
FT   CDS_pept        complement(462104..462610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0822"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0822"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63056"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD7"
FT                   /protein_id="AAL63056.1"
FT                   LQRLL"
FT   gene            complement(462711..463721)
FT                   /locus_tag="PAE0824"
FT   CDS_pept        complement(462711..463721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0824"
FT                   /product="P. aerophilum family 1964 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0824"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63057"
FT                   /db_xref="GOA:Q8ZYD6"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD6"
FT                   /protein_id="AAL63057.1"
FT   gene            complement(463759..467316)
FT                   /locus_tag="PAE0826"
FT   CDS_pept        complement(463759..467316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0826"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0826"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD5"
FT                   /protein_id="AAL63058.1"
FT   gene            467363..469285
FT                   /locus_tag="PAE0827"
FT   CDS_pept        467363..469285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0827"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0827"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD4"
FT                   /protein_id="AAL63059.1"
FT                   TLVIS"
FT   gene            469327..477306
FT                   /locus_tag="PAE0829"
FT   CDS_pept        469327..477306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0829"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0829"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63060"
FT                   /db_xref="GOA:Q8ZYD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD3"
FT                   /protein_id="AAL63060.1"
FT                   EYNNWRRRRLMQILAPPK"
FT   gene            477366..477959
FT                   /locus_tag="PAE0830"
FT   CDS_pept        477366..477959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0830"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0830"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63061"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYD2"
FT                   /protein_id="AAL63061.1"
FT   gene            477989..478780
FT                   /locus_tag="PAE0831"
FT   CDS_pept        477989..478780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0831"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0831"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD1"
FT                   /protein_id="AAL63062.1"
FT   gene            478761..479291
FT                   /locus_tag="PAE0832"
FT   CDS_pept        478761..479291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0832"
FT                   /product="adenylate cyclase"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0832"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63063"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYD0"
FT                   /protein_id="AAL63063.1"
FT                   YLELYFNTFKSSG"
FT   gene            479299..481053
FT                   /locus_tag="PAE0833"
FT   CDS_pept        479299..481053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0833"
FT                   /product="DNA ligase"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0833"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63064"
FT                   /db_xref="GOA:O93723"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93723"
FT                   /protein_id="AAL63064.1"
FT                   QKKVVQPE"
FT   gene            complement(481041..481541)
FT                   /locus_tag="PAE0834"
FT   CDS_pept        complement(481041..481541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0834"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0834"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC9"
FT                   /protein_id="AAL63065.1"
FT                   YSG"
FT   gene            481582..482499
FT                   /locus_tag="PAE0835"
FT   CDS_pept        481582..482499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0835"
FT                   /product="sugar kinase, possible phosphofructokinase"
FT                   /note="Energy metabolism; Glycolysis/gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0835"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63066"
FT                   /db_xref="GOA:Q7LX31"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LX31"
FT                   /protein_id="AAL63066.1"
FT   gene            482519..482860
FT                   /locus_tag="PAE0836"
FT   CDS_pept        482519..482860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0836"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0836"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC8"
FT                   /protein_id="AAL63067.1"
FT                   KRQGLGDYL"
FT   gene            482857..483534
FT                   /locus_tag="PAE0837"
FT   CDS_pept        482857..483534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0837"
FT                   /product="sugar-phosphate nucleotidyl transferase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0837"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63068"
FT                   /db_xref="GOA:Q8ZYC7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC7"
FT                   /protein_id="AAL63068.1"
FT                   LKP"
FT   gene            483565..484296
FT                   /locus_tag="PAE0838"
FT   CDS_pept        483565..484296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0838"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0838"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC6"
FT                   /protein_id="AAL63069.1"
FT   gene            484293..484847
FT                   /locus_tag="PAE0839"
FT   CDS_pept        484293..484847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0839"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0839"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC5"
FT                   /protein_id="AAL63070.1"
FT   gene            complement(484816..485196)
FT                   /locus_tag="PAE0840"
FT   CDS_pept        complement(484816..485196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0840"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0840"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63071"
FT                   /db_xref="GOA:Q8ZYC4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC4"
FT                   /protein_id="AAL63071.1"
FT   gene            485223..486284
FT                   /locus_tag="PAE0841"
FT   CDS_pept        485223..486284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0841"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0841"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63072"
FT                   /db_xref="GOA:Q8ZYC3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC3"
FT                   /protein_id="AAL63072.1"
FT                   IDPQTLEELEPLP"
FT   gene            complement(486449..486542)
FT                   /locus_tag="PAEtR44"
FT   tRNA            complement(486449..486542)
FT                   /locus_tag="PAEtR44"
FT                   /product="tRNA-Arg"
FT   gene            486748..487263
FT                   /locus_tag="PAE0843"
FT   CDS_pept        486748..487263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0843"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0843"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63073"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC2"
FT                   /protein_id="AAL63073.1"
FT                   RVCGVFKR"
FT   gene            487416..487568
FT                   /locus_tag="PAE0845"
FT   CDS_pept        487416..487568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0845"
FT                   /product="paREP2a"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0845"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63074"
FT                   /db_xref="InterPro:IPR012490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC1"
FT                   /protein_id="AAL63074.1"
FT                   SDDSG"
FT   gene            487555..487734
FT                   /locus_tag="PAE0846"
FT   CDS_pept        487555..487734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0846"
FT                   /product="paREP2a"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0846"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63075"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYC0"
FT                   /protein_id="AAL63075.1"
FT                   RYVLPYSLAQKTAP"
FT   gene            487834..487942
FT                   /locus_tag="PAEtR43"
FT   tRNA            487834..487942
FT                   /locus_tag="PAEtR43"
FT                   /product="tRNA-Glu"
FT   gene            488323..496680
FT                   /locus_tag="PAE0850"
FT   CDS_pept        488323..496680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0850"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0850"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63076"
FT                   /db_xref="InterPro:IPR011689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB9"
FT                   /protein_id="AAL63076.1"
FT   gene            496670..496855
FT                   /locus_tag="PAE0852"
FT   CDS_pept        496670..496855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0852"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0852"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63077"
FT                   /db_xref="InterPro:IPR011689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB8"
FT                   /protein_id="AAL63077.1"
FT                   ELLRWYAEVMKESAEL"
FT   gene            496919..496993
FT                   /locus_tag="PAEtRpseudo"
FT   tRNA            496919..496993
FT                   /locus_tag="PAEtRpseudo"
FT                   /product="tRNA-OTHER"
FT   gene            complement(497136..497408)
FT                   /locus_tag="PAE0855"
FT   CDS_pept        complement(497136..497408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0855"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0855"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB7"
FT                   /protein_id="AAL63078.1"
FT   gene            complement(497432..498328)
FT                   /locus_tag="PAE0857"
FT   CDS_pept        complement(497432..498328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0857"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0857"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63079"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB6"
FT                   /protein_id="AAL63079.1"
FT                   CTGCGACALLCTRGAIR"
FT   gene            complement(498341..498682)
FT                   /locus_tag="PAE0858"
FT   CDS_pept        complement(498341..498682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0858"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0858"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB5"
FT                   /protein_id="AAL63080.1"
FT                   KLVIKLKIR"
FT   gene            499073..499384
FT                   /locus_tag="PAE0862"
FT   CDS_pept        499073..499384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0862"
FT                   /product="ribosomal protein L14"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0862"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63081"
FT                   /db_xref="GOA:Q8ZYB4"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYB4"
FT                   /protein_id="AAL63081.1"
FT   gene            499381..500382
FT                   /locus_tag="PAE0865"
FT   CDS_pept        499381..500382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0865"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="Protein synthesis; tRNA and rRNA base modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0865"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63082"
FT                   /db_xref="GOA:Q8ZYB3"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYB3"
FT                   /protein_id="AAL63082.1"
FT   gene            500455..500748
FT                   /locus_tag="PAE0866"
FT   CDS_pept        500455..500748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0866"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0866"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63083"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB2"
FT                   /protein_id="AAL63083.1"
FT   gene            500745..501239
FT                   /locus_tag="PAE0867"
FT   CDS_pept        500745..501239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0867"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0867"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63084"
FT                   /db_xref="GOA:Q8ZYB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB1"
FT                   /protein_id="AAL63084.1"
FT                   I"
FT   gene            501260..501718
FT                   /locus_tag="PAE0868"
FT   CDS_pept        501260..501718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0868"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0868"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63085"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYB0"
FT                   /protein_id="AAL63085.1"
FT   gene            501715..502647
FT                   /locus_tag="PAE0870"
FT   CDS_pept        501715..502647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0870"
FT                   /product="conserved NAD/P oxidoreductase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0870"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63086"
FT                   /db_xref="GOA:Q8ZYA9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA9"
FT                   /protein_id="AAL63086.1"
FT   gene            502707..503252
FT                   /locus_tag="PAE0871"
FT   CDS_pept        502707..503252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0871"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0871"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63087"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA8"
FT                   /protein_id="AAL63087.1"
FT                   KTPLGLGFIGKTAEVVVI"
FT   gene            complement(503249..503830)
FT                   /locus_tag="PAE0872"
FT   CDS_pept        complement(503249..503830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0872"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0872"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63088"
FT                   /db_xref="GOA:Q8ZYA7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA7"
FT                   /protein_id="AAL63088.1"
FT   gene            503859..504344
FT                   /locus_tag="PAE0874"
FT   CDS_pept        503859..504344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0874"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0874"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA6"
FT                   /protein_id="AAL63089.1"
FT   gene            complement(504334..505134)
FT                   /locus_tag="PAE0875"
FT   CDS_pept        complement(504334..505134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0875"
FT                   /product="competence damage protein, conjectural"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0875"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63090"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR023055"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZYA5"
FT                   /protein_id="AAL63090.1"
FT   gene            complement(505145..506023)
FT                   /locus_tag="PAE0876"
FT   CDS_pept        complement(505145..506023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0876"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0876"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63091"
FT                   /db_xref="GOA:Q8ZYA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA4"
FT                   /protein_id="AAL63091.1"
FT                   FIIREEIKGTD"
FT   gene            506064..506477
FT                   /locus_tag="PAE0877"
FT   CDS_pept        506064..506477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0877"
FT                   /product="antioxidant protein, putative"
FT                   /note="Cellular processes; Toxin production and resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0877"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63092"
FT                   /db_xref="GOA:Q8ZYA3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA3"
FT                   /protein_id="AAL63092.1"
FT   gene            506474..506707
FT                   /locus_tag="PAE0878"
FT   CDS_pept        506474..506707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0878"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0878"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63093"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA2"
FT                   /protein_id="AAL63093.1"
FT   gene            complement(506676..507065)
FT                   /locus_tag="PAE0879"
FT   CDS_pept        complement(506676..507065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0879"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0879"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63094"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA1"
FT                   /protein_id="AAL63094.1"
FT   gene            507089..507145
FT                   /locus_tag="PAEsR23"
FT   ncRNA           507089..507145
FT                   /locus_tag="PAEsR23"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   16S at C1874"
FT                   /ncRNA_class="other"
FT   gene            complement(507117..507788)
FT                   /locus_tag="PAE0880"
FT   CDS_pept        complement(507117..507788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0880"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase
FT                   (endonuclease III, PaNth)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0880"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63095"
FT                   /db_xref="GOA:Q7LX30"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q7LX30"
FT                   /protein_id="AAL63095.1"
FT                   T"
FT   gene            507834..508322
FT                   /locus_tag="PAE0882"
FT   CDS_pept        507834..508322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0882"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0882"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63096"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZYA0"
FT                   /protein_id="AAL63096.1"
FT   gene            508367..509152
FT                   /locus_tag="PAE0883"
FT   CDS_pept        508367..509152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0883"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0883"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63097"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY99"
FT                   /protein_id="AAL63097.1"
FT   gene            509526..511001
FT                   /locus_tag="PAE0885"
FT   CDS_pept        509526..511001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0885"
FT                   /product="thermostable carboxypeptidase"
FT                   /note="Protein fate; Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0885"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63098"
FT                   /db_xref="GOA:Q8ZY98"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY98"
FT                   /protein_id="AAL63098.1"
FT   gene            complement(510998..511636)
FT                   /locus_tag="PAE0886"
FT   CDS_pept        complement(510998..511636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0886"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0886"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63099"
FT                   /db_xref="GOA:Q8ZY97"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY97"
FT                   /protein_id="AAL63099.1"
FT   gene            511677..512144
FT                   /locus_tag="PAE0887"
FT   CDS_pept        511677..512144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0887"
FT                   /product="conserved protein (possible
FT                   cytidylyltransferase)"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0887"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63100"
FT                   /db_xref="GOA:Q8ZY96"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023540"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY96"
FT                   /protein_id="AAL63100.1"
FT   gene            complement(512115..513434)
FT                   /locus_tag="PAE0888"
FT   CDS_pept        complement(512115..513434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0888"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0888"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63101"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR014573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY95"
FT                   /protein_id="AAL63101.1"
FT   gene            complement(513451..513798)
FT                   /locus_tag="PAE0889"
FT   CDS_pept        complement(513451..513798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0889"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0889"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY94"
FT                   /protein_id="AAL63102.1"
FT                   DKLNIYSVESL"
FT   gene            513834..513890
FT                   /locus_tag="PAEsR14"
FT   ncRNA           513834..513890
FT                   /locus_tag="PAEsR14"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   23S at U2625"
FT                   /ncRNA_class="other"
FT   gene            513918..514196
FT                   /locus_tag="PAE0890"
FT   CDS_pept        513918..514196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0890"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0890"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63103"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY93"
FT                   /protein_id="AAL63103.1"
FT   gene            complement(514177..514986)
FT                   /locus_tag="PAE0891"
FT   CDS_pept        complement(514177..514986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0891"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0891"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63104"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY92"
FT                   /protein_id="AAL63104.1"
FT   gene            515091..516035
FT                   /locus_tag="PAE0893"
FT   CDS_pept        515091..516035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0893"
FT                   /product="chorismate mutase/prephenate dehydratase
FT                   (P-protein)"
FT                   /note="Amino acid biosynthesis; Aromatic amino acid family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0893"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63105"
FT                   /db_xref="GOA:Q8ZY91"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY91"
FT                   /protein_id="AAL63105.1"
FT   gene            complement(516025..518139)
FT                   /locus_tag="PAE0894"
FT   CDS_pept        complement(516025..518139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0894"
FT                   /product="ATP-dependent, DNA binding helicase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0894"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63106"
FT                   /db_xref="GOA:Q8ZY90"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY90"
FT                   /protein_id="AAL63106.1"
FT                   IEQARQLVKF"
FT   gene            complement(518173..518388)
FT                   /locus_tag="PAE0894a"
FT   CDS_pept        complement(518173..518388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0894a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0894a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY89"
FT                   /protein_id="AAL63107.1"
FT   gene            518871..520913
FT                   /locus_tag="PAE0901"
FT   CDS_pept        518871..520913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0901"
FT                   /product="DNA replication licensing factor (mcm)"
FT                   /note="DNA metabolism; DNA replication, recombination, and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0901"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63108"
FT                   /db_xref="GOA:Q8ZY88"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY88"
FT                   /protein_id="AAL63108.1"
FT   gene            520969..521430
FT                   /locus_tag="PAE0902"
FT   CDS_pept        520969..521430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0902"
FT                   /product="paREP8"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0902"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63109"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY87"
FT                   /protein_id="AAL63109.1"
FT   gene            521829..522077
FT                   /locus_tag="PAE0903"
FT   CDS_pept        521829..522077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0903"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0903"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63110"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY86"
FT                   /protein_id="AAL63110.1"
FT   gene            522079..522456
FT                   /locus_tag="PAE0904"
FT   CDS_pept        522079..522456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0904"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0904"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63111"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY85"
FT                   /protein_id="AAL63111.1"
FT   gene            522435..522773
FT                   /locus_tag="PAE0905"
FT   CDS_pept        522435..522773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0905"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0905"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63112"
FT                   /db_xref="GOA:Q8ZY84"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY84"
FT                   /protein_id="AAL63112.1"
FT                   IDAEVKIC"
FT   gene            522813..524048
FT                   /locus_tag="PAE0906"
FT   CDS_pept        522813..524048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0906"
FT                   /product="paREP7"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0906"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63113"
FT                   /db_xref="GOA:Q8ZY83"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY83"
FT                   /protein_id="AAL63113.1"
FT                   LLILGREYPRPY"
FT   gene            complement(524292..524507)
FT                   /locus_tag="PAE0908"
FT   CDS_pept        complement(524292..524507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0908"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0908"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63114"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY82"
FT                   /protein_id="AAL63114.1"
FT   gene            524593..524664
FT                   /locus_tag="PAE0908a"
FT   CDS_pept        524593..524664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0908a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0908a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY81"
FT                   /protein_id="AAL63115.1"
FT                   /translation="MGLTVKDAALAEARRLAVAETQS"
FT   gene            524767..525168
FT                   /locus_tag="PAE0909"
FT   CDS_pept        524767..525168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0909"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0909"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63116"
FT                   /db_xref="GOA:Q8ZY80"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY80"
FT                   /protein_id="AAL63116.1"
FT   gene            525864..526232
FT                   /locus_tag="PAE0910"
FT   CDS_pept        525864..526232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0910"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0910"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63117"
FT                   /db_xref="GOA:Q8ZY79"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY79"
FT                   /protein_id="AAL63117.1"
FT                   VFVALFSVSAVLSYLLGR"
FT   gene            526248..526544
FT                   /locus_tag="PAE0910a"
FT   CDS_pept        526248..526544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0910a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0910a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63118"
FT                   /db_xref="GOA:Q8ZY78"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY78"
FT                   /protein_id="AAL63118.1"
FT   gene            526519..526857
FT                   /locus_tag="PAE0913"
FT   CDS_pept        526519..526857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0913"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0913"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63119"
FT                   /db_xref="GOA:Q8ZY77"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY77"
FT                   /protein_id="AAL63119.1"
FT                   LYLGMPQC"
FT   gene            526940..529723
FT                   /locus_tag="PAE0915"
FT   CDS_pept        526940..529723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0915"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0915"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63120"
FT                   /db_xref="GOA:Q8ZY76"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY76"
FT                   /protein_id="AAL63120.1"
FT   gene            529749..530486
FT                   /locus_tag="PAE0916"
FT   CDS_pept        529749..530486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0916"
FT                   /product="P. aerophilum family 1964 protein part 1,
FT                   authentic frameshift"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0916"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63121"
FT                   /db_xref="GOA:Q8ZY75"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY75"
FT                   /protein_id="AAL63121.1"
FT   gene            530491..530757
FT                   /locus_tag="PAE0917"
FT   CDS_pept        530491..530757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0917"
FT                   /product="P. aerophilum family 1964 protein part 2,
FT                   authentic frameshift"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0917"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY74"
FT                   /protein_id="AAL63122.1"
FT   gene            complement(530729..531718)
FT                   /locus_tag="PAE0918"
FT   CDS_pept        complement(530729..531718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0918"
FT                   /product="histidinol-phosphate aminotransferase (hisC)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0918"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63123"
FT                   /db_xref="GOA:Q8ZY73"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY73"
FT                   /protein_id="AAL63123.1"
FT   gene            complement(531732..532307)
FT                   /locus_tag="PAE0920"
FT   CDS_pept        complement(531732..532307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0920"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0920"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63124"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY72"
FT                   /protein_id="AAL63124.1"
FT   gene            complement(532338..533753)
FT                   /locus_tag="PAE0922"
FT   CDS_pept        complement(532338..533753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0922"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0922"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63125"
FT                   /db_xref="GOA:Q8ZY71"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY71"
FT                   /protein_id="AAL63125.1"
FT                   APLGVADDGLVAG"
FT   gene            533900..534094
FT                   /locus_tag="PAE0923"
FT   CDS_pept        533900..534094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0923"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0923"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY70"
FT                   /protein_id="AAL63126.1"
FT   gene            534081..534620
FT                   /locus_tag="PAE0924"
FT   CDS_pept        534081..534620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0924"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0924"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63127"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY69"
FT                   /protein_id="AAL63127.1"
FT                   KLNELKHVVEEALCGR"
FT   gene            534608..534895
FT                   /locus_tag="PAE0925"
FT   CDS_pept        534608..534895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0925"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0925"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63128"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY68"
FT                   /protein_id="AAL63128.1"
FT   gene            534874..535428
FT                   /locus_tag="PAE0926"
FT   CDS_pept        534874..535428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0926"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0926"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63129"
FT                   /db_xref="GOA:Q8ZY67"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY67"
FT                   /protein_id="AAL63129.1"
FT   gene            complement(535423..535929)
FT                   /locus_tag="PAE0927"
FT   CDS_pept        complement(535423..535929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0927"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0927"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY66"
FT                   /protein_id="AAL63130.1"
FT                   FIVGS"
FT   gene            complement(535953..536549)
FT                   /locus_tag="PAE0928"
FT   CDS_pept        complement(535953..536549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0928"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0928"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63131"
FT                   /db_xref="GOA:Q8ZY65"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY65"
FT                   /protein_id="AAL63131.1"
FT   gene            complement(536546..537727)
FT                   /locus_tag="PAE0929"
FT   CDS_pept        complement(536546..537727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0929"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0929"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY64"
FT                   /protein_id="AAL63132.1"
FT   gene            complement(537724..538089)
FT                   /locus_tag="PAE0929a"
FT   CDS_pept        complement(537724..538089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0929a"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0929a"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63133"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY63"
FT                   /protein_id="AAL63133.1"
FT                   LATVLPNGTTVCIAVWA"
FT   gene            complement(538086..539666)
FT                   /locus_tag="PAE0931"
FT   CDS_pept        complement(538086..539666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0931"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0931"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63134"
FT                   /db_xref="GOA:Q8ZY62"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY62"
FT                   /protein_id="AAL63134.1"
FT                   IVDLWVFRR"
FT   gene            539775..540887
FT                   /locus_tag="PAE0932"
FT   CDS_pept        539775..540887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0932"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0932"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63135"
FT                   /db_xref="GOA:Q8ZY61"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY61"
FT                   /protein_id="AAL63135.1"
FT   gene            complement(540884..542125)
FT                   /locus_tag="PAE0933"
FT   CDS_pept        complement(540884..542125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0933"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0933"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63136"
FT                   /db_xref="GOA:Q8ZY60"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY60"
FT                   /protein_id="AAL63136.1"
FT                   IAGFFSPHDVEWIG"
FT   gene            complement(542122..542931)
FT                   /locus_tag="PAE0934"
FT   CDS_pept        complement(542122..542931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0934"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0934"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY59"
FT                   /protein_id="AAL63137.1"
FT   gene            complement(543246..543527)
FT                   /locus_tag="PAE0936"
FT   CDS_pept        complement(543246..543527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0936"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0936"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63138"
FT                   /db_xref="GOA:Q8ZY58"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY58"
FT                   /protein_id="AAL63138.1"
FT   gene            543795..544376
FT                   /locus_tag="PAE0937"
FT   CDS_pept        543795..544376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0937"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0937"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63139"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY57"
FT                   /protein_id="AAL63139.1"
FT   gene            complement(544371..545309)
FT                   /locus_tag="PAE0938"
FT   CDS_pept        complement(544371..545309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0938"
FT                   /product="2-oxoacid ferredoxin oxidoreductase beta subunit"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0938"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63140"
FT                   /db_xref="GOA:Q8ZY56"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY56"
FT                   /protein_id="AAL63140.1"
FT   gene            complement(545312..547213)
FT                   /locus_tag="PAE0939"
FT   CDS_pept        complement(545312..547213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0939"
FT                   /product="2-oxoacid ferredoxin oxidoreductase alpha
FT                   subunit"
FT                   /note="Energy metabolism; Electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0939"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63141"
FT                   /db_xref="GOA:Q8ZY55"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY55"
FT                   /protein_id="AAL63141.1"
FT   gene            complement(547327..547626)
FT                   /locus_tag="PAE0941"
FT   CDS_pept        complement(547327..547626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0941"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0941"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63142"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY54"
FT                   /protein_id="AAL63142.1"
FT   gene            complement(547614..547964)
FT                   /locus_tag="PAE0942"
FT   CDS_pept        complement(547614..547964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0942"
FT                   /product="conserved hypothetical protein part 2, authentic
FT                   frameshift"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0942"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63143"
FT                   /db_xref="GOA:Q8ZY53"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY53"
FT                   /protein_id="AAL63143.1"
FT                   TGVRNQVVKWTS"
FT   gene            complement(547964..548206)
FT                   /locus_tag="PAE0943"
FT   CDS_pept        complement(547964..548206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0943"
FT                   /product="conserved hypothetical protein part 1, authentic
FT                   frameshift"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0943"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63144"
FT                   /db_xref="GOA:Q8ZY52"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY52"
FT                   /protein_id="AAL63144.1"
FT   gene            complement(548377..548429)
FT                   /locus_tag="PAEsR45"
FT   ncRNA           complement(548377..548429)
FT                   /locus_tag="PAEsR45"
FT                   /product="sRNA, predicted to direct ribose methylation of
FT                   tRNA03 (val) at C34"
FT                   /ncRNA_class="other"
FT   gene            complement(548441..549640)
FT                   /locus_tag="PAE0944"
FT   CDS_pept        complement(548441..549640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0944"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0944"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63145"
FT                   /db_xref="GOA:Q8ZY51"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY51"
FT                   /protein_id="AAL63145.1"
FT                   "
FT   gene            549647..550147
FT                   /locus_tag="PAE0945"
FT   CDS_pept        549647..550147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0945"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0945"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63146"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY50"
FT                   /protein_id="AAL63146.1"
FT                   QRA"
FT   gene            550213..551253
FT                   /locus_tag="PAE0946"
FT   CDS_pept        550213..551253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0946"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0946"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63147"
FT                   /db_xref="GOA:Q8ZY49"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY49"
FT                   /protein_id="AAL63147.1"
FT                   VERHGH"
FT   gene            551243..554317
FT                   /locus_tag="PAE0947"
FT   CDS_pept        551243..554317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0947"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Pyrimidine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0947"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63148"
FT                   /db_xref="GOA:Q8ZY48"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY48"
FT                   /protein_id="AAL63148.1"
FT   gene            554311..555105
FT                   /locus_tag="PAE0948"
FT   CDS_pept        554311..555105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0948"
FT                   /product="ribosomal protein S6 modification protein (rimK)"
FT                   /note="Protein synthesis; Ribosomal proteins: synthesis and
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0948"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63149"
FT                   /db_xref="GOA:Q8ZY47"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY47"
FT                   /protein_id="AAL63149.1"
FT   gene            complement(555092..556072)
FT                   /locus_tag="PAE0949"
FT   CDS_pept        complement(555092..556072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0949"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0949"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63150"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY46"
FT                   /protein_id="AAL63150.1"
FT   gene            556099..556974
FT                   /locus_tag="PAE0951"
FT   CDS_pept        556099..556974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0951"
FT                   /product="aminotransferase, conjectural"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0951"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63151"
FT                   /db_xref="GOA:Q8ZY45"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY45"
FT                   /protein_id="AAL63151.1"
FT                   LADFLSEIPV"
FT   gene            556988..557551
FT                   /locus_tag="PAE0952"
FT   CDS_pept        556988..557551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0952"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0952"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63152"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY44"
FT                   /protein_id="AAL63152.1"
FT   gene            557545..558699
FT                   /locus_tag="PAE0953"
FT   CDS_pept        557545..558699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0953"
FT                   /product="putrescine/spermidine binding protein,
FT                   conjectural"
FT                   /note="Transport and binding proteins; Amino acids,
FT                   peptides and amines"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0953"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63153"
FT                   /db_xref="GOA:Q8ZY43"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY43"
FT                   /protein_id="AAL63153.1"
FT   gene            complement(558872..560479)
FT                   /locus_tag="PAE0954"
FT   CDS_pept        complement(558872..560479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0954"
FT                   /product="paREP2b"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0954"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63154"
FT                   /db_xref="InterPro:IPR011689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY42"
FT                   /protein_id="AAL63154.1"
FT                   WRAGKPQSKSSRDAGRSD"
FT   gene            560482..560592
FT                   /locus_tag="PAE0955"
FT   CDS_pept        560482..560592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0955"
FT                   /product="paREP2a"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0955"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63155"
FT                   /db_xref="InterPro:IPR012490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY41"
FT                   /protein_id="AAL63155.1"
FT   gene            560623..561195
FT                   /locus_tag="PAE0956"
FT   CDS_pept        560623..561195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0956"
FT                   /product="amidotransferase (hisH)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0956"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63156"
FT                   /db_xref="GOA:Q8ZY40"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY40"
FT                   /protein_id="AAL63156.1"
FT   gene            complement(561175..561570)
FT                   /locus_tag="PAE0957"
FT   CDS_pept        complement(561175..561570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0957"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0957"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63157"
FT                   /db_xref="GOA:Q8ZY39"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY39"
FT                   /protein_id="AAL63157.1"
FT   gene            561671..562717
FT                   /locus_tag="PAE0958"
FT   CDS_pept        561671..562717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0958"
FT                   /product="histidinol-phosphate aminotransferase (hisC)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0958"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63158"
FT                   /db_xref="GOA:Q8ZY38"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY38"
FT                   /protein_id="AAL63158.1"
FT                   QTKPAGGV"
FT   gene            562759..562860
FT                   /locus_tag="PAE0959"
FT   CDS_pept        562759..562860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0959"
FT                   /product="paREP1, degenerate"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0959"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63159"
FT                   /protein_id="AAL63159.1"
FT   gene            563219..564067
FT                   /locus_tag="PAE0961"
FT   CDS_pept        563219..564067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0961"
FT                   /product="ATP phosphoribosyltransferase (hisG)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0961"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63160"
FT                   /db_xref="GOA:Q8ZY36"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY36"
FT                   /protein_id="AAL63160.1"
FT                   V"
FT   gene            564570..565148
FT                   /locus_tag="PAE0964"
FT   CDS_pept        564570..565148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0964"
FT                   /product="thymidylate kinase (tmk)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Nucleotide and nucleoside interconversions"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0964"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63161"
FT                   /db_xref="GOA:Q8ZY35"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY35"
FT                   /protein_id="AAL63161.1"
FT   gene            complement(565141..565635)
FT                   /locus_tag="PAE0965"
FT   CDS_pept        complement(565141..565635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0965"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0965"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63162"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY34"
FT                   /protein_id="AAL63162.1"
FT                   I"
FT   gene            565682..566263
FT                   /locus_tag="PAE0966"
FT   CDS_pept        565682..566263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0966"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0966"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63163"
FT                   /db_xref="GOA:Q8ZY33"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY33"
FT                   /protein_id="AAL63163.1"
FT   gene            complement(566260..566790)
FT                   /locus_tag="PAE0967"
FT   CDS_pept        complement(566260..566790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0967"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0967"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63164"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY32"
FT                   /protein_id="AAL63164.1"
FT                   VCAAEGGVKTDFG"
FT   gene            complement(566787..567305)
FT                   /locus_tag="PAE0969"
FT   CDS_pept        complement(566787..567305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0969"
FT                   /product="molybdenum cofactor biosynthesis protein (moaB)"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0969"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63165"
FT                   /db_xref="GOA:Q8ZY31"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY31"
FT                   /protein_id="AAL63165.1"
FT                   ISHLLYLIK"
FT   gene            complement(567322..567702)
FT                   /locus_tag="PAE0970"
FT   CDS_pept        complement(567322..567702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0970"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0970"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63166"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY30"
FT                   /protein_id="AAL63166.1"
FT   gene            567733..568215
FT                   /locus_tag="PAE0971"
FT   CDS_pept        567733..568215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0971"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0971"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63167"
FT                   /db_xref="GOA:Q8ZY29"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY29"
FT                   /protein_id="AAL63167.1"
FT   gene            complement(568207..569418)
FT                   /locus_tag="PAE0972"
FT   CDS_pept        complement(568207..569418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0972"
FT                   /product="adenylosuccinate lyase (purB)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0972"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63168"
FT                   /db_xref="GOA:Q8ZY28"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="PDB:1DOF"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY28"
FT                   /protein_id="AAL63168.1"
FT                   LKLC"
FT   gene            complement(569424..569903)
FT                   /locus_tag="PAE0973"
FT   CDS_pept        complement(569424..569903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0973"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0973"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63169"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY27"
FT                   /protein_id="AAL63169.1"
FT   gene            complement(569924..570925)
FT                   /locus_tag="PAE0974"
FT   CDS_pept        complement(569924..570925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0974"
FT                   /product="adenylosuccinate synthetase (purA)"
FT                   /note="Purines, pyrimidines, nucleosides, and nucleotides;
FT                   Purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0974"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63170"
FT                   /db_xref="GOA:Q8ZY26"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY26"
FT                   /protein_id="AAL63170.1"
FT   gene            571256..571609
FT                   /locus_tag="PAE0976"
FT   CDS_pept        571256..571609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0976"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0976"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63171"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY25"
FT                   /protein_id="AAL63171.1"
FT                   VAEREDLDVINYR"
FT   gene            571613..571840
FT                   /locus_tag="PAE0978"
FT   CDS_pept        571613..571840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0978"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0978"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63172"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY24"
FT                   /protein_id="AAL63172.1"
FT   gene            571923..572147
FT                   /locus_tag="PAE0979"
FT   CDS_pept        571923..572147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0979"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0979"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63173"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY23"
FT                   /protein_id="AAL63173.1"
FT   gene            572222..572707
FT                   /locus_tag="PAE0980"
FT   CDS_pept        572222..572707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0980"
FT                   /product="paREP1"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0980"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63174"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY22"
FT                   /protein_id="AAL63174.1"
FT   gene            572963..574408
FT                   /locus_tag="PAE0983"
FT   CDS_pept        572963..574408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0983"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0983"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63175"
FT                   /db_xref="GOA:Q8ZY21"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY21"
FT                   /protein_id="AAL63175.1"
FT   gene            complement(574389..574946)
FT                   /locus_tag="PAE0984"
FT   CDS_pept        complement(574389..574946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0984"
FT                   /product="P. aerophilum family 70 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0984"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63176"
FT                   /db_xref="GOA:Q8ZY20"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY20"
FT                   /protein_id="AAL63176.1"
FT   gene            complement(574916..577303)
FT                   /locus_tag="PAE0985"
FT   CDS_pept        complement(574916..577303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0985"
FT                   /product="P. aerophilum family 68 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0985"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY19"
FT                   /protein_id="AAL63177.1"
FT   gene            complement(577374..577658)
FT                   /locus_tag="PAE0986"
FT   CDS_pept        complement(577374..577658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0986"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0986"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63178"
FT                   /db_xref="GOA:Q8ZY18"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY18"
FT                   /protein_id="AAL63178.1"
FT   gene            complement(577655..578761)
FT                   /locus_tag="PAE0988"
FT   CDS_pept        complement(577655..578761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0988"
FT                   /product="histidinol dehydrogenase (hisD)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0988"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63179"
FT                   /db_xref="GOA:Q8ZY17"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY17"
FT                   /protein_id="AAL63179.1"
FT   gene            complement(578758..579519)
FT                   /locus_tag="PAE0989"
FT   CDS_pept        complement(578758..579519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0989"
FT                   /product="histidine biosynthesis protein (hisF,cyclase)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0989"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63180"
FT                   /db_xref="GOA:Q8ZY16"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:1H5Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY16"
FT                   /protein_id="AAL63180.1"
FT   gene            579577..580137
FT                   /locus_tag="PAE0990"
FT   CDS_pept        579577..580137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0990"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0990"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63181"
FT                   /db_xref="GOA:Q8ZY15"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY15"
FT                   /protein_id="AAL63181.1"
FT   gene            580134..580823
FT                   /locus_tag="PAE0991"
FT   CDS_pept        580134..580823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0991"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase (hisA)"
FT                   /note="Amino acid biosynthesis; Histidine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0991"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63182"
FT                   /db_xref="GOA:Q8ZY14"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY14"
FT                   /protein_id="AAL63182.1"
FT                   KKCANWY"
FT   gene            580805..580996
FT                   /locus_tag="PAE0992"
FT   CDS_pept        580805..580996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0992"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0992"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63183"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY13"
FT                   /protein_id="AAL63183.1"
FT                   LTVTEAVLREFGKRHTRR"
FT   gene            581287..581724
FT                   /locus_tag="PAE0993"
FT   CDS_pept        581287..581724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0993"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0993"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63184"
FT                   /db_xref="GOA:Q8ZY12"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY12"
FT                   /protein_id="AAL63184.1"
FT   gene            complement(581705..582028)
FT                   /locus_tag="PAE0995"
FT   CDS_pept        complement(581705..582028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0995"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0995"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY11"
FT                   /protein_id="AAL63185.1"
FT                   RRI"
FT   gene            complement(582050..582586)
FT                   /locus_tag="PAE0996"
FT   CDS_pept        complement(582050..582586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0996"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0996"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63186"
FT                   /db_xref="GOA:Q8ZY10"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY10"
FT                   /protein_id="AAL63186.1"
FT                   KNSNQLVTSQVLSSL"
FT   gene            complement(582758..584212)
FT                   /locus_tag="PAE0998"
FT   CDS_pept        complement(582758..584212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0998"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0998"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63187"
FT                   /db_xref="GOA:Q8ZY09"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY09"
FT                   /protein_id="AAL63187.1"
FT   gene            584454..586655
FT                   /locus_tag="PAE0999"
FT   CDS_pept        584454..586655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE0999"
FT                   /product="P. aerophilum family 59 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE0999"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY08"
FT                   /protein_id="AAL63188.1"
FT   gene            586648..587178
FT                   /locus_tag="PAE1000"
FT   CDS_pept        586648..587178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1000"
FT                   /product="P. aerophilum family 3 protein"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1000"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63189"
FT                   /db_xref="GOA:Q8ZY07"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY07"
FT                   /protein_id="AAL63189.1"
FT                   YKGLPSGFTRPEG"
FT   gene            587319..587762
FT                   /locus_tag="PAE1001"
FT   CDS_pept        587319..587762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1001"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63190"
FT                   /db_xref="GOA:Q8ZY06"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY06"
FT                   /protein_id="AAL63190.1"
FT   gene            587789..589672
FT                   /locus_tag="PAE1002"
FT   CDS_pept        587789..589672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1002"
FT                   /product="acylamino-acid-releasing enzyme, conjectural"
FT                   /note="Protein fate; Protein modification and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63191"
FT                   /db_xref="GOA:Q8ZY05"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY05"
FT                   /protein_id="AAL63191.1"
FT   gene            589665..590918
FT                   /locus_tag="PAE1003"
FT   CDS_pept        589665..590918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1003"
FT                   /product="asparaginase (asnA)"
FT                   /note="Amino acid biosynthesis; Aspartate family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63192"
FT                   /db_xref="GOA:Q8ZY04"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZY04"
FT                   /protein_id="AAL63192.1"
FT                   PIAYEMSPRSDPLVFGGL"
FT   gene            590915..591445
FT                   /locus_tag="PAE1004"
FT   CDS_pept        590915..591445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63193"
FT                   /db_xref="GOA:Q8ZY03"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY03"
FT                   /protein_id="AAL63193.1"
FT                   DIYVARYCQGVTL"
FT   gene            complement(593021..593575)
FT                   /locus_tag="PAE1008"
FT   CDS_pept        complement(593021..593575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63194"
FT                   /db_xref="GOA:Q8ZY02"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY02"
FT                   /protein_id="AAL63194.1"
FT   gene            593592..593858
FT                   /locus_tag="PAE1009"
FT   CDS_pept        593592..593858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1009"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63195"
FT                   /db_xref="GOA:Q8ZY01"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY01"
FT                   /protein_id="AAL63195.1"
FT   gene            593897..594475
FT                   /locus_tag="PAE1011"
FT   CDS_pept        593897..594475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1011"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZY00"
FT                   /protein_id="AAL63196.1"
FT   gene            complement(594437..595180)
FT                   /locus_tag="PAE1012"
FT   CDS_pept        complement(594437..595180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1012"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63197"
FT                   /db_xref="GOA:Q8ZXZ9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ9"
FT                   /protein_id="AAL63197.1"
FT   gene            complement(595180..596184)
FT                   /locus_tag="PAE1013"
FT   CDS_pept        complement(595180..596184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1013"
FT                   /product="polyprenyl synthetase"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63198"
FT                   /db_xref="GOA:Q8ZXZ8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ8"
FT                   /protein_id="AAL63198.1"
FT   gene            596479..596616
FT                   /locus_tag="PAE1015"
FT   CDS_pept        596479..596616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1015"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63199"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ7"
FT                   /protein_id="AAL63199.1"
FT                   "
FT   gene            596687..597478
FT                   /locus_tag="PAE1016"
FT   CDS_pept        596687..597478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1016"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63200"
FT                   /db_xref="GOA:Q8ZXZ6"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ6"
FT                   /protein_id="AAL63200.1"
FT   gene            597501..597911
FT                   /locus_tag="PAE1017"
FT   CDS_pept        597501..597911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hypothetical; Conserved"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63201"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ5"
FT                   /protein_id="AAL63201.1"
FT   gene            598009..598341
FT                   /locus_tag="PAE1018"
FT   CDS_pept        598009..598341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1018"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1018"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ4"
FT                   /protein_id="AAL63202.1"
FT                   EAVTSE"
FT   gene            complement(598328..598522)
FT                   /locus_tag="PAE1019"
FT   CDS_pept        complement(598328..598522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1019"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63203"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ3"
FT                   /protein_id="AAL63203.1"
FT   gene            598536..598766
FT                   /locus_tag="PAE1020"
FT   CDS_pept        598536..598766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1020"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ2"
FT                   /protein_id="AAL63204.1"
FT   gene            598946..599557
FT                   /locus_tag="PAE1022"
FT   CDS_pept        598946..599557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1022"
FT                   /product="thiamine-monophosphate kinase part 2, authentic
FT                   frameshift"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63205"
FT                   /db_xref="GOA:Q8ZXZ1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ1"
FT                   /protein_id="AAL63205.1"
FT   gene            599536..599793
FT                   /locus_tag="PAE1024"
FT   CDS_pept        599536..599793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1024"
FT                   /product="thiamine-monophosphate kinase part 1, authentic
FT                   frameshift"
FT                   /note="Biosynthesis of cofactors, prosthetic groups, and
FT                   carriers; Thiamine"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63206"
FT                   /db_xref="GOA:Q8ZXZ0"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXZ0"
FT                   /protein_id="AAL63206.1"
FT   gene            599819..600523
FT                   /locus_tag="PAE1026"
FT   CDS_pept        599819..600523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1026"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63207"
FT                   /db_xref="GOA:Q8ZXY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY9"
FT                   /protein_id="AAL63207.1"
FT                   SVYIYYQVFIDN"
FT   gene            complement(600520..601191)
FT                   /locus_tag="PAE1027"
FT   CDS_pept        complement(600520..601191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1027"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="Energy metabolism; Pentose phosphate pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1027"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63208"
FT                   /db_xref="GOA:Q8ZXY8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY8"
FT                   /protein_id="AAL63208.1"
FT                   L"
FT   gene            complement(601212..601595)
FT                   /locus_tag="PAE1028"
FT   CDS_pept        complement(601212..601595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1028"
FT                   /product="conserved protein with 2 CBS domains"
FT                   /note="Unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63209"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY7"
FT                   /protein_id="AAL63209.1"
FT   gene            601692..603560
FT                   /locus_tag="PAE1029"
FT   CDS_pept        601692..603560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1029"
FT                   /product="aldehyde ferredoxin oxidoreductase (aor)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63210"
FT                   /db_xref="GOA:Q8ZXY6"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY6"
FT                   /protein_id="AAL63210.1"
FT   gene            604504..605109
FT                   /locus_tag="PAE1031"
FT   CDS_pept        604504..605109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1031"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY5"
FT                   /protein_id="AAL63211.1"
FT   gene            605091..605519
FT                   /locus_tag="PAE1032"
FT   CDS_pept        605091..605519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1032"
FT                   /product="conserved within P. aerophilum part 1, authentic
FT                   frameshift"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63212"
FT                   /db_xref="GOA:Q8ZXY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY4"
FT                   /protein_id="AAL63212.1"
FT   gene            605503..605901
FT                   /locus_tag="PAE1033"
FT   CDS_pept        605503..605901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1033"
FT                   /product="conserved within P. aerophilum part 2, authentic
FT                   frameshift"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63213"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY3"
FT                   /protein_id="AAL63213.1"
FT   gene            complement(605904..606098)
FT                   /locus_tag="PAE1034"
FT   CDS_pept        complement(605904..606098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1034"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63214"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY2"
FT                   /protein_id="AAL63214.1"
FT   gene            606138..606962
FT                   /locus_tag="PAE1035"
FT   CDS_pept        606138..606962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1035"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY1"
FT                   /protein_id="AAL63215.1"
FT   gene            606944..607762
FT                   /locus_tag="PAE1036"
FT   CDS_pept        606944..607762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1036"
FT                   /product="conserved within P. aerophilum"
FT                   /note="Hypothetical; Conserved within genome"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63216"
FT                   /db_xref="GOA:Q8ZXY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXY0"
FT                   /protein_id="AAL63216.1"
FT   gene            complement(607895..608002)
FT                   /locus_tag="PAE1037"
FT   CDS_pept        complement(607895..608002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1037"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63217"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX9"
FT                   /protein_id="AAL63217.1"
FT   gene            complement(608030..609001)
FT                   /locus_tag="PAE1038"
FT   CDS_pept        complement(608030..609001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1038"
FT                   /product="D-3-phosphoglycerate dehydrogenase (serA)"
FT                   /note="Amino acid biosynthesis; Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63218"
FT                   /db_xref="GOA:Q8ZXX8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX8"
FT                   /protein_id="AAL63218.1"
FT   gene            609092..609619
FT                   /locus_tag="PAE1040"
FT   CDS_pept        609092..609619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1040"
FT                   /product="pyruvate ferredoxin oxidoreductase gamma subunit
FT                   (porG)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63219"
FT                   /db_xref="GOA:Q8ZXX7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX7"
FT                   /protein_id="AAL63219.1"
FT                   LVEMAYQETVGL"
FT   gene            609616..609924
FT                   /locus_tag="PAE1041"
FT   CDS_pept        609616..609924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1041"
FT                   /product="pyruvate ferredoxin oxidoreductase delta subunit
FT                   (porD)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63220"
FT                   /db_xref="GOA:Q8ZXX6"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX6"
FT                   /protein_id="AAL63220.1"
FT   gene            609924..611102
FT                   /locus_tag="PAE1042"
FT   CDS_pept        609924..611102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1042"
FT                   /product="pyruvate ferredoxin oxidoreductase alpha subunit
FT                   (porA)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63221"
FT                   /db_xref="GOA:Q8ZXX5"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX5"
FT                   /protein_id="AAL63221.1"
FT   gene            611099..612043
FT                   /locus_tag="PAE1043"
FT   CDS_pept        611099..612043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1043"
FT                   /product="pyruvate ferredoxin oxidoreductase beta subunit
FT                   (porB)"
FT                   /note="Energy metabolism; Fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63222"
FT                   /db_xref="GOA:Q8ZXX4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX4"
FT                   /protein_id="AAL63222.1"
FT   gene            612137..614017
FT                   /locus_tag="PAE1044"
FT   CDS_pept        612137..614017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1044"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63223"
FT                   /db_xref="GOA:Q8ZXX3"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX3"
FT                   /protein_id="AAL63223.1"
FT   gene            614064..614405
FT                   /locus_tag="PAE1046"
FT   CDS_pept        614064..614405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1046"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63224"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX2"
FT                   /protein_id="AAL63224.1"
FT                   SPGEKNRDN"
FT   gene            614588..616003
FT                   /locus_tag="PAE1048"
FT   CDS_pept        614588..616003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1048"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63225"
FT                   /db_xref="GOA:Q8ZXX1"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX1"
FT                   /protein_id="AAL63225.1"
FT                   FRHDLLWGVVQSF"
FT   gene            616024..617235
FT                   /locus_tag="PAE1049"
FT   CDS_pept        616024..617235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1049"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63226"
FT                   /db_xref="GOA:Q8ZXX0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXX0"
FT                   /protein_id="AAL63226.1"
FT                   ARII"
FT   gene            617461..618456
FT                   /locus_tag="PAE1051"
FT   CDS_pept        617461..618456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PAE1051"
FT                   /product="cysteine synthase"
FT                   /note="Amino acid biosynthesis; Serine family"
FT                   /db_xref="EnsemblGenomes-Gn:PAE1051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL63227"
FT                   /db_xref="GOA:Q8ZXW9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZXW9"
FT                   /protein_id="AAL63227.1"
FT                   GHASALGFYF