(data stored in ACNUC17686 zone)

EMBL: AE009949

ID   AE009949; SV 1; circular; genomic DNA; STD; PRO; 1895017 BP.
XX
AC   AE009949; AE009953-AE010125;
XX
PR   Project:PRJNA286;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Streptococcus pyogenes MGAS8232, complete genome.
XX
KW   .
XX
OS   Streptococcus pyogenes MGAS8232
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-1895017
RX   DOI; 10.1073/pnas.062526099.
RX   PUBMED; 11917108.
RA   Smoot J.C., Barbian K.D., Van Gompel J.J., Smoot L.M., Chaussee M.S.,
RA   Sylva G.L., Sturdevant D.E., Ricklefs S.M., Porcella S.F., Parkins L.D.,
RA   Beres S.B., Campbell D.S., Smith T.M., Zhang Q., Kapur V., Daly J.A.,
RA   Veasy L.G., Musser J.M.;
RT   "Genome sequence and comparative microarray analysis of serotype M18 group
RT   A Streptococcus strains associated with acute rheumatic fever outbreaks";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(7):4668-4673(2002).
XX
RN   [2]
RP   1-1895017
RA   Smoot J.C., Barbian K.D., Van Gompel J.J., Smoot L.M., Chaussee M.S.,
RA   Sylva G.L., Sturdevant D.E., Ricklefs S.M., Porcella S.F., Parkins L.D.,
RA   Beres S.B., Campbell D.S., Smith T.M., Zhang Q., Kapur V., Daly J.A.,
RA   Veasy L.G., Musser J.M.;
RT   ;
RL   Submitted (31-JAN-2002) to the INSDC.
RL   Laboratory of Human Bacterial Pathogenesis/Rocky Mountain
RL   Laboratories/NIAID/NIH, 903 S. 4th St., Hamilton, MT 59840, USA
XX
DR   MD5; 2236636d508a85f46b16f12be122bb61.
DR   BioSample; SAMN02603495.
DR   EnsemblGenomes-Gn; EBG00001168153.
DR   EnsemblGenomes-Gn; EBG00001168154.
DR   EnsemblGenomes-Gn; EBG00001168155.
DR   EnsemblGenomes-Gn; EBG00001168156.
DR   EnsemblGenomes-Gn; EBG00001168157.
DR   EnsemblGenomes-Gn; EBG00001168158.
DR   EnsemblGenomes-Gn; EBG00001168159.
DR   EnsemblGenomes-Gn; EBG00001168160.
DR   EnsemblGenomes-Gn; EBG00001168161.
DR   EnsemblGenomes-Gn; EBG00001168162.
DR   EnsemblGenomes-Gn; EBG00001168163.
DR   EnsemblGenomes-Gn; EBG00001168164.
DR   EnsemblGenomes-Gn; EBG00001168165.
DR   EnsemblGenomes-Gn; EBG00001168166.
DR   EnsemblGenomes-Gn; EBG00001168167.
DR   EnsemblGenomes-Gn; EBG00001168168.
DR   EnsemblGenomes-Gn; EBG00001168169.
DR   EnsemblGenomes-Gn; EBG00001168170.
DR   EnsemblGenomes-Gn; EBG00001168171.
DR   EnsemblGenomes-Gn; EBG00001168172.
DR   EnsemblGenomes-Gn; EBG00001168173.
DR   EnsemblGenomes-Gn; EBG00001168174.
DR   EnsemblGenomes-Gn; EBG00001168175.
DR   EnsemblGenomes-Gn; EBG00001168176.
DR   EnsemblGenomes-Gn; EBG00001168177.
DR   EnsemblGenomes-Gn; EBG00001168178.
DR   EnsemblGenomes-Gn; EBG00001168179.
DR   EnsemblGenomes-Gn; EBG00001168180.
DR   EnsemblGenomes-Gn; EBG00001168181.
DR   EnsemblGenomes-Gn; EBG00001168182.
DR   EnsemblGenomes-Gn; EBG00001168183.
DR   EnsemblGenomes-Gn; EBG00001168184.
DR   EnsemblGenomes-Gn; EBG00001168185.
DR   EnsemblGenomes-Gn; EBG00001168186.
DR   EnsemblGenomes-Gn; EBG00001168187.
DR   EnsemblGenomes-Gn; EBG00001168188.
DR   EnsemblGenomes-Gn; EBG00001168189.
DR   EnsemblGenomes-Gn; EBG00001168190.
DR   EnsemblGenomes-Gn; EBG00001168191.
DR   EnsemblGenomes-Gn; EBG00001168192.
DR   EnsemblGenomes-Gn; EBG00001168193.
DR   EnsemblGenomes-Gn; EBG00001168194.
DR   EnsemblGenomes-Gn; EBG00001168195.
DR   EnsemblGenomes-Gn; EBG00001168196.
DR   EnsemblGenomes-Gn; EBG00001168197.
DR   EnsemblGenomes-Gn; EBG00001168198.
DR   EnsemblGenomes-Gn; EBG00001168199.
DR   EnsemblGenomes-Gn; EBG00001168200.
DR   EnsemblGenomes-Gn; EBG00001168201.
DR   EnsemblGenomes-Gn; EBG00001168202.
DR   EnsemblGenomes-Gn; EBG00001168203.
DR   EnsemblGenomes-Gn; EBG00001168204.
DR   EnsemblGenomes-Gn; EBG00001168205.
DR   EnsemblGenomes-Gn; EBG00001168206.
DR   EnsemblGenomes-Gn; EBG00001168207.
DR   EnsemblGenomes-Gn; EBG00001168208.
DR   EnsemblGenomes-Gn; EBG00001168209.
DR   EnsemblGenomes-Gn; EBG00001168210.
DR   EnsemblGenomes-Gn; EBG00001168211.
DR   EnsemblGenomes-Gn; EBG00001168212.
DR   EnsemblGenomes-Gn; EBG00001168213.
DR   EnsemblGenomes-Gn; EBG00001168214.
DR   EnsemblGenomes-Gn; EBG00001168215.
DR   EnsemblGenomes-Gn; EBG00001168216.
DR   EnsemblGenomes-Gn; EBG00001168217.
DR   EnsemblGenomes-Gn; EBG00001168218.
DR   EnsemblGenomes-Gn; EBG00001168219.
DR   EnsemblGenomes-Gn; EBG00001168220.
DR   EnsemblGenomes-Gn; EBG00001168221.
DR   EnsemblGenomes-Gn; EBG00001168222.
DR   EnsemblGenomes-Gn; EBG00001168223.
DR   EnsemblGenomes-Gn; EBG00001168224.
DR   EnsemblGenomes-Gn; EBG00001168225.
DR   EnsemblGenomes-Gn; EBG00001168226.
DR   EnsemblGenomes-Gn; EBG00001168227.
DR   EnsemblGenomes-Gn; EBG00001168228.
DR   EnsemblGenomes-Gn; EBG00001168229.
DR   EnsemblGenomes-Gn; EBG00001168230.
DR   EnsemblGenomes-Gn; EBG00001168231.
DR   EnsemblGenomes-Gn; EBG00001168232.
DR   EnsemblGenomes-Gn; EBG00001168233.
DR   EnsemblGenomes-Gn; EBG00001168234.
DR   EnsemblGenomes-Gn; EBG00001168235.
DR   EnsemblGenomes-Gn; EBG00001168236.
DR   EnsemblGenomes-Gn; EBG00001168237.
DR   EnsemblGenomes-Gn; EBG00001168238.
DR   EnsemblGenomes-Gn; EBG00001168239.
DR   EnsemblGenomes-Gn; EBG00001168240.
DR   EnsemblGenomes-Gn; EBG00001168241.
DR   EnsemblGenomes-Gn; EBG00001168242.
DR   EnsemblGenomes-Gn; EBG00001168243.
DR   EnsemblGenomes-Gn; EBG00001168244.
DR   EnsemblGenomes-Gn; EBG00001168245.
DR   EnsemblGenomes-Gn; EBG00001168246.
DR   EnsemblGenomes-Gn; EBG00001168247.
DR   EnsemblGenomes-Gn; EBG00001168248.
DR   EnsemblGenomes-Gn; EBG00001168249.
DR   EnsemblGenomes-Gn; EBG00001168250.
DR   EnsemblGenomes-Gn; EBG00001168251.
DR   EnsemblGenomes-Gn; EBG00001168252.
DR   EnsemblGenomes-Gn; EBG00001168253.
DR   EnsemblGenomes-Gn; EBG00001168254.
DR   EnsemblGenomes-Gn; EBG00001168255.
DR   EnsemblGenomes-Gn; EBG00001168256.
DR   EnsemblGenomes-Gn; EBG00001168257.
DR   EnsemblGenomes-Gn; EBG00001168258.
DR   EnsemblGenomes-Gn; EBG00001168259.
DR   EnsemblGenomes-Gn; EBG00001168260.
DR   EnsemblGenomes-Gn; EBG00001168261.
DR   EnsemblGenomes-Gn; spyM18_r01.
DR   EnsemblGenomes-Gn; spyM18_r02.
DR   EnsemblGenomes-Gn; spyM18_r03.
DR   EnsemblGenomes-Gn; spyM18_r04.
DR   EnsemblGenomes-Gn; spyM18_r05.
DR   EnsemblGenomes-Gn; spyM18_r06.
DR   EnsemblGenomes-Gn; spyM18_r07.
DR   EnsemblGenomes-Gn; spyM18_r08.
DR   EnsemblGenomes-Gn; spyM18_r09.
DR   EnsemblGenomes-Gn; spyM18_r10.
DR   EnsemblGenomes-Gn; spyM18_r11.
DR   EnsemblGenomes-Gn; spyM18_r12.
DR   EnsemblGenomes-Tr; EBT00001734758.
DR   EnsemblGenomes-Tr; EBT00001734759.
DR   EnsemblGenomes-Tr; EBT00001734760.
DR   EnsemblGenomes-Tr; EBT00001734761.
DR   EnsemblGenomes-Tr; EBT00001734762.
DR   EnsemblGenomes-Tr; EBT00001734763.
DR   EnsemblGenomes-Tr; EBT00001734764.
DR   EnsemblGenomes-Tr; EBT00001734765.
DR   EnsemblGenomes-Tr; EBT00001734766.
DR   EnsemblGenomes-Tr; EBT00001734767.
DR   EnsemblGenomes-Tr; EBT00001734768.
DR   EnsemblGenomes-Tr; EBT00001734769.
DR   EnsemblGenomes-Tr; EBT00001734770.
DR   EnsemblGenomes-Tr; EBT00001734771.
DR   EnsemblGenomes-Tr; EBT00001734772.
DR   EnsemblGenomes-Tr; EBT00001734773.
DR   EnsemblGenomes-Tr; EBT00001734774.
DR   EnsemblGenomes-Tr; EBT00001734775.
DR   EnsemblGenomes-Tr; EBT00001734776.
DR   EnsemblGenomes-Tr; EBT00001734777.
DR   EnsemblGenomes-Tr; EBT00001734778.
DR   EnsemblGenomes-Tr; EBT00001734779.
DR   EnsemblGenomes-Tr; EBT00001734780.
DR   EnsemblGenomes-Tr; EBT00001734781.
DR   EnsemblGenomes-Tr; EBT00001734782.
DR   EnsemblGenomes-Tr; EBT00001734783.
DR   EnsemblGenomes-Tr; EBT00001734784.
DR   EnsemblGenomes-Tr; EBT00001734785.
DR   EnsemblGenomes-Tr; EBT00001734786.
DR   EnsemblGenomes-Tr; EBT00001734787.
DR   EnsemblGenomes-Tr; EBT00001734788.
DR   EnsemblGenomes-Tr; EBT00001734789.
DR   EnsemblGenomes-Tr; EBT00001734790.
DR   EnsemblGenomes-Tr; EBT00001734791.
DR   EnsemblGenomes-Tr; EBT00001734792.
DR   EnsemblGenomes-Tr; EBT00001734793.
DR   EnsemblGenomes-Tr; EBT00001734794.
DR   EnsemblGenomes-Tr; EBT00001734795.
DR   EnsemblGenomes-Tr; EBT00001734796.
DR   EnsemblGenomes-Tr; EBT00001734797.
DR   EnsemblGenomes-Tr; EBT00001734798.
DR   EnsemblGenomes-Tr; EBT00001734799.
DR   EnsemblGenomes-Tr; EBT00001734800.
DR   EnsemblGenomes-Tr; EBT00001734801.
DR   EnsemblGenomes-Tr; EBT00001734802.
DR   EnsemblGenomes-Tr; EBT00001734803.
DR   EnsemblGenomes-Tr; EBT00001734804.
DR   EnsemblGenomes-Tr; EBT00001734805.
DR   EnsemblGenomes-Tr; EBT00001734806.
DR   EnsemblGenomes-Tr; EBT00001734807.
DR   EnsemblGenomes-Tr; EBT00001734808.
DR   EnsemblGenomes-Tr; EBT00001734809.
DR   EnsemblGenomes-Tr; EBT00001734810.
DR   EnsemblGenomes-Tr; EBT00001734811.
DR   EnsemblGenomes-Tr; EBT00001734812.
DR   EnsemblGenomes-Tr; EBT00001734813.
DR   EnsemblGenomes-Tr; EBT00001734814.
DR   EnsemblGenomes-Tr; EBT00001734815.
DR   EnsemblGenomes-Tr; EBT00001734816.
DR   EnsemblGenomes-Tr; EBT00001734817.
DR   EnsemblGenomes-Tr; EBT00001734818.
DR   EnsemblGenomes-Tr; EBT00001734819.
DR   EnsemblGenomes-Tr; EBT00001734820.
DR   EnsemblGenomes-Tr; EBT00001734821.
DR   EnsemblGenomes-Tr; EBT00001734822.
DR   EnsemblGenomes-Tr; EBT00001734823.
DR   EnsemblGenomes-Tr; EBT00001734824.
DR   EnsemblGenomes-Tr; EBT00001734825.
DR   EnsemblGenomes-Tr; EBT00001734826.
DR   EnsemblGenomes-Tr; EBT00001734827.
DR   EnsemblGenomes-Tr; EBT00001734828.
DR   EnsemblGenomes-Tr; EBT00001734829.
DR   EnsemblGenomes-Tr; EBT00001734830.
DR   EnsemblGenomes-Tr; EBT00001734831.
DR   EnsemblGenomes-Tr; EBT00001734832.
DR   EnsemblGenomes-Tr; EBT00001734833.
DR   EnsemblGenomes-Tr; EBT00001734834.
DR   EnsemblGenomes-Tr; EBT00001734835.
DR   EnsemblGenomes-Tr; EBT00001734836.
DR   EnsemblGenomes-Tr; EBT00001734837.
DR   EnsemblGenomes-Tr; EBT00001734838.
DR   EnsemblGenomes-Tr; EBT00001734839.
DR   EnsemblGenomes-Tr; EBT00001734840.
DR   EnsemblGenomes-Tr; EBT00001734841.
DR   EnsemblGenomes-Tr; EBT00001734842.
DR   EnsemblGenomes-Tr; EBT00001734843.
DR   EnsemblGenomes-Tr; EBT00001734844.
DR   EnsemblGenomes-Tr; EBT00001734845.
DR   EnsemblGenomes-Tr; EBT00001734846.
DR   EnsemblGenomes-Tr; EBT00001734847.
DR   EnsemblGenomes-Tr; EBT00001734848.
DR   EnsemblGenomes-Tr; EBT00001734849.
DR   EnsemblGenomes-Tr; EBT00001734850.
DR   EnsemblGenomes-Tr; EBT00001734851.
DR   EnsemblGenomes-Tr; EBT00001734852.
DR   EnsemblGenomes-Tr; EBT00001734853.
DR   EnsemblGenomes-Tr; EBT00001734854.
DR   EnsemblGenomes-Tr; EBT00001734855.
DR   EnsemblGenomes-Tr; EBT00001734856.
DR   EnsemblGenomes-Tr; EBT00001734857.
DR   EnsemblGenomes-Tr; EBT00001734858.
DR   EnsemblGenomes-Tr; EBT00001734859.
DR   EnsemblGenomes-Tr; EBT00001734860.
DR   EnsemblGenomes-Tr; EBT00001734861.
DR   EnsemblGenomes-Tr; EBT00001734862.
DR   EnsemblGenomes-Tr; EBT00001734863.
DR   EnsemblGenomes-Tr; EBT00001734864.
DR   EnsemblGenomes-Tr; EBT00001734865.
DR   EnsemblGenomes-Tr; EBT00001734866.
DR   EnsemblGenomes-Tr; spyM18_r01-1.
DR   EnsemblGenomes-Tr; spyM18_r02-1.
DR   EnsemblGenomes-Tr; spyM18_r03-1.
DR   EnsemblGenomes-Tr; spyM18_r04-1.
DR   EnsemblGenomes-Tr; spyM18_r05-1.
DR   EnsemblGenomes-Tr; spyM18_r06-1.
DR   EnsemblGenomes-Tr; spyM18_r07-1.
DR   EnsemblGenomes-Tr; spyM18_r08-1.
DR   EnsemblGenomes-Tr; spyM18_r09-1.
DR   EnsemblGenomes-Tr; spyM18_r10-1.
DR   EnsemblGenomes-Tr; spyM18_r11-1.
DR   EnsemblGenomes-Tr; spyM18_r12-1.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC123705; 11917108.
DR   EuropePMC; PMC1253647; 16223875.
DR   EuropePMC; PMC1392966; 16461700.
DR   EuropePMC; PMC1459018; 16636287.
DR   EuropePMC; PMC1797367; 17028269.
DR   EuropePMC; PMC1855836; 17277061.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3411356; 21115137.
DR   EuropePMC; PMC4518830; 26013489.
DR   EuropePMC; PMC6374595; 30760615.
DR   GOA; P0C097.
DR   GOA; P0C098.
DR   InterPro; IPR000119; Hist_DNA-bd.
DR   InterPro; IPR000206; Ribosomal_L7/12.
DR   InterPro; IPR008932; Ribosomal_L7/L12_oligo.
DR   InterPro; IPR010992; IHF-like_DNA-bd_dom_sf.
DR   InterPro; IPR013823; Ribosomal_L7/L12_C.
DR   InterPro; IPR014719; Ribosomal_L7/12_C/ClpS-like.
DR   InterPro; IPR020816; Histone-like_DNA-bd_CS.
DR   InterPro; IPR036235; Ribosomal_L7/L12_oligo_N_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; AE009949.
DR   SILVA-SSU; AE009949.
DR   StrainInfo; 494010; 0.
DR   UniProtKB/Swiss-Prot; P0C097; DBH_STRP8.
DR   UniProtKB/Swiss-Prot; P0C098; RL7_STRP8.
XX
CC   On or before Oct 24, 2008 this sequence version replaced
CC   gi:19747290, gi:19747302, gi:19747304, gi:19747310, gi:19747318,
CC   gi:19747330, gi:19747346, gi:19747364, gi:19747372, gi:19747376,
CC   gi:19747394, gi:19747406, gi:19747417, gi:19747429, gi:19747440,
CC   gi:19747450, gi:19747460, gi:19747470, gi:19747481, gi:19747492,
CC   gi:19747508, gi:19747519, gi:19747529, gi:19747537, gi:19747546,
CC   gi:19747558, gi:19747569, gi:19747586, gi:19747611, gi:19747622,
CC   gi:19747636, gi:19747652, gi:19747664, gi:19747680, gi:19747685,
CC   gi:19747697, gi:19747710, gi:19747722, gi:19747729, gi:19747740,
CC   gi:19747752, gi:19747764, gi:19747776, gi:19747786, gi:19747798,
CC   gi:19747816, gi:19747826, gi:19747840, gi:19747852, gi:19747861,
CC   gi:19747873, gi:19747884, gi:19747893, gi:19747920, gi:19747926,
CC   gi:19747945, gi:19747957, gi:19747968, gi:19747975, gi:19747985,
CC   gi:19747997, gi:19748009, gi:19748017, gi:19748027, gi:19748041,
CC   gi:19748052, gi:19748066, gi:19748075, gi:19748086, gi:19748097,
CC   gi:19748108, gi:19748120, gi:19748133, gi:19748142, gi:19748154,
CC   gi:19748165, gi:19748176, gi:19748183, gi:19748194, gi:19748205,
CC   gi:19748215, gi:19748228, gi:19748240, gi:19748253, gi:19748269,
CC   gi:19748280, gi:19748292, gi:19748305, gi:19748314, gi:19748324,
CC   gi:19748336, gi:19748347, gi:19748361, gi:19748376, gi:19748385,
CC   gi:19748394, gi:19748408, gi:19748426, gi:19748443, gi:19748463,
CC   gi:19748473, gi:19748484, gi:19748494, gi:19748506, gi:19748518,
CC   gi:19748527, gi:19748540, gi:19748551, gi:19748561, gi:19748573,
CC   gi:19748582, gi:19748591, gi:19748614, gi:19748639, gi:19748657,
CC   gi:19748667, gi:19748679, gi:19748693, gi:19748705, gi:19748717,
CC   gi:19748731, gi:19748741, gi:19748750, gi:19748761, gi:19748770,
CC   gi:19748781, gi:19748791, gi:19748805, gi:19748813, gi:19748823,
CC   gi:19748839, gi:19748851, gi:19748869, gi:19748883, gi:19748901,
CC   gi:19748917, gi:19748933, gi:19748945, gi:19748956, gi:19748961,
CC   gi:19748970, gi:19748976, gi:19748984, gi:19748997, gi:19749008,
CC   gi:19749017, gi:19749031, gi:19749043, gi:19749053, gi:19749061,
CC   gi:19749067, gi:19749081, gi:19749097, gi:19749111, gi:19749118,
CC   gi:19749126, gi:19749134, gi:19749144, gi:19749156, gi:19749164,
CC   gi:19749176, gi:19749187, gi:19749196, gi:19749206, gi:19749216,
CC   gi:19749225, gi:19749238, gi:19749248, gi:19749260, gi:19749272,
CC   gi:19749282, gi:19749293, gi:19749303.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1895017
FT                   /organism="Streptococcus pyogenes MGAS8232"
FT                   /strain="MGAS8232"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:186103"
FT   gene            202..1557
FT                   /gene="dnaA"
FT                   /locus_tag="spyM18_0001"
FT   CDS_pept        202..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="spyM18_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="best blastp match sp|Q9L572|DNAA_STRPY CHROMOSOMAL
FT                   REPLICATION INITIATOR PROTEIN DNAA"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96837"
FT                   /db_xref="GOA:P0A3A6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3A6"
FT                   /protein_id="AAL96837.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   gene            1709..2845
FT                   /gene="dnaN"
FT                   /locus_tag="spyM18_0002"
FT   CDS_pept        1709..2845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="spyM18_0002"
FT                   /product="beta subunit of DNA polymerase III"
FT                   /note="best blastp match gb|AAK33147.1| (AE006472) beta
FT                   subunit of DNA polymerase III [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96838"
FT                   /protein_id="AAL96838.1"
FT                   /translation="MIQFSINRTLFIHALNATKRAISTKNAIPILSSIKIKVTPTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   gene            3447..4562
FT                   /locus_tag="spyM18_0004"
FT   CDS_pept        3447..4562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0004"
FT                   /product="putative GTP-binding protein"
FT                   /note="best blastp match gb|AAK33149.1| (AE006472) putative
FT                   GTP-binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96839"
FT                   /protein_id="AAL96839.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEEEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMIYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   gene            4632..5201
FT                   /gene="pth"
FT                   /locus_tag="spyM18_0005"
FT   CDS_pept        4632..5201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="spyM18_0005"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /note="best blastp match gb|AAK33150.1| (AE006472) putative
FT                   peptidyl-tRNA hydrolase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96840"
FT                   /db_xref="GOA:Q8P327"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P327"
FT                   /protein_id="AAL96840.1"
FT                   /translation="MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFK
FT                   AQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRL
FT                   RSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLT
FT                   LDRVVNAVKFYLQENDFEKTMQKFNG"
FT   gene            5204..8707
FT                   /gene="trcF"
FT                   /locus_tag="spyM18_0007"
FT   CDS_pept        5204..8707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="spyM18_0007"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="best blastp match gb|AAK33151.1| (AE006472) putative
FT                   transcription-repair coupling factor [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96841"
FT                   /protein_id="AAL96841.1"
FT                   /translation="MDILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKALAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSSLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFHPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDNKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADDKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQIGSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVVVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVRKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQVFYVYNKVDTIDKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYISDERQKIDIYKRIREIQSREDYLN
FT                   LQDELMDRFGEYPDQVAYLLEIALLKHYMDNTFAELVERKNNQVIVRFEVTSLSYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYRILEELMLFGERLSEIKIRKKNSVF
FT                   K"
FT   gene            8869..9141
FT                   /locus_tag="spyM18_0008"
FT   CDS_pept        8869..9141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33152.1| (AE006472)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96842"
FT                   /protein_id="AAL96842.1"
FT                   /translation="MRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKSSTNVKLND
FT                   HIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   gene            9128..9499
FT                   /gene="divIC"
FT                   /locus_tag="spyM18_0009"
FT   CDS_pept        9128..9499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="spyM18_0009"
FT                   /product="putative cell division protein"
FT                   /note="best blastp match gb|AAK33153.1| (AE006472) putative
FT                   cell division protein (DivIC) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96843"
FT                   /protein_id="AAL96843.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKSTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   gene            9634..10920
FT                   /locus_tag="spyM18_0011"
FT   CDS_pept        9634..10920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0011"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33154.1| (AE006472)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96844"
FT                   /protein_id="AAL96844.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLLIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSFSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   gene            10917..12203
FT                   /gene="mesJ"
FT                   /locus_tag="spyM18_0012"
FT   CDS_pept        10917..12203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="spyM18_0012"
FT                   /product="putative cell-cycle protein"
FT                   /note="best blastp match gb|AAK33155.1| (AE006472) putative
FT                   cell-cycle protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96845"
FT                   /db_xref="GOA:Q8P322"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P322"
FT                   /protein_id="AAL96845.1"
FT                   /translation="MMTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKDEKMLEYDSNLCYRDYYFSFMPKSNEDQGQV
FT                   NIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIVGEQDGEIIFV
FT                   LVGDKTYLRKACKHDIMLAKLYIDKLEKG"
FT   gene            12208..12750
FT                   /gene="hpt"
FT                   /locus_tag="spyM18_0013"
FT   CDS_pept        12208..12750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="spyM18_0013"
FT                   /product="putative hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /note="best blastp match sp|Q02522|HPRT_LACLA
FT                   HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE (HGPRT)
FT                   (HGPRTASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96846"
FT                   /db_xref="GOA:Q7CNQ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNQ9"
FT                   /protein_id="AAL96846.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   gene            12772..14751
FT                   /gene="ftsH"
FT                   /locus_tag="spyM18_0014"
FT   CDS_pept        12772..14751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="spyM18_0014"
FT                   /product="putative cell division protein"
FT                   /note="best blastp match gb|AAK33156.1| (AE006473) putative
FT                   cell division protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96847"
FT                   /protein_id="AAL96847.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   gene            15077..16468
FT                   /locus_tag="spyM18_0015"
FT   CDS_pept        15077..16468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0015"
FT                   /product="putative amino acid permease"
FT                   /note="best blastp match gb|AAK33157.1| (AE006473) putative
FT                   amino acid permease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96848"
FT                   /protein_id="AAL96848.1"
FT                   /translation="MTIFRKKKKYSNKTEMQRHFKVIDLIFLGLGSMVGTGIFTVTGIG
FT                   AAKYAGPALTISIIISAIAIGILALFYAEFASRMPSNGGAYSYVYATLGEFPAWLVGWY
FT                   IIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALNGTFNLKNGTYIDILPVLVMFFVT
FT                   GIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFIDHNNWSHFAPYGVGQITGGKTGI
FT                   FAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGIILSLIIVTALYIVVTTILTGIVHY
FT                   TKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITVCISMTYALARTIYSISRDGLLPK
FT                   SLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLAEFVNICTLAYLIILSGAIIKLRR
FT                   IEGEPKANEFKTPLVPFLPILAIIICLSFMSQYKAFTWIAFAIATIIGTLIYLAYGYTH
FT                   SIENK"
FT   gene            17138..18472
FT                   /locus_tag="spyM18_r01"
FT   rRNA            17138..18472
FT                   /locus_tag="spyM18_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            19005..21905
FT                   /locus_tag="spyM18_r02"
FT   rRNA            19005..21905
FT                   /locus_tag="spyM18_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            23139..24473
FT                   /locus_tag="spyM18_r03"
FT   rRNA            23139..24473
FT                   /locus_tag="spyM18_r03"
FT                   /product="16S ribosomal RNA"
FT   gene            25006..27906
FT                   /locus_tag="spyM18_r04"
FT   rRNA            25006..27906
FT                   /locus_tag="spyM18_r04"
FT                   /product="23S ribosomal RNA"
FT   gene            31158..32354
FT                   /locus_tag="spyM18_0020"
FT   CDS_pept        31158..32354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0020"
FT                   /product="putative secreted protein"
FT                   /note="best blastp match gb|AAK33158.1| (AE006474) putative
FT                   secreted protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96849"
FT                   /protein_id="AAL96849.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLEAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   AAPSARPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQWAYSAQAAGYRTGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADHRGWFNPTGVTFIYPH"
FT   gene            32607..33569
FT                   /gene="prsA"
FT                   /locus_tag="spyM18_0021"
FT   CDS_pept        32607..33569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="spyM18_0021"
FT                   /product="putative ribose-phosphate pyrophosphokinase"
FT                   /note="best blastp match gb|AAK33159.1| (AE006474) putative
FT                   ribose-phosphate pyrophosphokinase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96850"
FT                   /db_xref="GOA:P65245"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65245"
FT                   /protein_id="AAL96850.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLV
FT                   GEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLDTIYL
FT                   PKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   gene            33755..34510
FT                   /locus_tag="spyM18_0022"
FT   CDS_pept        33755..34510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33160.1| (AE006475)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96851"
FT                   /db_xref="GOA:P65989"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65989"
FT                   /protein_id="AAL96851.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   gene            34608..35615
FT                   /locus_tag="spyM18_0023"
FT   CDS_pept        34608..35615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0023"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="best blastp match gb|AAK33161.1| (AE006475) putative
FT                   fatty acid/phospholipid synthesis protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96852"
FT                   /db_xref="GOA:Q8P317"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P317"
FT                   /protein_id="AAL96852.1"
FT                   /translation="MKRIAIDAMGGDNAPKAIVEGVNQAIEAFSDIEIQLYGDQTKINS
FT                   YLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKASMVLAAKAVKEGKADAIISAGNTGVL
FT                   LAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDMLDLGANAENTAKHLHQYAILGSFYAK
FT                   NVRGIANPRVGLLNNGTEETKGDPLRKATYELLTADNTISFVGNVEARELMSGVADVIV
FT                   SDGFTGNAVLKSIEGTAISIMGQLKQIINSGGIKTKIGASLLKSSLYEMKKTLDYSSAG
FT                   GAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTMLDTNVVGQLVEEFAKETQVND"
FT   gene            35608..35850
FT                   /gene="acp"
FT                   /locus_tag="spyM18_0024"
FT   CDS_pept        35608..35850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="spyM18_0024"
FT                   /product="putative acyl carrier protein"
FT                   /note="best blastp match gb|AAK33162.1| (AE006475) putative
FT                   acyl carrier protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96853"
FT                   /protein_id="AAL96853.1"
FT                   /translation="MTRQEIFDRLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDVEDMVFMGDVLDYLVQRLT"
FT   gene            35971..36705
FT                   /gene="purC"
FT                   /locus_tag="spyM18_0025"
FT   CDS_pept        35971..36705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="spyM18_0025"
FT                   /product="putative
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /note="best blastp match gb|AAK33163.1| (AE006475) putative
FT                   phosphoribosylaminoimidazole - succinocarboxamide synthase
FT                   (SAICAR synthetase) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96854"
FT                   /db_xref="GOA:Q8P315"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P315"
FT                   /protein_id="AAL96854.1"
FT                   /translation="MKTERKANNQVTNQLIYKGKAKDIYSTKDENVIRTVYKDQATMLN
FT                   GARKETIDGKGALNNQISSLIFEKLNKAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRN
FT                   VTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHVKFLGIVNDEEIAYLKGE
FT                   TRRINELLKGWFAQIGLNLIDFKLEFGFDQEGTIILADEFSPDNCRLWDKNGNHMDKDV
FT                   FRRDLGNLTDVYQVVLEKLIAL"
FT   gene            36781..40554
FT                   /gene="purL"
FT                   /locus_tag="spyM18_0026"
FT   CDS_pept        36781..40554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="spyM18_0026"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase II"
FT                   /note="best blastp match gb|AAK33164.1| (AE006475) putative
FT                   phosphoribosylformylglycinamidine synthase II
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96855"
FT                   /protein_id="AAL96855.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKDLRIVQVYDVFNLAEDLLARAEKHIFSEQVTDRLLTEAEITAELDKVAFFAIEA
FT                   LPGQFDQRAASSQEALLLFGSDSQVKVNTAELYLVNKDIAEAELEAVKNYLLNPVDSRF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFENYKADDFAAYKAEQGLAMEVDDLLFIQDYFKSI
FT                   GRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRAGKLPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDGEVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPSD
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNGETIVDLERRFLDTNGVRVVIDAKVVD
FT                   KDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTRTVSVMAQGYNPYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEGLTVPPT
FT                   LVAFGVTTADSRKILSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFEAIQAQHKI
FT                   TAASAAKYGGVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKFEEVYPTEFEQADALEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEIAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGGLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANANSPWLAGVEVGDIHAIPVSHGEG
FT                   KFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   gene            40715..42169
FT                   /gene="purF"
FT                   /locus_tag="spyM18_0027"
FT   CDS_pept        40715..42169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="spyM18_0027"
FT                   /product="putative phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /note="best blastp match gb|AAK33165.1| (AE006475) putative
FT                   phosphoribosylpyrophosphate amidotransferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96856"
FT                   /protein_id="AAL96856.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNSNFMGKVKEALN
FT                   TVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDSGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQE
FT                   FKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   gene            42197..43219
FT                   /gene="purM"
FT                   /locus_tag="spyM18_0028"
FT   CDS_pept        42197..43219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="spyM18_0028"
FT                   /product="putative phosphoribosylformylglycinamide
FT                   cyclo-ligase"
FT                   /note="best blastp match gb|AAK33166.1| (AE006475) putative
FT                   phosphoribosylformylglycinamide cyclo-ligase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96857"
FT                   /db_xref="GOA:Q8P312"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P312"
FT                   /protein_id="AAL96857.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGVLGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNNPVKLEEVVSGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKQLKDVLL
FT                   EPTRIYVKAALPLIKEELVNGIGHITGGGFIENIPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKELLDEPVYEIGRIIKKADDSVVIK
FT                   "
FT   gene            43387..43941
FT                   /gene="purN"
FT                   /locus_tag="spyM18_0029"
FT   CDS_pept        43387..43941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="spyM18_0029"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /note="best blastp match gb|AAK33167.1| (AE006475)
FT                   Phosphoribosylglycinamide formyltransferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96858"
FT                   /protein_id="AAL96858.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   gene            44125..45672
FT                   /gene="purH"
FT                   /locus_tag="spyM18_0030"
FT   CDS_pept        44125..45672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="spyM18_0030"
FT                   /product="putative phosphoribosyl carboxyamide
FT                   aminoimidazole transformylase"
FT                   /note="best blastp match dbj|BAB20827.1| (AB045609)
FT                   phosphoribosyl carboxyamide aminoimidazole transformylase
FT                   [Streptococcus suis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96859"
FT                   /db_xref="GOA:Q8P310"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P310"
FT                   /protein_id="AAL96859.1"
FT                   /translation="MTKRALISVSDKSGIIDFAKELKNLGWDIISTGGTKVALDNAGVE
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDNNIELIDLVVINLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYATVLGELADAGQT
FT                   TFETRQRLAAKVFRHTAAYDALIAEYFTAQVGEAKPEKLTITYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVIALKHMNPCGI
FT                   GQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAKKMHPIFLEIIIAPSYSEEALA
FT                   ILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPT
FT                   EQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAV
FT                   LASDAFFPFADNIEEVAAAGVKAIIQPGGSVRDQDSIDAANKHGLTMIFTGVRHFRH"
FT   gene            complement(45731..46855)
FT                   /locus_tag="spyM18_0031"
FT   CDS_pept        complement(45731..46855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0031"
FT                   /product="putative choline binding protein"
FT                   /note="best blastp match gb|AAK33168.1| (AE006476) putative
FT                   choline binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96860"
FT                   /protein_id="AAL96860.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYDHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQASFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKVVTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGNQILRVGEYFTVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   gene            47108..48373
FT                   /gene="purD"
FT                   /locus_tag="spyM18_0032"
FT   CDS_pept        47108..48373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="spyM18_0032"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /note="best blastp match gb|AAK33169.1| (AE006476)
FT                   phosphoribosylamine-glycine ligase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96861"
FT                   /db_xref="GOA:Q8P308"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P308"
FT                   /protein_id="AAL96861.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLASKGVDQVFVAPGNDGMTLDGLDLV
FT                   NIVVSEHSRLIAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSK
FT                   DFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVETIVRPVLEGMVAEGRPYLGVLYVGLILTADGPK
FT                   VIEFNLRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQNDGVTLGVVVASEGYPL
FT                   DYEKGVPLPEKTDGDIITYYAGAKFAENSKALLSNGGRVYMLVTTEDSVKAGQDKIYTQ
FT                   LAQQDTTGLFYRNDIGSKAIRE"
FT   gene            48532..49143
FT                   /gene="purE"
FT                   /locus_tag="spyM18_0033"
FT   CDS_pept        48532..49143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="spyM18_0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   I"
FT                   /note="best blastp match gb|AAK33170.1| (AE006476) putative
FT                   phosphoribosylaminoimidazole carboxylase I [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96862"
FT                   /protein_id="AAL96862.1"
FT                   /translation="MLKHLVALTWVHLRNQRFRTYRIFFYGKFRQVETPLYILIMKTPI
FT                   ISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPDLMFKHAEEARGRGIKIIIA
FT                   GAGGAAHLPGMVAAKTTLPVIGVPVKSRALLGLDSLYSIVQMPGGVPVATMAIGEAGAT
FT                   NAALTALRILSIEDQNLADALAHFHEEQGKIAEESSGELI"
FT   gene            49094..50203
FT                   /gene="purK"
FT                   /locus_tag="spyM18_0034"
FT   CDS_pept        49094..50203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="spyM18_0034"
FT                   /product="phosphoribosylaminoimidazole carboxylase II"
FT                   /note="best blastp match gb|AAK33171.1| (AE006476)
FT                   phosphoribosylaminoimidazole carboxylase II [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96863"
FT                   /protein_id="AAL96863.1"
FT                   /translation="MRNKEKSQRSQVVNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITL
FT                   DPASDCPASRVSEVIVAPYDDVEALGQLAARCDVLTYEFENVDADGLDAVVSACQLPQG
FT                   TDLLRISQNRIFEKDFLANKAGVTVAPYKVVTSSLDLEGLDLTKTYVLKTATGGYDGHG
FT                   QKVIRSAEDLPEAQQLANSAQCVLEEFVNFDLEISVIVSGNGEDVTVFPVQENIHCNNI
FT                   LSKTIVPARILDQLADKAKKMAVQIAKKLQLSGTLCVEMFATADDIIVNEIAPRPHNSG
FT                   HYSIEACDFSQFDTHILGVLGAPLPTIHLHAPAVMLNVLGQHVQQAIDYVTENPSAHLH
FT                   MYGKLEAKHNRKMGHVTLFAEDADEVEEF"
FT   gene            50224..51564
FT                   /locus_tag="spyM18_0035"
FT   CDS_pept        50224..51564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0035"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96864"
FT                   /protein_id="AAL96864.1"
FT                   /translation="MELREFKAWLLKNHFEEDELYKESIKCYQVEAYKAAYIFSYLANH
FT                   KFIAKLAIDYSGVPSNFMSKCPDDEVRKSSWQKRVNSLKNEDEWEQTVNEKLIQAWEDD
FT                   NVFKLPFKIKEKYSHMRVLRNNAAHAKDRRISESTVLELWNEIEYIYPYFVINGTIDAW
FT                   MEDLERLVRYSNSSIESQNQLQNKFGDFSTENKTLIVKKIIQKYLVDSEWDETYPDIVM
FT                   NFLLYIFQESNYINQIGKDLTEKEELYLSIGTGIYHFQAEAIDIFSQFEESLSDYTFRY
FT                   FCEEFSDNFWKFIDSMDSEVNKEKLTATSLEILKKNSAILVNAEFNENRFLSDNSLFFK
FT                   SVLDKIKHLYYYTMHHTGQRHHNTNTFDYSKFNSYIPYINYIFYRISSNPGLKEDEKVI
FT                   DFVKRCNNLISSDYSAESWYSERQMQDVIKKINEKYTILEDSGRESD"
FT   gene            51545..51658
FT                   /locus_tag="spyM18_0036"
FT   CDS_pept        51545..51658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0036"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96865"
FT                   /protein_id="AAL96865.1"
FT                   /translation="MEGSRINQIKFGREFRKSNLLILNAKEIKLKNRKEQG"
FT   gene            51933..53225
FT                   /gene="purB"
FT                   /locus_tag="spyM18_0037"
FT   CDS_pept        51933..53225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="spyM18_0037"
FT                   /product="adenylosuccinate lyase"
FT                   /note="best blastp match gb|AAK33173.1| (AE006476)
FT                   adenylosuccinate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96866"
FT                   /protein_id="AAL96866.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQDTRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLEKFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEQYVCYKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFKRLGI"
FT   gene            53359..54270
FT                   /locus_tag="spyM18_0038"
FT   CDS_pept        53359..54270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0038"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33174.1| (AE006476)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96867"
FT                   /protein_id="AAL96867.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLIL
FT                   LELYLAYLDIEGMDGQYSDKIFYDSLLDNLSEQFEQFELDELFIVNKIIIDISSLSLKN
FT                   NRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKQKDIIKAEQSFMKACLFAQ
FT                   MTADQYLENKLIQEWEKDVKSY"
FT   gene            54431..55495
FT                   /gene="ruvB"
FT                   /locus_tag="spyM18_0039"
FT   CDS_pept        54431..55495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="spyM18_0039"
FT                   /product="putative Holliday junction DNA helicase, subunit
FT                   B"
FT                   /note="best blastp match gb|AAK33175.1| (AE006476) putative
FT                   Holliday junction DNA helicase, subunit B [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96868"
FT                   /db_xref="GOA:Q8P302"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P302"
FT                   /protein_id="AAL96868.1"
FT                   /translation="MTGGDYNKSRPLLSFTLCYNSPMARILDNNVMGNEEFSDRTLRPQ
FT                   YLHEYIGQDKVKEQFAIFIEAAKRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQ
FT                   TSGPAVEKAGDLVAILNELEPGDILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAGDT
FT                   SRSIHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYQEKDLTEIVERTATIFEIK
FT                   IDHEAARKLACRSRGTPRIANRLLKRVRDYAQIIGDGIITAQITDRALTMLDVDREGLN
FT                   YIDQKILRTMIEMYQGGPVGLGTLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRVAT
FT                   QKAYRHLGYPYQNT"
FT   gene            55633..56070
FT                   /locus_tag="spyM18_0040"
FT   CDS_pept        55633..56070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0040"
FT                   /product="putative protein-tyrosine phosphatase"
FT                   /note="best blastp match gb|AAK33176.1| (AE006477) putative
FT                   protein-tyrosine phosphatase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96869"
FT                   /protein_id="AAL96869.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGN
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEY"
FT   gene            56093..56494
FT                   /locus_tag="spyM18_0041"
FT   CDS_pept        56093..56494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0041"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33177.1| (AE006477)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96870"
FT                   /protein_id="AAL96870.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRIHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   gene            56491..58266
FT                   /locus_tag="spyM18_0042"
FT   CDS_pept        56491..58266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0042"
FT                   /product="putative acyltransferase"
FT                   /note="best blastp match gb|AAK33178.1| (AE006477) putative
FT                   acyltransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96871"
FT                   /protein_id="AAL96871.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLFWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMSIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSPYYKWIVGGALALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPKGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   gene            58575..61217
FT                   /gene="adhE"
FT                   /locus_tag="spyM18_0043"
FT   CDS_pept        58575..61217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="spyM18_0043"
FT                   /product="putative Adh2"
FT                   /note="best blastp match gb|AAK03537.1| (AE006181) Adh2
FT                   [Pasteurella multocida]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96872"
FT                   /protein_id="AAL96872.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDNFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAEC
FT                   TEVSEKEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   gene            61469..62485
FT                   /gene="adhP"
FT                   /locus_tag="spyM18_0045"
FT   CDS_pept        61469..62485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="spyM18_0045"
FT                   /product="putative alcohol dehydrogenase I"
FT                   /note="best blastp match gb|AAK33179.1| (AE006477) putative
FT                   alcohol dehydrogenase I [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96873"
FT                   /protein_id="AAL96873.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNVGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGVAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPG
FT                   YIQEKIGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVAPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS"
FT   gene            62873..64162
FT                   /locus_tag="spyM18_0048"
FT   CDS_pept        62873..64162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33180.1| (AE006477)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96874"
FT                   /protein_id="AAL96874.1"
FT                   /translation="MIYNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEASVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPPTAGTLVYTAVWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   gene            64361..64669
FT                   /gene="rpsJ"
FT                   /locus_tag="spyM18_0049"
FT   CDS_pept        64361..64669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="spyM18_0049"
FT                   /product="30S ribosomal protein S10"
FT                   /note="best blastp match gb|AAK33181.1| (AE006477) 30S
FT                   ribosomal protein S10 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96875"
FT                   /db_xref="GOA:P66343"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66343"
FT                   /protein_id="AAL96875.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            64917..65543
FT                   /gene="rplC"
FT                   /locus_tag="spyM18_0050"
FT   CDS_pept        64917..65543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="spyM18_0050"
FT                   /product="50S ribosomal protein L3"
FT                   /note="best blastp match gb|AAK33182.1| (AE006477) 50S
FT                   ribosomal protein L3 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96876"
FT                   /db_xref="GOA:P60452"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60452"
FT                   /protein_id="AAL96876.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   gene            65567..66190
FT                   /gene="rplD"
FT                   /locus_tag="spyM18_0051"
FT   CDS_pept        65567..66190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="spyM18_0051"
FT                   /product="50S ribosomal protein L4"
FT                   /note="best blastp match gb|AAK33183.1| (AE006477) 50S
FT                   ribosomal protein L4 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96877"
FT                   /db_xref="GOA:P60831"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60831"
FT                   /protein_id="AAL96877.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   gene            66190..66486
FT                   /gene="rplW"
FT                   /locus_tag="spyM18_0052"
FT   CDS_pept        66190..66486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="spyM18_0052"
FT                   /product="50S ribosomal protein L23"
FT                   /note="best blastp match gb|AAK33184.1| (AE006477) 50S
FT                   ribosomal protein L23 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96878"
FT                   /db_xref="GOA:Q7CNQ1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNQ1"
FT                   /protein_id="AAL96878.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   gene            66504..67337
FT                   /gene="rplB"
FT                   /locus_tag="spyM18_0053"
FT   CDS_pept        66504..67337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="spyM18_0053"
FT                   /product="50S ribosomal protein L2"
FT                   /note="best blastp match gb|AAK33185.1| (AE006477) 50S
FT                   ribosomal protein L2 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96879"
FT                   /db_xref="GOA:P60435"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60435"
FT                   /protein_id="AAL96879.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            67476..67754
FT                   /gene="rpsS"
FT                   /locus_tag="spyM18_0054"
FT   CDS_pept        67476..67754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="spyM18_0054"
FT                   /product="30S ribosomal protein S19"
FT                   /note="best blastp match gb|AAK33186.1| (AE006478) 30S
FT                   ribosomal protein S19 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96880"
FT                   /db_xref="GOA:P66498"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66498"
FT                   /protein_id="AAL96880.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   gene            67770..68114
FT                   /gene="rplV"
FT                   /locus_tag="spyM18_0056"
FT   CDS_pept        67770..68114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="spyM18_0056"
FT                   /product="50S ribosomal protein L22"
FT                   /note="best blastp match gb|AAK33187.1| (AE006478) 50S
FT                   ribosomal protein L22 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96881"
FT                   /db_xref="GOA:Q7CNQ0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNQ0"
FT                   /protein_id="AAL96881.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   gene            68127..68780
FT                   /gene="rpsC"
FT                   /locus_tag="spyM18_0057"
FT   CDS_pept        68127..68780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="spyM18_0057"
FT                   /product="30S ribosomal protein S3"
FT                   /note="best blastp match gb|AAK33188.1| (AE006478) 30S
FT                   ribosomal protein S3 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96882"
FT                   /db_xref="GOA:P66557"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66557"
FT                   /protein_id="AAL96882.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            68784..69197
FT                   /gene="rplP"
FT                   /locus_tag="spyM18_0058"
FT   CDS_pept        68784..69197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="spyM18_0058"
FT                   /product="50S ribosomal protein L16"
FT                   /note="best blastp match gb|AAK33189.1| (AE006478) 50S
FT                   ribosomal protein L16 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96883"
FT                   /db_xref="GOA:Q7CNP9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP9"
FT                   /protein_id="AAL96883.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            69207..69413
FT                   /gene="rpmC"
FT                   /locus_tag="spyM18_0060"
FT   CDS_pept        69207..69413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="spyM18_0060"
FT                   /product="50S ribosomal protein L29"
FT                   /note="best blastp match gb|AAK33190.1| (AE006478) 50S
FT                   ribosomal protein L29 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96884"
FT                   /db_xref="GOA:P66178"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66178"
FT                   /protein_id="AAL96884.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   gene            69439..69699
FT                   /gene="rpsQ"
FT                   /locus_tag="spyM18_0061"
FT   CDS_pept        69439..69699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="spyM18_0061"
FT                   /product="30S ribosomal protein S17"
FT                   /note="best blastp match gb|AAK33191.1| (AE006478) 30S
FT                   ribosomal protein S17 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96885"
FT                   /db_xref="GOA:Q7CNP8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP8"
FT                   /protein_id="AAL96885.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEKAVII"
FT   gene            69724..70092
FT                   /gene="rplN"
FT                   /locus_tag="spyM18_0062"
FT   CDS_pept        69724..70092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="spyM18_0062"
FT                   /product="50S ribosomal protein L14"
FT                   /note="best blastp match gb|AAK33192.1| (AE006478) 50S
FT                   ribosomal protein L14 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96886"
FT                   /db_xref="GOA:Q7CNP7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP7"
FT                   /protein_id="AAL96886.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   gene            70171..70476
FT                   /gene="rplX"
FT                   /locus_tag="spyM18_0063"
FT   CDS_pept        70171..70476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="spyM18_0063"
FT                   /product="50S ribosomal protein L24"
FT                   /note="best blastp match gb|AAK33193.1| (AE006478) 50S
FT                   ribosomal protein L24 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96887"
FT                   /db_xref="GOA:P60738"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60738"
FT                   /protein_id="AAL96887.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   gene            70500..71042
FT                   /gene="rplE"
FT                   /locus_tag="spyM18_0064"
FT   CDS_pept        70500..71042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="spyM18_0064"
FT                   /product="50S ribosomal protein L5"
FT                   /note="best blastp match gb|AAK33194.1| (AE006478) 50S
FT                   ribosomal protein L5 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96888"
FT                   /db_xref="GOA:Q7CNP5"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP5"
FT                   /protein_id="AAL96888.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   gene            71058..71243
FT                   /gene="rpsN"
FT                   /locus_tag="spyM18_0065"
FT   CDS_pept        71058..71243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="spyM18_0065"
FT                   /product="30S ribosomal protein S14"
FT                   /note="best blastp match gb|AAK33195.1| (AE006478) 30S
FT                   ribosomal protein S14 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96889"
FT                   /db_xref="GOA:P66423"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66423"
FT                   /protein_id="AAL96889.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   gene            71394..71792
FT                   /gene="rpsH"
FT                   /locus_tag="spyM18_0066"
FT   CDS_pept        71394..71792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="spyM18_0066"
FT                   /product="30S ribosomal protein S8"
FT                   /note="best blastp match gb|AAK33196.1| (AE006478) 30S
FT                   ribosomal protein S8 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96890"
FT                   /db_xref="GOA:P66636"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66636"
FT                   /protein_id="AAL96890.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            71995..72531
FT                   /gene="rplF"
FT                   /locus_tag="spyM18_0067"
FT   CDS_pept        71995..72531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="spyM18_0067"
FT                   /product="50S ribosomal protein L6"
FT                   /note="best blastp match gb|AAK33197.1| (AE006478) 50S
FT                   ribosomal protein L6 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96891"
FT                   /db_xref="GOA:Q7CNP4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP4"
FT                   /protein_id="AAL96891.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   gene            72636..72992
FT                   /gene="rplR"
FT                   /locus_tag="spyM18_0068"
FT   CDS_pept        72636..72992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="spyM18_0068"
FT                   /product="50S ribosomal protein L18"
FT                   /note="best blastp match gb|AAK33198.1| (AE006478) 50S
FT                   ribosomal protein L18 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96892"
FT                   /db_xref="GOA:Q7CNP3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP3"
FT                   /protein_id="AAL96892.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            73011..73505
FT                   /gene="rpsE"
FT                   /locus_tag="spyM18_0069"
FT   CDS_pept        73011..73505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="spyM18_0069"
FT                   /product="30S ribosomal protein S5"
FT                   /note="best blastp match gb|AAK33199.1| (AE006478) 30S
FT                   ribosomal protein S5 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96893"
FT                   /db_xref="GOA:P66585"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66585"
FT                   /protein_id="AAL96893.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   gene            73520..73702
FT                   /gene="rpmD"
FT                   /locus_tag="spyM18_0071"
FT   CDS_pept        73520..73702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="spyM18_0071"
FT                   /product="50S ribosomal protein L30"
FT                   /note="best blastp match gb|AAK33200.1| (AE006478) 50S
FT                   ribosomal protein L30 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96894"
FT                   /db_xref="GOA:Q7CNP2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP2"
FT                   /protein_id="AAL96894.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   gene            73917..74357
FT                   /gene="rplO"
FT                   /locus_tag="spyM18_0072"
FT   CDS_pept        73917..74357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="spyM18_0072"
FT                   /product="50S ribosomal protein L15"
FT                   /note="best blastp match gb|AAK33201.1| (AE006478) 50S
FT                   ribosomal protein L15 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96895"
FT                   /db_xref="GOA:Q7CNP1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNP1"
FT                   /protein_id="AAL96895.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   gene            74374..75678
FT                   /gene="secY"
FT                   /locus_tag="spyM18_0073"
FT   CDS_pept        74374..75678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="spyM18_0073"
FT                   /product="putative preprotein translocase"
FT                   /note="best blastp match gb|AAK33202.1| (AE006478) putative
FT                   preprotein translocase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96896"
FT                   /protein_id="AAL96896.1"
FT                   /translation="MFLKILKDALKIKTVRNKIFFTIFIILVFRIGTHITVPGVNAKSL
FT                   EQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDIKTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVNVKASDLHSSYLIVGIL
FT                   IIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAPIAAQQALNLSSSIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   gene            75828..76466
FT                   /gene="adk"
FT                   /locus_tag="spyM18_0074"
FT   CDS_pept        75828..76466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="spyM18_0074"
FT                   /product="adenylate kinase"
FT                   /note="best blastp match sp|P82549|KAD_STRPY ADENYLATE
FT                   KINASE (ATP-AMP TRANSPHOSPHORYLASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96897"
FT                   /db_xref="GOA:Q8P2Z4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2Z4"
FT                   /protein_id="AAL96897.1"
FT                   /translation="MNLLIIGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLGLVTDIEGNQEITDVFADVEKALLELK"
FT   gene            76584..76802
FT                   /gene="infA"
FT                   /locus_tag="spyM18_0075"
FT   CDS_pept        76584..76802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="spyM18_0075"
FT                   /product="putative translation initiation factor IF-1"
FT                   /note="best blastp match gb|AAK33204.1| (AE006478) putative
FT                   translation initiation factor IF-1 [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96898"
FT                   /db_xref="GOA:P65125"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65125"
FT                   /protein_id="AAL96898.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            76828..76944
FT                   /gene="rpmJ"
FT                   /locus_tag="spyM18_0076"
FT   CDS_pept        76828..76944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="spyM18_0076"
FT                   /product="50S ribosomal protein B"
FT                   /note="best blastp match gb|AAK33205.1| (AE006478) 50S
FT                   ribosomal protein B [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96899"
FT                   /db_xref="GOA:P66305"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66305"
FT                   /protein_id="AAL96899.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   gene            76962..77327
FT                   /gene="rpsM"
FT                   /locus_tag="spyM18_0077"
FT   CDS_pept        76962..77327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="spyM18_0077"
FT                   /product="30S ribosomal protein S13"
FT                   /note="best blastp match gb|AAK33206.1| (AE006478) 30S
FT                   ribosomal protein S13 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96900"
FT                   /db_xref="GOA:P66396"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66396"
FT                   /protein_id="AAL96900.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            77345..77728
FT                   /gene="rpsK"
FT                   /locus_tag="spyM18_0078"
FT   CDS_pept        77345..77728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="spyM18_0078"
FT                   /product="30S ribosomal protein S11"
FT                   /note="best blastp match gb|AAK33207.1| (AE006478) 30S
FT                   ribosomal protein S11 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96901"
FT                   /db_xref="GOA:P66362"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66362"
FT                   /protein_id="AAL96901.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            77774..78712
FT                   /gene="rpoA"
FT                   /locus_tag="spyM18_0079"
FT   CDS_pept        77774..78712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="spyM18_0079"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /note="best blastp match gb|AAK33208.1| (AE006478)
FT                   DNA-directed RNA polymerase alpha subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96902"
FT                   /db_xref="GOA:P66711"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66711"
FT                   /protein_id="AAL96902.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   gene            78727..79113
FT                   /gene="rplQ"
FT                   /locus_tag="spyM18_0080"
FT   CDS_pept        78727..79113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="spyM18_0080"
FT                   /product="50S ribosomal protein L17"
FT                   /note="best blastp match gb|AAK06165.1|AE006436_14
FT                   (AE006436) 50S ribosomal protein L17 [Lactococcus lactis
FT                   subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96903"
FT                   /db_xref="GOA:Q7CNN9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNN9"
FT                   /protein_id="AAL96903.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            80041..81375
FT                   /locus_tag="spyM18_r05"
FT   rRNA            80041..81375
FT                   /locus_tag="spyM18_r05"
FT                   /product="16S ribosomal RNA"
FT   gene            81908..84808
FT                   /locus_tag="spyM18_r06"
FT   rRNA            81908..84808
FT                   /locus_tag="spyM18_r06"
FT                   /product="23S ribosomal RNA"
FT   gene            85244..85507
FT                   /locus_tag="spyM18_0084"
FT   CDS_pept        85244..85507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0084"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96904"
FT                   /protein_id="AAL96904.1"
FT                   /translation="MISVRSVVRVHSCPLSIIILLWSVGQGVKTPPFHGGNTGSNPVRT
FT                   ILYLEDYPSPAEGNGLENRQACKSVRGFESHILLLTIAGWSS"
FT   gene            86359..86544
FT                   /locus_tag="spyM18_0085"
FT   CDS_pept        86359..86544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0085"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33209.1| (AE006479)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96905"
FT                   /protein_id="AAL96905.1"
FT                   /translation="MSFEIFTLIIGWKLVGYRVMECGSSFKQGDYRLVVHICLLNVMDE
FT                   MLSQQGHEDKADWPEP"
FT   misc_feature    87224..87490
FT                   /note="spyM18_0089; probable gene fragment; best blastp
FT                   match sp|Q9KGK0|ISPE_BACHD
FT                   4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE (CMK)
FT                   (4-(CYTIDINE-5'-DIPHOSPHO)-2-C-METHYL-D-ERYTHRITOL KINASE)"
FT   misc_feature    87530..87757
FT                   /note="spyM18_0091; probable gene fragment; best blastp
FT                   match sp|Q9KGK0|ISPE_BACHD
FT                   4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE (CMK)
FT                   (4-(CYTIDINE-5'-DIPHOSPHO)-2-C-METHYL-D-ERYTHRITOL KINASE)"
FT   gene            87867..88310
FT                   /gene="adcR"
FT                   /locus_tag="spyM18_0092"
FT   CDS_pept        87867..88310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="spyM18_0092"
FT                   /product="putative repressor protein"
FT                   /note="best blastp match gb|AAK33210.1| (AE006479) putative
FT                   repressor protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96906"
FT                   /protein_id="AAL96906.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   gene            88314..89033
FT                   /gene="adrC"
FT                   /locus_tag="spyM18_0093"
FT   CDS_pept        88314..89033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adrC"
FT                   /locus_tag="spyM18_0093"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33211.1| (AE006479) ABC
FT                   transporter (ATP-binding protein) [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96907"
FT                   /protein_id="AAL96907.1"
FT                   /translation="MRYISVKNLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEVETDDEKGGHGHA"
FT   gene            89026..89841
FT                   /gene="adrB"
FT                   /locus_tag="spyM18_0094"
FT   CDS_pept        89026..89841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adrB"
FT                   /locus_tag="spyM18_0094"
FT                   /product="putative ABC transporter (permease)"
FT                   /note="best blastp match gb|AAK33212.1| (AE006479) putative
FT                   ABC transporter (permease) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96908"
FT                   /protein_id="AAL96908.1"
FT                   /translation="MLDILSYDFMQRAVMAVVAISIFAPILGIFLILRRQSLMSDTLSH
FT                   VSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEISTAILMSLGLALSLI
FT                   IMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLFIRPMYILTFDEDT
FT                   AFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIAMRLGKNFKTVILL
FT                   GIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKKRLF"
FT   gene            complement(89881..90264)
FT                   /locus_tag="spyM18_0095"
FT   CDS_pept        complement(89881..90264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0095"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /note="best blastp match gb|AAK33213.1| (AE006479) putative
FT                   histidine triad (HIT) protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96909"
FT                   /protein_id="AAL96909.1"
FT                   /translation="MTECIFCHQLKANQLLTQSQYFKVVFDIDPIQKGHLLLISKDHYT
FT                   SLTQLPKEVRYDLINLQAALVAKLEQHLPISGVTSVSNDKELMDEGTHFHLHLIPRLTN
FT                   DSFWEGITINQENWDLAPFLKHL"
FT   gene            complement(90320..91576)
FT                   /gene="tyrS"
FT                   /locus_tag="spyM18_0096"
FT   CDS_pept        complement(90320..91576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="spyM18_0096"
FT                   /product="putative tyrosine-tRNA ligase"
FT                   /note="best blastp match gb|AAK33214.1| (AE006479) putative
FT                   tyrosine-tRNA ligase [Streptococcus pyogenes M1 GAS]."
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96910"
FT                   /db_xref="GOA:Q8P2Y5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2Y5"
FT                   /protein_id="AAL96910.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   SEFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSEDSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGDRIQDLDYQLSNDDKI
FT                   DDQLTVIRRGKKKYAVLTY"
FT   gene            91680..93980
FT                   /gene="pbp"
FT                   /locus_tag="spyM18_0098"
FT   CDS_pept        91680..93980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp"
FT                   /locus_tag="spyM18_0098"
FT                   /product="putative penicillin-binding protein 1b"
FT                   /note="best blastp match gb|AAK33215.1| (AE006480) putative
FT                   penicillin-binding protein 1b [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96911"
FT                   /protein_id="AAL96911.1"
FT                   /translation="MVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYTVIFLFGM
FT                   MGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLRTPVA
FT                   NDAISENIKKAIVSTEDEHFQEHKGVVPKAVFRATLASVLGFGEASGGSTLTQQLVKQQ
FT                   VLGDDPTFKRKSKEIVYALALERYMSKDNILGDYLNVSPFGRNNKGQNIAGVEEAARGI
FT                   FGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNMYRTG
FT                   VLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKVSSRD
FT                   LKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTVQMGN
FT                   VLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGSASVL
FT                   SNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENYMTKM
FT                   GYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVVYKHE
FT                   NKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTENYTD
FT                   VWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVGQRFN
FT                   LDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGGTDAD
FT                   YQKAWGNFGFRKN"
FT   gene            94244..97810
FT                   /gene="ropB"
FT                   /locus_tag="spyM18_0099"
FT   CDS_pept        94244..97810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropB"
FT                   /locus_tag="spyM18_0099"
FT                   /product="putative DNA-dependent RNA polymerase subunit
FT                   beta"
FT                   /note="best blastp match gb|AAK33216.1| (AE006480) putative
FT                   DNA-dependent RNA polymerase subunit beta [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96912"
FT                   /db_xref="GOA:Q8P2Y3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2Y3"
FT                   /protein_id="AAL96912.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGTVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   gene            97901..101542
FT                   /gene="ropC"
FT                   /locus_tag="spyM18_0100"
FT   CDS_pept        97901..101542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropC"
FT                   /locus_tag="spyM18_0100"
FT                   /product="RNA polymerase beta' subunit"
FT                   /note="best blastp match sp|P95816|RPOC_STRPY DNA-DIRECTED
FT                   RNA POLYMERASE BETA PRIME CHAIN (TRANSCRIPTASE BETA CHAIN)
FT                   (RNA POLYMERASE BETA PRIME SUBUNIT)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96913"
FT                   /db_xref="GOA:Q8P2Y2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2Y2"
FT                   /protein_id="AAL96913.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLICAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAVFTAEAE"
FT   gene            101694..102059
FT                   /locus_tag="spyM18_0101"
FT   CDS_pept        101694..102059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0101"
FT                   /product="putative DNA binding protein"
FT                   /note="best blastp match gb|AAK33218.1| (AE006481) putative
FT                   DNA binding protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96914"
FT                   /protein_id="AAL96914.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   gene            102151..103089
FT                   /locus_tag="spyM18_0102"
FT   CDS_pept        102151..103089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0102"
FT                   /product="putative ABC transporter subunit ComYA"
FT                   /note="best blastp match gb|AAK33219.1| (AE006481) putative
FT                   ABC transporter subunit ComYA [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96915"
FT                   /protein_id="AAL96915.1"
FT                   /translation="MVQVLAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISNYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGVTKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   gene            102968..104059
FT                   /locus_tag="spyM18_0103"
FT   CDS_pept        102968..104059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0103"
FT                   /product="putative competence protein, ABC transporter
FT                   subunit"
FT                   /note="best blastp match gb|AAK33220.1| (AE006481) putative
FT                   competence protein, ABC transporter subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96916"
FT                   /protein_id="AAL96916.1"
FT                   /translation="MTLLKTNLNIIPHRTGINKLISFLRQDISIPSKLSLKKLSSKHQH
FT                   KFIQLLANLLSTGFSFAEVIAFLKRSQLLQIDYVLKMEESLLKGQGLADMLSGLGFSDA
FT                   ILTQISLADRHGNIETTLVAIQHYLNQMARIRRKTVEVITYPLILLLFLFVMMLGLRRY
FT                   LVPQLETQNQITYFLNHFPAFFIGFCSGLILLFGMVWLRWRSQSRLKLYSRLSRYPFLG
FT                   KLLKQYLTSYYAREWGTLIGQGLDLMTILDIMAIEKSSLMKELAEDIRMSLLEGQAFHI
FT                   KVATYPFFKKELSLMIEYGEIKSKLGAELEIYAQESWEQFFSQLYQVTQLIQPAIFLVV
FT                   AVTIVMIYAAILLPIYQNMGGIF"
FT   gene            104061..104387
FT                   /locus_tag="spyM18_0105"
FT   CDS_pept        104061..104387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0105"
FT                   /product="putative competence protein"
FT                   /note="best blastp match gb|AAK33221.1| (AE006481) putative
FT                   competence protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96917"
FT                   /protein_id="AAL96917.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   gene            104362..104790
FT                   /locus_tag="spyM18_0106"
FT   CDS_pept        104362..104790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0106"
FT                   /product="putative competence protein"
FT                   /note="best blastp match gb|AAK33222.1| (AE006481) putative
FT                   competence protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96918"
FT                   /protein_id="AAL96918.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   gene            104795..105031
FT                   /locus_tag="spyM18_0107"
FT   CDS_pept        104795..105031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0107"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33223.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96919"
FT                   /protein_id="AAL96919.1"
FT                   /translation="MIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTR
FT                   TKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   gene            105024..105458
FT                   /locus_tag="spyM18_0108"
FT   CDS_pept        105024..105458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0108"
FT                   /product="putative competence protein"
FT                   /note="best blastp match gb|AAK33224.1| (AE006481) putative
FT                   competence protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96920"
FT                   /protein_id="AAL96920.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIGQSQICITLKWKSGLERTFYYAFQD"
FT   gene            105442..105768
FT                   /locus_tag="spyM18_0109"
FT   CDS_pept        105442..105768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0109"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33225.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96921"
FT                   /protein_id="AAL96921.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVSFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   gene            105866..106819
FT                   /locus_tag="spyM18_0110"
FT   CDS_pept        105866..106819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33226.1| (AE006481)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96922"
FT                   /protein_id="AAL96922.1"
FT                   /translation="MTFEKIEEAYQLLLENCQLIENDLKTHIYDAIVEQNSFYLGAEGA
FT                   SPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQFTPDAIGFILLYLLEQ
FT                   LSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLIDLSASIAEIMDSSAHF
FT                   IQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHTYAHHLLMEQSLKYLK
FT                   KDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVALITLPDSIFGHPSNAKSIIVLQKQT
FT                   DHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   gene            106878..108074
FT                   /locus_tag="spyM18_0111"
FT   CDS_pept        106878..108074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0111"
FT                   /product="acetate kinase"
FT                   /note="best blastp match gb|AAK33227.1| (AE006481) acetate
FT                   kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96923"
FT                   /db_xref="GOA:Q8P2X6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2X6"
FT                   /protein_id="AAL96923.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEEVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEHIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKCIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   gene            108261..108569
FT                   /locus_tag="spyM18_0112"
FT   CDS_pept        108261..108569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0112"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33228.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96924"
FT                   /protein_id="AAL96924.1"
FT                   /translation="MYVFIEPNDLKDYLITIYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKIATNSQKPPFDTSQVLC"
FT   gene            complement(108652..109422)
FT                   /locus_tag="spyM18_0113"
FT   CDS_pept        complement(108652..109422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0113"
FT                   /product="putative pyrroline carboxylate reductase"
FT                   /note="best blastp match gb|AAK33229.1| (AE006481) putative
FT                   pyrroline carboxylate reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96925"
FT                   /protein_id="AAL96925.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   gene            complement(109470..110537)
FT                   /locus_tag="spyM18_0115"
FT   CDS_pept        complement(109470..110537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0115"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /note="best blastp match gb|AAK33230.1| (AE006481) putative
FT                   glutamyl-aminopeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96926"
FT                   /protein_id="AAL96926.1"
FT                   /translation="MTDLFSKMKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKVEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNSGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEA
FT                   GVNIQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKCY"
FT   gene            111073..112074
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0116"
FT   CDS_pept        111073..112074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0116"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96927"
FT                   /protein_id="AAL96927.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGFRSSNLIFL"
FT   gene            112088..112372
FT                   /locus_tag="spyM18_0117"
FT   CDS_pept        112088..112372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0117"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33232.1| (AE006481)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96928"
FT                   /protein_id="AAL96928.1"
FT                   /translation="MSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLRTFF
FT                   SPLGQIEVLYINPCQVKQDYISGGIVMSNGKQYQFTYHSRQISFEEDKG"
FT   gene            112369..112707
FT                   /gene="trxA"
FT                   /locus_tag="spyM18_0118"
FT   CDS_pept        112369..112707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="spyM18_0118"
FT                   /product="putative thioredoxin"
FT                   /note="best blastp match gb|AAK04487.1|AE006276_2
FT                   (AE006276) thioredoxin H-type [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96929"
FT                   /protein_id="AAL96929.1"
FT                   /translation="MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAE
FT                   LTDMTFVCVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   QQEKRKNK"
FT   gene            112704..113330
FT                   /gene="pheT1"
FT                   /locus_tag="spyM18_0119"
FT   CDS_pept        112704..113330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT1"
FT                   /locus_tag="spyM18_0119"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK04488.1|AE006276_3
FT                   (AE006276) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96930"
FT                   /protein_id="AAL96930.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPIVGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   gene            113482..113877
FT                   /gene="ssb"
FT                   /locus_tag="spyM18_0120"
FT   CDS_pept        113482..113877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="spyM18_0120"
FT                   /product="putative single-strand binding protein"
FT                   /note="best blastp match gb|AAK04490.1|AE006276_5
FT                   (AE006276) single-strand binding protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96931"
FT                   /protein_id="AAL96931.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   AGFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   gene            complement(114132..114773)
FT                   /locus_tag="spyM18_0121"
FT   CDS_pept        complement(114132..114773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0121"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAC97156.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96932"
FT                   /protein_id="AAL96932.1"
FT                   /translation="MLIVLAGTIGAGKSSLAAALGEHLGTDVFYEAVDNNPVLDLYYQD
FT                   PKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLKLNYKNGNVTKTELDIY
FT                   QELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSFEQVDGNPSLEQYYHQV
FT                   HGEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTKLKELHLL"
FT   gene            complement(114793..115770)
FT                   /locus_tag="spyM18_0122"
FT   CDS_pept        complement(114793..115770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0122"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAC97155.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96933"
FT                   /protein_id="AAL96933.1"
FT                   /translation="MTKLNSSFRIGDVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPDKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHETLARVSKAITKIPFIGNGDVRSVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGQELPDLPFAKKLDIAKDHLKRLINLKGET
FT                   IAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR"
FT   gene            complement(115757..116629)
FT                   /locus_tag="spyM18_0123"
FT   CDS_pept        complement(115757..116629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0123"
FT                   /product="putative HSP33"
FT                   /note="best blastp match sp|Q9ZB45|HSLO_STRPY 33 KDA
FT                   CHAPERONIN (HEAT SHOCK PROTEIN 33 HOMOLOG) (HSP33)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96934"
FT                   /db_xref="GOA:Q8P2W5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2W5"
FT                   /protein_id="AAL96934.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEALINDKA"
FT   misc_feature    complement(116755..117375)
FT                   /note="nra.2 (spyM18_0124); sequence confirmed upstream
FT                   mutation-gene fragment; best blastp match gb|AAC97147.1|
FT                   (U49397) Nra [Streptococcus pyogenes]"
FT   gene            complement(117637..118290)
FT                   /gene="nra.1"
FT                   /locus_tag="spyM18_0125"
FT   CDS_pept        complement(117637..118290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nra.1"
FT                   /locus_tag="spyM18_0125"
FT                   /product="N-terminal fragment of Nra"
FT                   /note="best blastp match gb|AAC97147.1| (U49397) Nra
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96935"
FT                   /protein_id="AAL96935.1"
FT                   /translation="MPYVKKKKDSFLVETYLEQSIRDKSELVLLLFKSPTIIFSHVAKQ
FT                   TGLTAVQLKYYCKELDDFFGNNLDITIKKGKIICCFVKPVKEFYLHQLYDTSTILKLLV
FT                   FFIKNGTTSQPLIKFSKKYFLSSSSAYRLRESLIKLLREFGLRVSKNTIVGEEYRIRYL
FT                   IAMLYSKFGIVIYPLDHLDNQIIYRFLSQSATNLRTSPWLEEPFSFYNMLLALS"
FT   gene            118720..120294
FT                   /gene="cbp"
FT                   /locus_tag="spyM18_0126"
FT   CDS_pept        118720..120294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp"
FT                   /locus_tag="spyM18_0126"
FT                   /product="putative collagen binding protein"
FT                   /note="best blastp match gb|AAC97148.1| (U49397) Cpa
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96936"
FT                   /protein_id="AAL96936.1"
FT                   /translation="MQKRDKTNYGSANNKRRQTTIGLLKVFLTFVALIGIVGFSIRAFG
FT                   AEEQSTETKKTSVIIRKYAEGDYSKLLEGATLKLAQIEGSGFQEQSFESSTSGQKLQLS
FT                   DGTYILTETKSPQGYEIAEPITFKVTAGKVFIKGKDGQFVENQNKEVAEPYSVTAYNDF
FT                   DDSGFINPKTFTPYGKFYYAKNANGTSQVVYCFNVDLHSPPDSLDKGETIDPDFNEGKE
FT                   IKYTHILGADLFSYANNPRASTNDELLSQVKKVLEKGYRDDSTTYANLTSVEFRAATQL
FT                   AIYYFTDSVDLDNLADYHGFGALTTEALNATKEIVAYAEDRANLPNISNLDFYVPNSNK
FT                   YQSLIGTQYHPESLVDIIRMEDKQAPIIPITHKLTISKTVTGTIADKKKEFNFEIHLKS
FT                   SDGQAISGTYPTNSGELTVTDGKATFTLKDGESLIVEGLPSGYSYEITETGASDYEVSV
FT                   NGKNAPDGKATKASVKEDETITFENRKDLVPPTGLTTDGAIYLWLLLLVLLGLWVWLIG
FT                   RKGLKND"
FT   gene            120287..120808
FT                   /gene="lepA"
FT                   /locus_tag="spyM18_0127"
FT   CDS_pept        120287..120808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="spyM18_0127"
FT                   /product="LepA"
FT                   /note="best blastp match gb|AAC97149.1| (U49397) LepA
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96937"
FT                   /protein_id="AAL96937.1"
FT                   /translation="MTNYLNRLNENPLFKAFIRLVLKISIIGFLGYILFQYIFGVMIIN
FT                   TNVMSPALSAGDGILYYRLTDRYHINDVVVYEVDNTLKVGRIVAQAGDEVSFTQEGGLL
FT                   INGHPPEKEVPYLTYPHSSGPNFPYKVPTGTYFILNDYREERLDSRYYGALPINQIKGK
FT                   ISTLLRVRGI"
FT   gene            120829..121863
FT                   /locus_tag="spyM18_0128"
FT   CDS_pept        120829..121863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0128"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAC97152.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96938"
FT                   /protein_id="AAL96938.1"
FT                   /translation="MKKNKLLLATAILATALGTASLNQNVKAETAGVIDGSTLVVKKTF
FT                   PSYTDDKVLMPKADYTFKVEADDNAKGKTKDGLDIKPGVIDGLENTKTIHYGNSDKTTA
FT                   KEKSVNFDFANVKFPGVGVYRYTVSEVNGNKAGIAYDSQQWTVDVYVVNREDGGFEAKY
FT                   IVSTEGGQSDKKPVLFKNFFDTTSLKVTKKVTGNTGEHQRSFSFTLLLTPNECFEKGQV
FT                   VNILQGGETKKVVIGEEYSFTLKDKESVTLSQLPVGIEYKVTEEDVTKDGYKTSATLKD
FT                   GDVTDGYNLGDSKTTDKSTDEIVVTNKRDTQVPTGVVGTLAPFAVLSIVAIGGVIYITK
FT                   RKKA"
FT   gene            121864..122604
FT                   /locus_tag="spyM18_0129"
FT   CDS_pept        121864..122604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0129"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAC97152.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96939"
FT                   /protein_id="AAL96939.1"
FT                   /translation="MISQRMMMTIVQVINKAIDTLILIFCLVVLFLAGFGLWDSYHLYQ
FT                   QADASNFKKFKTAQQQPKFEDLLALNEDVIGWLNIPGTHMDYPLVQGKTNLEYINKAVD
FT                   GSVAMSGSLFLDTRNHNDFTDDYSLIYGHHMAGNAMFGEIPKFLKKDFFNKHNKAIIET
FT                   KERKKLTVTIFACLKTDAFDQLVFNPNAITNQDQQRQLVDYISKRSKQFKPVKLKHHTK
FT                   FVAFSTCENFSTDNRVIVVGTIQE"
FT   gene            122621..123208
FT                   /locus_tag="spyM18_0130"
FT   CDS_pept        122621..123208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0130"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAC97151.1| (U49397) unknown
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96940"
FT                   /protein_id="AAL96940.1"
FT                   /translation="MRKYWKMLFSVVMILTMLAFNQTVLAKDSTVQTSISVENVLERAG
FT                   DSTSFSVALESIDAMKTIDEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQAD
FT                   TTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPDIPKTPLP
FT                   LAGEVKSLLGILSIVLLGLLVLLYVKKLKSRL"
FT   gene            complement(123368..124573)
FT                   /locus_tag="spyM18_0131"
FT   CDS_pept        complement(123368..124573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0131"
FT                   /product="putative multiple sugar metabolism repressor"
FT                   /note="best blastp match gb|AAC97150.1| (U49397) MsmR
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96941"
FT                   /protein_id="AAL96941.1"
FT                   /translation="MAIFDLKHVQTLHSLSQLPISVMSQDKALIQVYGNDDYLLCYYQF
FT                   LKHLAIPQAAQDVIFYEGLFEESFMIFPLCHYIIAIGPFYPYSLNKDYQEQLANNCLKH
FT                   SSHRSKEELLSYMALVPHFPINNVRNLLIAIDAFFDTQFETTCQQTIHQLLQHSKQMTA
FT                   DPDIIHRLKHISKASSQLPPVLEHLNHIMDLVKLGNPQLLKQEINRIPLSSITSSSISA
FT                   LRAEKNLTVIYLTRLLEFSFVENTDVAKHYSLVKYYMALNEEASDLLKVLRIRCAAIIH
FT                   FSESLTNKSISDKRQMYNSVLHYVDSHLYSKLKVSDIAKRLYVSESHLRSVFKKYSNVS
FT                   LQHYILSTKIKEAQLLLKRGIPVGEVAKSLYFYDTTHFHKIFKKYTGISSKDYLAKYRD
FT                   NI"
FT   gene            124958..127048
FT                   /gene="prtF2l"
FT                   /locus_tag="spyM18_0132"
FT   CDS_pept        124958..127048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtF2l"
FT                   /locus_tag="spyM18_0132"
FT                   /product="protein F2-like protein"
FT                   /note="best blastp match pir||T30856 protein F2 -
FT                   Streptococcus pyogenes"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96942"
FT                   /protein_id="AAL96942.1"
FT                   /translation="MTQKNSYKLSFLLSLTGFILGLLLVFIGLSGVSVGHAETRNGANK
FT                   QGAFEIKKNKSQEEYNYEVYDNRNILQDGEHKLEIKRVDGTGKTYQGFCFQLTKNFPTA
FT                   QGVSKKLYKKLSSSDEETLKQYASKYTSNRRGDTSGNLKKQIAKVLTEGYPTNKSDWLN
FT                   GLTENEKIEVTQDAIWYFTETTVPADRSYTNRNVNSQKMKEVYQKLIDTTDIDKYEDVQ
FT                   FDLFVPQDTNLQAVISVEPVIESLPWTSLKPIAQKDITAKKIWVDAPKEKPIIYFKLYR
FT                   QLPGEKEVAVDDAELKQINSEGQQEISVTWTNQLVTDEKGMAYIYSVKEVDKNGELLEP
FT                   KDYIKKEDGLTVTNTYVKPTSGHYDIEVTFGNGHIDITEDTTPDIVSGENQMKQIEGED
FT                   SKPIDEVTENNLIEFGKNTMPGEEDGTNSNKYEEVEDSRPVDTLSGLSSEQGQSGDMTI
FT                   EEDSATHIKFSKRDIDGKELAGATMELRDSSGKTISTWISDGQVKDFYLMPGKYTFVET
FT                   AAPDGYEIATAITFTVNEQGQVTVNGKATKGDAHIVMVDAYKPTKGSGQVIDIEEKLPD
FT                   EQGHSGSTTEIEDSKSSDVIIGGQGQIVETTEDTQTGMHGDSGCKTEVEDTKLVQSFHF
FT                   DNKESESNSEIPKKDKPKSNTSLPATGEKQHNMFFWMVTSCSLISSVFVISLKTKKRLS
FT                   SC"
FT   gene            complement(127314..127979)
FT                   /locus_tag="spyM18_0133"
FT   CDS_pept        complement(127314..127979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0133"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33244.1| (AE006483)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96943"
FT                   /protein_id="AAL96943.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEKGKVHLYWQGNY
FT                   YVDNYVDYTKTLVDNNNSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPKEITYEHHYWD
FT                   GTVHSEKRSNTQWHYDWENQKTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHVLVD
FT                   TYGRQSHTYFSHKMVWKFKTELEEGNKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   gene            128332..129738
FT                   /locus_tag="spyM18_0134"
FT   CDS_pept        128332..129738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0134"
FT                   /product="putative short-chain fatty acids transporter"
FT                   /note="best blastp match gb|AAK33245.1| (AE006483) putative
FT                   short-chain fatty acids transporter [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96944"
FT                   /protein_id="AAL96944.1"
FT                   /translation="MNNIKTKKRFMDRYIDGFMKWMPESLFICFILTFLVVTMSVLMTD
FT                   SPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVASSPPAHKMFKFLAKLPQT
FT                   RTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTPLFVATLFFTFL
FT                   PATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFISLLVVCMLVPF
FT                   CFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRLVMYLVGGAIVS
FT                   YSLYHFSVVGLSGLDLNSFNFLFLGLGLLLCGQQGPEYYGSLFKDGVMSSWGLVLQFPF
FT                   YAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSGGSKFVIEAPYI
FT                   VPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIVAYTIPCVLVVT
FT                   GIAIIYLFVF"
FT   gene            complement(129808..130719)
FT                   /locus_tag="spyM18_0135"
FT   CDS_pept        complement(129808..130719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0135"
FT                   /product="putative transcriptional regulator"
FT                   /note="best blastp match gb|AAK34404.1| (AE006595) putative
FT                   transcriptional regulator (LysR family) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96945"
FT                   /protein_id="AAL96945.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   IVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDATIADIDI
FT                   LLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLP
FT                   VVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHN
FT                   KTSHLKHYIKHTILDYFTNQRF"
FT   gene            130840..132024
FT                   /locus_tag="spyM18_0136"
FT   CDS_pept        130840..132024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0136"
FT                   /product="putative acetyl-CoA acetyltransferase"
FT                   /note="best blastp match gb|AAK33246.1| (AE006483) putative
FT                   acetyl-CoA acetyltransferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96946"
FT                   /protein_id="AAL96946.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLIDQDEYPK
FT                   FGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   gene            132036..132695
FT                   /locus_tag="spyM18_0137"
FT   CDS_pept        132036..132695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0137"
FT                   /product="putative acetyl-CoA:acetoacetyl-CoA transferase
FT                   alpha subunit"
FT                   /note="best blastp match gb|AAK33247.1| (AE006483) putative
FT                   acetyl-CoA:acetoacetyl-CoA transferase alpha subunit
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96947"
FT                   /protein_id="AAL96947.1"
FT                   /translation="MKENKRIAIAEAISHIKDGDTIMVGGFMANGTPEALIDALVDKGT
FT                   KDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEAGRQMTAGETTIELIPQGTF
FT                   AEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLLEYPFEADVALIFANKADEM
FT                   GNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPEYVHTPHIFVDYIVKEGV"
FT   gene            132698..133345
FT                   /locus_tag="spyM18_0138"
FT   CDS_pept        132698..133345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0138"
FT                   /product="butyrate-acetoacetate CoA-transferase, beta
FT                   subunit"
FT                   /note="best blastp match gb|AAK33248.1| (AE006483)
FT                   butyrate-acetoacetate CoA-transferase, beta subunit
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96948"
FT                   /protein_id="AAL96948.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   gene            complement(133467..134147)
FT                   /locus_tag="spyM18_0140"
FT   CDS_pept        complement(133467..134147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33249.1| (AE006483)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96949"
FT                   /protein_id="AAL96949.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   gene            134321..134686
FT                   /locus_tag="spyM18_0141"
FT   CDS_pept        134321..134686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33250.1| (AE006484)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96950"
FT                   /protein_id="AAL96950.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   gene            134723..135742
FT                   /locus_tag="spyM18_0142"
FT   CDS_pept        134723..135742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0142"
FT                   /product="putative regulatory protein"
FT                   /note="best blastp match gb|AAK33251.1| (AE006484) putative
FT                   regulatory protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96951"
FT                   /protein_id="AAL96951.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIINLIVGYIGGSVFKNYRLVTKQELQARN"
FT   gene            136197..136517
FT                   /locus_tag="spyM18_0143"
FT   CDS_pept        136197..136517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0143"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33252.1| (AE006484)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96952"
FT                   /protein_id="AAL96952.1"
FT                   /translation="MNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEYE
FT                   QETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVETY
FT                   GH"
FT   gene            136507..138507
FT                   /locus_tag="spyM18_0144"
FT   CDS_pept        136507..138507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0144"
FT                   /product="V-type Na+-ATPase subunit I"
FT                   /note="best blastp match gb|AAK33253.1| (AE006484) V-type
FT                   Na+ -ATPase subunit I [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96953"
FT                   /protein_id="AAL96953.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNKGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEESHRQQAAQTALKMMSQKIERLEQLQNKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANDHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKRLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNISGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETNLEDN"
FT   gene            138509..138988
FT                   /locus_tag="spyM18_0145"
FT   CDS_pept        138509..138988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0145"
FT                   /product="V-type Na+-ATPase subunit K"
FT                   /note="best blastp match gb|AAK33254.1| (AE006484) V-type
FT                   Na+ -ATPase subunit K [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96954"
FT                   /protein_id="AAL96954.1"
FT                   /translation="MEHLAHYFTAHGGVFFAVLGIVLAVALSGMGSAYGVGKGGQAAAA
FT                   LLKEEPEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQGLAYFLVSLPIAIV
FT                   GYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFVVSFILLNKIG"
FT   gene            139056..139640
FT                   /locus_tag="spyM18_0146"
FT   CDS_pept        139056..139640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0146"
FT                   /product="putative V-type Na+-ATPase subunit E"
FT                   /note="best blastp match gb|AAK33255.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit E [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96955"
FT                   /protein_id="AAL96955.1"
FT                   /translation="MNDITRLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   gene            139656..140654
FT                   /locus_tag="spyM18_0147"
FT   CDS_pept        139656..140654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0147"
FT                   /product="putative V-type Na+-ATPase subunit C"
FT                   /note="best blastp match gb|AAK33256.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit C [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96956"
FT                   /protein_id="AAL96956.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLVALEHLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPIA"
FT   gene            140651..140971
FT                   /locus_tag="spyM18_0148"
FT   CDS_pept        140651..140971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0148"
FT                   /product="putative V-type Na+ ATP synthase subunit G"
FT                   /note="best blastp match sp|P43455|NTPG_ENTHR V-TYPE SODIUM
FT                   ATP SYNTHASE SUBUNIT G (NA(+)-TRANSLOCATING ATPASE SUBUNIT
FT                   G)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96957"
FT                   /protein_id="AAL96957.1"
FT                   /translation="MTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQDAINQLRQLAM
FT                   EDFGIIYITEDIAAAIPEALTHYDNQVLPAVIPLPTHQGAQGIGLSRIQAMVEKAVGQN
FT                   IL"
FT   gene            141172..142947
FT                   /locus_tag="spyM18_0150"
FT   CDS_pept        141172..142947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0150"
FT                   /product="putative V-type Na+-ATPase alpha subunit"
FT                   /note="best blastp match gb|AAK33257.1| (AE006484) putative
FT                   V-type Na+ -ATPase alpha subunit [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96958"
FT                   /db_xref="GOA:Q8P2U6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2U6"
FT                   /protein_id="AAL96958.1"
FT                   /translation="MNQGKIITVSGPLVVASGMQEANIQDICRVGHLGLVGEIIEMRRD
FT                   QASIQVYEETSGIGPGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLI
FT                   RGVAIPSLDRKAKWAFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIH
FT                   AGDFTVTDTVYEIKQEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFP
FT                   VTKGGAAAVPGPFGAGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPN
FT                   TGQSIMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALR
FT                   EMSGRLQEMPGDEGYPAYLGSRIAEYYERSGRVRTLGSQEREGTITAIGAVSPPGGDIS
FT                   EPVTQNTLRIVKVFWGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQQSNWSNKV
FT                   TRAMAILQREASLEEIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFP
FT                   KQEAMLTNILTFNEEASKALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGLTQ
FT                   KVTKEIHHVLAKGGI"
FT   gene            142948..144363
FT                   /locus_tag="spyM18_0151"
FT   CDS_pept        142948..144363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0151"
FT                   /product="putative V-type Na+-ATPase subunit B"
FT                   /note="best blastp match gb|AAK33258.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit B [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96959"
FT                   /db_xref="GOA:Q8P2U5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2U5"
FT                   /protein_id="AAL96959.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGARRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   gene            144408..145034
FT                   /locus_tag="spyM18_0153"
FT   CDS_pept        144408..145034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0153"
FT                   /product="putative V-type Na+-ATPase subunit D"
FT                   /note="best blastp match gb|AAK33259.1| (AE006484) putative
FT                   V-type Na+ -ATPase subunit D [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96960"
FT                   /db_xref="GOA:Q8P2U4"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2U4"
FT                   /protein_id="AAL96960.1"
FT                   /translation="MARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELMRRFVDLI
FT                   RENNELRQTLEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIENIMSVNVP
FT                   KFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTCQLMADDI
FT                   EKTRRRVNGLEYSIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   gene            complement(145154..146416)
FT                   /locus_tag="spyM18_0154"
FT   CDS_pept        complement(145154..146416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0154"
FT                   /product="putative toxic anion resistance protein"
FT                   /note="best blastp match gb|AAK33260.1| (AE006485) putative
FT                   toxic anion resistance protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96961"
FT                   /protein_id="AAL96961.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   TTPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIVNANNAALQMLAETSKEAIPALEQSAQ
FT                   SPTLSMKSVTSLAESLVAQNNGIIAAIDHGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   gene            complement(146429..147307)
FT                   /locus_tag="spyM18_0155"
FT   CDS_pept        complement(146429..147307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0155"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33261.1| (AE006485)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96962"
FT                   /protein_id="AAL96962.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   gene            147745..149037
FT                   /locus_tag="spyM18_0156"
FT   CDS_pept        147745..149037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0156"
FT                   /product="putative adenylosuccinate synthetase"
FT                   /note="best blastp match gb|AAK33262.1| (AE006485) putative
FT                   adenylosuccinate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96963"
FT                   /db_xref="GOA:Q8P2U1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2U1"
FT                   /protein_id="AAL96963.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDAV
FT                   KICVAYDLDGERIDYYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   IGELVGVRISTFSVGPGREQTNILESVWASI"
FT   gene            149366..150409
FT                   /locus_tag="spyM18_0158"
FT   CDS_pept        149366..150409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0158"
FT                   /product="putative ABC transporter"
FT                   /note="best blastp match gb|AAK33263.1| (AE006485) putative
FT                   ABC transporter (lipoprotein) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96964"
FT                   /protein_id="AAL96964.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSAKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKPVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKRKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEGQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEG
FT                   TITVPEN"
FT   gene            150582..151121
FT                   /locus_tag="spyM18_0159"
FT   CDS_pept        150582..151121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0159"
FT                   /product="putative transcription antitermination factor"
FT                   /note="best blastp match sp|P82547|NUSG_STRPY TRANSCRIPTION
FT                   ANTITERMINATION PROTEIN NUSG"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96965"
FT                   /db_xref="GOA:P68895"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68895"
FT                   /protein_id="AAL96965.1"
FT                   /translation="MLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIP
FT                   TQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTP
FT                   LLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKLMLNMF
FT                   GSETVAEVELYQIAEL"
FT   gene            151493..152848
FT                   /gene="nga"
FT                   /locus_tag="spyM18_0163"
FT   CDS_pept        151493..152848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="spyM18_0163"
FT                   /product="nicotine adenine dinucleotide glycohydrolase
FT                   precursor"
FT                   /note="best blastp match gb|AAF19836.1|AF203370_1
FT                   (AF203370) nicotine adenine dinucleotide glycohydrolase
FT                   precursor [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96966"
FT                   /protein_id="AAL96966.1"
FT                   /translation="MRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKK
FT                   SGVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMRI
FT                   GRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFHKIELGDTYTKKPHHIEIDKK
FT                   LDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADEFIE
FT                   TADKYADKAVQMSAVASRTEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDLM
FT                   LAFDDAKNKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKDVDSGKYSDGV
FT                   YQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISV
FT                   KDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   gene            152982..153338
FT                   /locus_tag="spyM18_0164"
FT   CDS_pept        152982..153338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0164"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33266.1| (AE006485)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96967"
FT                   /protein_id="AAL96967.1"
FT                   /translation="MGDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALD
FT                   IYQAVQTLNAENMLLNYYESLPFYLNRQSILANMTKALKDAHIREAMAHYKLGEFAHYQ
FT                   DTMLDMVERTIKTF"
FT   gene            153353..155077
FT                   /gene="slo"
FT                   /locus_tag="spyM18_0165"
FT   CDS_pept        153353..155077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="spyM18_0165"
FT                   /product="streptolysin O"
FT                   /note="best blastp match dbj|BAB41212.1| (AB050250)
FT                   streptolysin O [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96968"
FT                   /db_xref="GOA:Q8P2T7"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2T7"
FT                   /protein_id="AAL96968.1"
FT                   /translation="MKDMSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTE
FT                   TTTTNEQPKPESSELTTEKAGQKTDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKS
FT                   EEDHTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTP
FT                   VDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVND
FT                   PTYANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTL
FT                   GIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPL
FT                   FVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGG
FT                   DAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVET
FT                   TSTEYTSGKINLSHRGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVI
FT                   PLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   gene            complement(155216..155458)
FT                   /locus_tag="spyM18_0166"
FT   CDS_pept        complement(155216..155458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0166"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33269.1| (AE006486)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96969"
FT                   /protein_id="AAL96969.1"
FT                   /translation="MKKKLSLFMIATAAVVSLSLATPENQTVSANEAVATQACADGTNC
FT                   CGYNFYGYCRPISWLFYKTKHLLMGDQPTTDIVTK"
FT   gene            complement(155875..156042)
FT                   /locus_tag="spyM18_0167"
FT   CDS_pept        complement(155875..156042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0167"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33270.1| (AE006486)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96970"
FT                   /protein_id="AAL96970.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGNHQTVSANDASYSNGFYGQNA
FT                   PDNWLLYTVW"
FT   gene            complement(156227..156493)
FT                   /locus_tag="spyM18_0168"
FT   CDS_pept        complement(156227..156493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0168"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96971"
FT                   /protein_id="AAL96971.1"
FT                   /translation="MKNKLFLVALATVTVLGPSLANPHHGTVHTTEYCTYVTGKPEVGG
FT                   CYERKDGMPIEENIIKKSNDFSLLNWFWEIITNWWSKITGYFS"
FT   gene            156977..158116
FT                   /locus_tag="spyM18_0170"
FT   CDS_pept        156977..158116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0170"
FT                   /product="putative cystathionine beta-lyase"
FT                   /note="best blastp match gb|AAK33272.1| (AE006486) putative
FT                   cystathionine beta-lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96972"
FT                   /protein_id="AAL96972.1"
FT                   /translation="MRENTTLLHGYTVIDEFTGAASVPIYQTSTFHNSELYCPSQKHLY
FT                   TRFSNPTTEALEDGLACLEKATYAVAYASGMAAISTVLMLLKAGDHVIFPLEVYGGTCQ
FT                   FATAILPNYQIETSFVDMADLATVKASIRPNTRMIYLETPSNPLLKICDISELVQLAKA
FT                   YGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATNNEAIYNQLKL
FT                   FQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLKVHYPGLDSH
FT                   PNHDTHLQQAKNGGAVLSFELASKEELMTFTHRIQLPILAVSLGGVESILSHPATMSHA
FT                   CLSSQARLEQGVVDGLLRLSCGVENIEDLLADFEQALAF"
FT   gene            158325..160826
FT                   /gene="leuS"
FT                   /locus_tag="spyM18_0171"
FT   CDS_pept        158325..160826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="spyM18_0171"
FT                   /product="putative leucyl-tRNA synthetase"
FT                   /note="best blastp match gb|AAK33273.1| (AE006486) putative
FT                   leucyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96973"
FT                   /db_xref="GOA:Q8P2T2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2T2"
FT                   /protein_id="AAL96973.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGNEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSGFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHLETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLVTTKEIVAENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   gene            161133..162566
FT                   /locus_tag="spyM18_0173"
FT   CDS_pept        161133..162566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33274.1| (AE006486)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96974"
FT                   /protein_id="AAL96974.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGAILAVLGPDIMSDVDLIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QFQFAKAKDKEAYYRGEAQ"
FT   gene            162637..162915
FT                   /locus_tag="spyM18_0174"
FT   CDS_pept        162637..162915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33275.1| (AE006486)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96975"
FT                   /protein_id="AAL96975.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   gene            163038..163523
FT                   /locus_tag="spyM18_0175"
FT   CDS_pept        163038..163523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33276.1| (AE006486)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96976"
FT                   /protein_id="AAL96976.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVQLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   gene            163614..164276
FT                   /locus_tag="spyM18_0176"
FT   CDS_pept        163614..164276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0176"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /note="best blastp match gb|AAK33277.1| (AE006486) putative
FT                   hexulose-6-phosphate synthase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96977"
FT                   /protein_id="AAL96977.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAMK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIRRIWG"
FT   gene            164227..165144
FT                   /locus_tag="spyM18_0177"
FT   CDS_pept        164227..165144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0177"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="best blastp match gb|AAK33278.1| (AE006486) putative
FT                   hexulose-6-phosphate isomerase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96978"
FT                   /protein_id="AAL96978.1"
FT                   /translation="MQRRVPSKMKSDVSGGNFMARPIGIYEKATPKQFTWRERLQFAKD
FT                   LGFDFVEMSVDESDARLARLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDP
FT                   AIEAKSLKLMKQCIELAQDLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEA
FT                   QVMLSIEIMDDPFINSIEKYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSI
FT                   AALHLKDTYAVTETSKGQFRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTV
FT                   EETKAAIKEAQDFLYPLIEKAGLA"
FT   gene            165083..165850
FT                   /locus_tag="spyM18_0178"
FT   CDS_pept        165083..165850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0178"
FT                   /product="putative L-ribulose 5-phosphate"
FT                   /note="best blastp match gb|AAK33279.1| (AE006486) putative
FT                   L-ribulose 5-phosphate 4-epimerase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96979"
FT                   /protein_id="AAL96979.1"
FT                   /translation="MLSKKLRTSFTHLLRKRGWHNMAKNLQEMRERVCAANKSLPQHGL
FT                   VKFTWGNVSEVCRELGRIVIKPSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHV
FT                   ELYKAWPEVGGIVHTHSTEAVGWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGA
FT                   YEQETGNVILEEFSKRGLDPMAVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVARMNRL
FT                   TEQINPRVEPAPRYIMDKHYLRKHGPNAYYGQK"
FT   gene            166178..167821
FT                   /locus_tag="spyM18_0179"
FT   CDS_pept        166178..167821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0179"
FT                   /product="putative transcriptional regulator"
FT                   /note="best blastp match gb|AAK33281.1| (AE006487) putative
FT                   transcriptional regulator [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96980"
FT                   /protein_id="AAL96980.1"
FT                   /translation="MILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKIN
FT                   QALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVST
FT                   ERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQY
FT                   LYKLLVDVYQGGNTSFIDIFNRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTINT
FT                   QDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFKF
FT                   HLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDLL
FT                   KQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDDI
FT                   AYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQY
FT                   QSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTEL
FT                   TKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   gene            168074..169165
FT                   /locus_tag="spyM18_0180"
FT   CDS_pept        168074..169165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33282.1| (AE006487)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96981"
FT                   /protein_id="AAL96981.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   gene            169655..170851
FT                   /locus_tag="spyM18_0181"
FT   CDS_pept        169655..170851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0181"
FT                   /product="putative glycine betaine/proline ABC transporter"
FT                   /note="best blastp match gb|AAK33283.1| (AE006487) putative
FT                   glycine betaine/proline ABC transporter (ATP-binding
FT                   protein) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96982"
FT                   /protein_id="AAL96982.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   gene            170867..172594
FT                   /locus_tag="spyM18_0182"
FT   CDS_pept        170867..172594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0182"
FT                   /product="putative glycine-betaine binding permease
FT                   protein"
FT                   /note="best blastp match gb|AAK33284.1| (AE006487) putative
FT                   glycine-betaine binding permease protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96983"
FT                   /protein_id="AAL96983.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKSATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAVFLIAALGRGIMTMASGMADKGETVNIAYVQWDSEVASTHV
FT                   IAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGP
FT                   NLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLSSWE
FT                   LVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENINTIA
FT                   RKGLKKELPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   gene            172725..175367
FT                   /locus_tag="spyM18_0184"
FT   CDS_pept        172725..175367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0184"
FT                   /product="DNA-directed DNA polymerase I"
FT                   /note="best blastp match gb|AAK33285.1| (AE006487)
FT                   DNA-directed DNA polymerase I [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96984"
FT                   /protein_id="AAL96984.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVRPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKASKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAAISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLGSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   gene            175554..176009
FT                   /locus_tag="spyM18_0185"
FT   CDS_pept        175554..176009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33286.1| (AE006487)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96985"
FT                   /protein_id="AAL96985.1"
FT                   /translation="MIYSFQNPSEDVLKAYLESAKTIAVVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVGIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   gene            176061..176528
FT                   /locus_tag="spyM18_0186"
FT   CDS_pept        176061..176528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0186"
FT                   /product="ferric transport regulator protein"
FT                   /note="best blastp match gb|AAK33287.1| (AE006487) Ferric
FT                   transport regulator protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96986"
FT                   /protein_id="AAL96986.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   gene            complement(176631..177494)
FT                   /locus_tag="spyM18_0187"
FT   CDS_pept        complement(176631..177494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0187"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33297.1| (AE006488)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96987"
FT                   /protein_id="AAL96987.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGGSTVISLIFLLFGAVLSLI
FT                   GFGIYINRYYAYSLSEYLLYDKVKEGTYLGAIAVIETSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   gene            177713..178855
FT                   /gene="tgt"
FT                   /locus_tag="spyM18_0189"
FT   CDS_pept        177713..178855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="spyM18_0189"
FT                   /product="putative tRNA-guanine transglycosylase"
FT                   /note="best blastp match gb|AAK33298.1| (AE006488) putative
FT                   tRNA-guanine transglycosylase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96988"
FT                   /db_xref="GOA:P66910"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66910"
FT                   /protein_id="AAL96988.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   gene            179073..179384
FT                   /locus_tag="spyM18_0191"
FT   CDS_pept        179073..179384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0191"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33299.1| (AE006489)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96989"
FT                   /protein_id="AAL96989.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   TDHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   gene            179388..179927
FT                   /locus_tag="spyM18_0193"
FT   CDS_pept        179388..179927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0193"
FT                   /product="putative biotin synthase"
FT                   /note="best blastp match gb|AAK33300.1| (AE006489) putative
FT                   biotin synthase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96990"
FT                   /protein_id="AAL96990.1"
FT                   /translation="MFTTKELVKVAMMTTLIIILGFIPAIPIGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALLISGVVLVDVLGAIWLAAYTGMSLVTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   gene            180066..180845
FT                   /locus_tag="spyM18_0195"
FT   CDS_pept        180066..180845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33301.1| (AE006489)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96991"
FT                   /protein_id="AAL96991.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVERIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYDGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPEGI
FT                   DPDNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   gene            180845..181324
FT                   /locus_tag="spyM18_0196"
FT   CDS_pept        180845..181324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK04819.1|AE006305_11
FT                   (AE006305) conserved hypothetical protein [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96992"
FT                   /db_xref="GOA:Q8P2R7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2R7"
FT                   /protein_id="AAL96992.1"
FT                   /translation="MPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGH
FT                   NAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGLARIPHVIY
FT                   GASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRERKKNS"
FT   gene            complement(181975..183207)
FT                   /locus_tag="spyM18_0197"
FT   CDS_pept        complement(181975..183207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0197"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33302.1| (AE006489)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96993"
FT                   /protein_id="AAL96993.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASTKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANMPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDHLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAI
FT                   LASLENQLLNRQEPLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   gene            complement(183668..184510)
FT                   /locus_tag="spyM18_0199"
FT   CDS_pept        complement(183668..184510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0199"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96994"
FT                   /protein_id="AAL96994.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVSLKVPKQRPLKKSLLLNIGSIIILNDSSTTSRQ"
FT   gene            184584..185306
FT                   /gene="speG"
FT                   /locus_tag="spyM18_0201"
FT   CDS_pept        184584..185306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="spyM18_0201"
FT                   /product="exotoxin G precursor"
FT                   /note="best blastp match gb|AAD30988.1|AF124499_1
FT                   (AF124499) exotoxin G precursor [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96995"
FT                   /protein_id="AAL96995.1"
FT                   /translation="MAKFILEFFNILTIIILSCVFSYGSQLAYADENLKDLKRSLRFVY
FT                   NITPCDYENIEIAFVTTNSIHINTKQKRSECILYVDSIVSLGITDQFIKGDKVDVFGLP
FT                   YNFSPPYVDNIYGGIVKHSNQGNKSLQFVGILNQDGKETYLPSEAVRIKKKQFTLQEFD
FT                   FKIRKFLMEKYNIYDSESRYTSGSLFLATKDSKHYEVDLFNKDDKLLSRDSFFKRYKDN
FT                   KIFNSEEISHFDIYLKTH"
FT   gene            185391..185510
FT                   /locus_tag="spyM18_0202"
FT   CDS_pept        185391..185510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0202"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96996"
FT                   /protein_id="AAL96996.1"
FT                   /translation="MRKYLQVIGASIAFVGVALCIDHMHDGVITRVEMIKSLK"
FT   gene            185762..187111
FT                   /gene="pgi"
FT                   /locus_tag="spyM18_0204"
FT   CDS_pept        185762..187111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="spyM18_0204"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="best blastp match gb|AAK33304.1| (AE006489)
FT                   glucose-6-phosphate isomerase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96997"
FT                   /db_xref="GOA:Q8P2R3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2R3"
FT                   /protein_id="AAL96997.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDKEEFARILTAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDNPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPVQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   gene            complement(187459..188967)
FT                   /locus_tag="spyM18_0205"
FT   CDS_pept        complement(187459..188967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0205"
FT                   /product="putative regulatory protein RofA related"
FT                   /note="best blastp match gb|AAK33305.1| (AE006489) putative
FT                   regulatory protein - RofA related [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96998"
FT                   /protein_id="AAL96998.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFAAQKNLQPSAFLDRRFLFFDVLLMLTWKRHRYPVHLPHLALF
FT                   EHLKSLPIFDNIKTIAVDELAPRTRVTFSSDNFDYLFLIYLTTDNSFLSGYWTSHQRQQ
FT                   LYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQ
FT                   YQGNMLLLDKLETVIKDWLYDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQ
FT                   ETVGNVIANFITSTIPSYKVELSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFP
FT                   KETRLFSLSLDCIQQQREDLIKTILALHQNHYQKRLEELWRVPS"
FT   gene            189655..190326
FT                   /locus_tag="spyM18_0208"
FT   CDS_pept        189655..190326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0208"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match emb|CAB90755.1| (AJ400707)
FT                   hypothetical protein [Streptococcus uberis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAL96999"
FT                   /protein_id="AAL96999.1"
FT                   /translation="MTRLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   gene            complement(190425..191324)
FT                   /gene="hasC2"
FT                   /locus_tag="spyM18_0210"
FT   CDS_pept        complement(190425..191324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasC2"
FT                   /locus_tag="spyM18_0210"
FT                   /product="putative UDP-glucose pyrophosphorylase"
FT                   /note="best blastp match sp|P58098|HAC2_STRPY
FT                   UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE 2 (UDP-GLUCOSE
FT                   PYROPHOSPHORYLASE 2) (UDPGP 2)
FT                   (ALPHA-D-GLUCOSYL-1-PHOSPHATE URIDYLYLTRANSFERASE 2)
FT                   (URIDINE DIPHOSPHOGLUCOSE PYROPHOSPHORYLASE 2)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97000"
FT                   /db_xref="GOA:P67070"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67070"
FT                   /protein_id="AAL97000.1"
FT                   /translation="MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQS
FT                   HPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVM
FT                   RVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILE
FT                   KQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLKAYIIQLGKALEKTKP"
FT   gene            complement(191357..192373)
FT                   /gene="gpdA"
FT                   /locus_tag="spyM18_0212"
FT   CDS_pept        complement(191357..192373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpdA"
FT                   /locus_tag="spyM18_0212"
FT                   /product="putative NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /note="best blastp match sp|P58143|GPDA_STRPY
FT                   GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+]
FT                   (NAD(P)H-DEPENDENT GLYCEROL-3-PHOSPHATE DEHYDROGENASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97001"
FT                   /db_xref="GOA:P68889"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68889"
FT                   /protein_id="AAL97001.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   gene            192671..193120
FT                   /locus_tag="spyM18_0213"
FT   CDS_pept        192671..193120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0213"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33311.1| (AE006490)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97002"
FT                   /protein_id="AAL97002.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   gene            193113..194819
FT                   /locus_tag="spyM18_0214"
FT   CDS_pept        193113..194819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0214"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="best blastp match gb|AAK33312.1| (AE006490) putative
FT                   ABC transporter, ATP-binding protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97003"
FT                   /protein_id="AAL97003.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVTSSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINHIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIMVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLAQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   gene            194822..196606
FT                   /locus_tag="spyM18_0215"
FT   CDS_pept        194822..196606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0215"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33313.1| (AE006490) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97004"
FT                   /protein_id="AAL97004.1"
FT                   /translation="MKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGESLTE
FT                   LGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHST
FT                   NRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIGL
FT                   VWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQK
FT                   AIIVQGVQEDTVTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTIV
FT                   LSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEEV
FT                   RPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPKGKMIAVVGPTGSGKTTIMN
FT                   LINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTISQ
FT                   YMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILDE
FT                   ATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHEL
FT                   LHQKGFYAELYHNQFVFE"
FT   gene            196724..197491
FT                   /locus_tag="spyM18_0218"
FT   CDS_pept        196724..197491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33314.1| (AE006490)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97005"
FT                   /protein_id="AAL97005.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKEAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   gene            197601..198047
FT                   /gene="dut"
FT                   /locus_tag="spyM18_0219"
FT   CDS_pept        197601..198047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="spyM18_0219"
FT                   /product="putative dUTPase, phage associated"
FT                   /note="best blastp match gb|AAK33315.1| (AE006490) putative
FT                   dUTPase, phage associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97006"
FT                   /protein_id="AAL97006.1"
FT                   /translation="MTKIRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDQPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   gene            198128..199489
FT                   /gene="radA"
FT                   /locus_tag="spyM18_0220"
FT   CDS_pept        198128..199489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="spyM18_0220"
FT                   /product="putative DNA repair protein"
FT                   /note="best blastp match gb|AAK33316.1| (AE006490) putative
FT                   DNA repair protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97007"
FT                   /db_xref="GOA:Q8P2Q5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2Q5"
FT                   /protein_id="AAL97007.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLKAVFS"
FT   gene            199677..200174
FT                   /locus_tag="spyM18_0221"
FT   CDS_pept        199677..200174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33317.1| (AE006491)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97008"
FT                   /protein_id="AAL97008.1"
FT                   /translation="MSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFAK
FT                   HIHEHLGVDVSGQDFLPFQDVEDSVRKDMAKLRASSLIPDDVVINGAVYDVDTGKMTQV
FT                   ME"
FT   gene            200305..201015
FT                   /locus_tag="spyM18_0222"
FT   CDS_pept        200305..201015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33318.1| (AE006491)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97009"
FT                   /protein_id="AAL97009.1"
FT                   /translation="MVDNRMRFTIDQNMQFPLVEIDLEHGGSVYLQQGSMVYHTENVTL
FT                   NTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNTPGQIVALELGEK
FT                   QYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGGLFVMTTEGLGTLLANSFGSIKKIT
FT                   LDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGHGEIYIQSLNLEQ
FT                   FAGTLKRYLPTSSN"
FT   gene            201197..202642
FT                   /gene="gluS"
FT                   /locus_tag="spyM18_0223"
FT   CDS_pept        201197..202642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluS"
FT                   /locus_tag="spyM18_0223"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /note="best blastp match gb|AAK33319.1| (AE006491) putative
FT                   glutamyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97010"
FT                   /db_xref="GOA:P67024"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67024"
FT                   /protein_id="AAL97010.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   gene            203036..204382
FT                   /locus_tag="spyM18_0224"
FT   CDS_pept        203036..204382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0224"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp match gb|AAK33320.1| (AE006491) putative
FT                   histidine kinase, possibly involved in competence
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97011"
FT                   /protein_id="AAL97011.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLFVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   gene            204379..205662
FT                   /locus_tag="spyM18_0226"
FT   CDS_pept        204379..205662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0226"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp match gb|AAK33321.1| (AE006491) putative
FT                   histidine kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97012"
FT                   /protein_id="AAL97012.1"
FT                   /translation="MMVIYSMALFYATIFINSWVIFAKVSAIKLSWKRVSIIGISFVIA
FT                   NMIFDKVILIDQLFFIIVSLLSAPKKKLFEHMFNGFFTILIVELLFRVIGSFFLPAVLG
FT                   FSIGQINNNLKLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKVKKWVFWMNTAMFS
FT                   YYFFAHFLVTVQSGFLALYFQYRSILVFIYLAIFIWVIVKLDRFAKDQLSQKLTQAQNE
FT                   RIAYLENYNQSIEQLYREIRTVKHDSENILISLKDSIDSGDIDLITRVYDTVIQQSATS
FT                   MMRTNYEISSLDNIKEAVIRSIMNSKLLEAQYLGIELYIEIPDVIDHLPIKLIDLIVLF
FT                   TGLVDNAIETAKGSRRPFLSIAYFKQDNKQLFIIENSTKTNRVDIAKRFDAQQQNSAHF
FT                   LTVLDSYPQITLSTKSDHYRLRQLLEMR"
FT   gene            205666..206406
FT                   /locus_tag="spyM18_0227"
FT   CDS_pept        205666..206406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0227"
FT                   /product="putative response regulator"
FT                   /note="best blastp match gb|AAK33322.1| (AE006491) putative
FT                   response regulator [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97013"
FT                   /protein_id="AAL97013.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFVPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   gene            206946..207305
FT                   /gene="rnpA"
FT                   /locus_tag="spyM18_0228"
FT   CDS_pept        206946..207305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="spyM18_0228"
FT                   /product="putative ribonuclease P protein component"
FT                   /note="best blastp match gb|AAK33323.1| (AE006491) putative
FT                   ribonuclease P protein component [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97014"
FT                   /db_xref="GOA:P66691"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66691"
FT                   /protein_id="AAL97014.1"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRGQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   gene            207271..208098
FT                   /locus_tag="spyM18_0229"
FT   CDS_pept        207271..208098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33324.1| (AE006491)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97015"
FT                   /db_xref="GOA:Q8P2P8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2P8"
FT                   /protein_id="AAL97015.1"
FT                   /translation="MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYL
FT                   FARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAG
FT                   KDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWV
FT                   ELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGV
FT                   VLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   gene            208110..209024
FT                   /locus_tag="spyM18_0230"
FT   CDS_pept        208110..209024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0230"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33325.1| (AE006491)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97016"
FT                   /protein_id="AAL97016.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPENINQKHAPAVNSADVEPEEIKATQKLEAEDTK
FT                   VVPLMPEDSPAQTPSNLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   gene            209339..209473
FT                   /gene="rpmH"
FT                   /locus_tag="spyM18_0232"
FT   CDS_pept        209339..209473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="spyM18_0232"
FT                   /product="50S ribosomal protein L34"
FT                   /note="best blastp match gb|AAK33326.1| (AE006491) 50S
FT                   ribosomal protein L34 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97017"
FT                   /db_xref="GOA:P66260"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66260"
FT                   /protein_id="AAL97017.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   gene            209747..210451
FT                   /locus_tag="spyM18_0233"
FT   CDS_pept        209747..210451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0233"
FT                   /product="putative N-acetylmannosamine-6-P"
FT                   /note="best blastp match gb|AAK33327.1| (AE006492) putative
FT                   N-acetylmannosamine-6-P epimerase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97018"
FT                   /db_xref="GOA:P65523"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65523"
FT                   /protein_id="AAL97018.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLMAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSRQEAGPDVALIEALCKAGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   gene            210500..211819
FT                   /locus_tag="spyM18_0234"
FT   CDS_pept        210500..211819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0234"
FT                   /product="putative sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="best blastp match gb|AAK33328.1| (AE006492) putative
FT                   sugar transporter sugar binding lipoprotein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97019"
FT                   /protein_id="AAL97019.1"
FT                   /translation="MNMKKLASLAMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTEEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMEKIAEWTKFYSPYYNTIDGF
FT                   AEMRTLWFPMVQAVSNGDEKPEDALKAFTEKANKTIKKTQ"
FT   gene            211924..212811
FT                   /locus_tag="spyM18_0236"
FT   CDS_pept        211924..212811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0236"
FT                   /product="putative sugar transport system (permease)"
FT                   /note="best blastp match gb|AAK33329.1| (AE006492) sugar
FT                   transport system (permease) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97020"
FT                   /protein_id="AAL97020.1"
FT                   /translation="MNVNKLKMRETLISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYS
FT                   MTDFTFVGFANYVRMFQDPIFMKSLINTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARS
FT                   FYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNYVLKYAHVIEQNISWLGDKHWALLAI
FT                   IVILLTTSVGQPIILYIAAMGNIDNSLMEAARVDGATEFQVFWNIKWPSLLPTTLYIAV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIAII
FT                   SFAQFKILGNDVEY"
FT   gene            212824..213654
FT                   /locus_tag="spyM18_0237"
FT   CDS_pept        212824..213654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0237"
FT                   /product="putative sugar transport protein (permease)"
FT                   /note="best blastp match gb|AAK33330.1| (AE006492) probable
FT                   sugar transport protein (permease) [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97021"
FT                   /protein_id="AAL97021.1"
FT                   /translation="MTKKKLTASDILTTVMLCVLTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSVFISVATMFLVCGTSSLAGYALAKKRFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   gene            213674..214129
FT                   /locus_tag="spyM18_0238"
FT   CDS_pept        213674..214129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match emb|CAC13833.1| (AL445565)
FT                   predicted coding region [Mycoplasma pulmonis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97022"
FT                   /protein_id="AAL97022.1"
FT                   /translation="MFYDRLKNISRYRGIHPHLDAAITFLQTTDLRQLAEGKYPILGEK
FT                   VFAVIQRNQLSKADNSLLEYHKRYADCHLLLAGNECIRYGIGNQAEVVPFEQEADIGFV
FT                   TCDRTYDLDLVDDSFAYFFPNEPHQPNNFNQAGEAVTKCLIKVLMAD"
FT   gene            214173..214835
FT                   /locus_tag="spyM18_0239"
FT   CDS_pept        214173..214835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0239"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33331.1| (AE006492)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97023"
FT                   /protein_id="AAL97023.1"
FT                   /translation="MTSKKQGLLHSLFNLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLVTTYRSHFKYYFKSGLRLGLIELGIMSICLLDLFLI
FT                   RNQSGLVFQGFKVLCVAVLFLVVILFLYAYPQAVKRDLSLSTLFKRSFLLAGLFFPWSF
FT                   AFLAFICLTIFSLQLSLLTLFGGVSLLAIIGISSLTYLYLIIMESLLRRFPLNNDIE"
FT   gene            214847..215761
FT                   /locus_tag="spyM18_0240"
FT   CDS_pept        214847..215761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0240"
FT                   /product="putative acylneuraminate lyase"
FT                   /note="best blastp match gb|AAK33332.1| (AE006492) putative
FT                   acylneuraminate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97024"
FT                   /protein_id="AAL97024.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGNISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYSVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDRIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIADKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   gene            215783..216721
FT                   /locus_tag="spyM18_0241"
FT   CDS_pept        215783..216721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0241"
FT                   /product="putative glucose kinase"
FT                   /note="best blastp match gb|AAK33333.1| (AE006492) putative
FT                   glucose kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97025"
FT                   /protein_id="AAL97025.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDEGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   gene            complement(216832..217662)
FT                   /locus_tag="spyM18_0242"
FT   CDS_pept        complement(216832..217662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33334.1| (AE006492)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97026"
FT                   /protein_id="AAL97026.1"
FT                   /translation="MPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTASEIV
FT                   KRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDYDALI
FT                   NKTYELVNEEKLLNLAKLIDASERVYFFGKGSSGLVAREMKLRFMRLGLICDAYSDTDG
FT                   FTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSLDIIP
FT                   VSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   gene            217914..218738
FT                   /locus_tag="spyM18_0243"
FT   CDS_pept        217914..218738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33335.1| (AE006492)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97027"
FT                   /protein_id="AAL97027.1"
FT                   /translation="MWLRSLCYNNIMTNKVEKLTIFDTHTHLNVAEFQGHEAEELALAQ
FT                   EMGVAYHNVVGFDQATISGALALADQYPHVYATIGWHPTEAGSYSEAVEESIVSQLSHP
FT                   KVIALGEIGLDYHWMEDPKELQIEVFKRQMQLAKDHDLPFVVHTRDALEDTYEVIKAAG
FT                   VGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKKALDIQEAAQHLPLDKILVETD
FT                   APYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVAKATTANAKRVFKLD"
FT   gene            218731..219300
FT                   /locus_tag="spyM18_0244"
FT   CDS_pept        218731..219300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33336.1| (AE006492)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97028"
FT                   /protein_id="AAL97028.1"
FT                   /translation="MTEKINIQEVLVVEGKDDTANLRRFYEVDTYETRGSAITEEDLER
FT                   INRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAVPSSKSKGRSLGVEH
FT                   ARFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRREYLGEKLRIGYANG
FT                   KQLLKRLELFGITLAEVEEVMETYEE"
FT   gene            219414..220286
FT                   /gene="ksgA"
FT                   /locus_tag="spyM18_0246"
FT   CDS_pept        219414..220286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="spyM18_0246"
FT                   /product="putative dimethyladenosine transferase"
FT                   /note="best blastp match gb|AAK33337.1| (AE006492) putative
FT                   dimethyladenosine transferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97029"
FT                   /db_xref="GOA:Q8P2N8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2N8"
FT                   /protein_id="AAL97029.1"
FT                   /translation="MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQKIVDTAEID
FT                   QNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQVVNQDILKA
FT                   DLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQREVADRISAE
FT                   PNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLIEVKDEDFF
FT                   FRVSRLSFVHRRKTLWNNLTSHFGKSEDIKTKLEKGLALADIKPSIRGEALSIQDFGKL
FT                   ADALKEVGL"
FT   gene            220709..221581
FT                   /locus_tag="spyM18_0247"
FT   CDS_pept        220709..221581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33338.1| (AE006493)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97030"
FT                   /db_xref="GOA:Q8P2N7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2N7"
FT                   /protein_id="AAL97030.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSLEELLPLLADKITVFMGQTGVGKS
FT                   TLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAED
FT                   LNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRE
FT                   TYKKVIKRK"
FT   gene            221591..222253
FT                   /locus_tag="spyM18_0248"
FT   CDS_pept        221591..222253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0248"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /note="best blastp match gb|AAK33339.1| (AE006493) putative
FT                   ribulose-phosphate 3-epimerase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97031"
FT                   /protein_id="AAL97031.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALNV"
FT   gene            222246..222878
FT                   /locus_tag="spyM18_0249"
FT   CDS_pept        222246..222878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33340.1| (AE006493)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97032"
FT                   /protein_id="AAL97032.1"
FT                   /translation="MSKVALFAGGDLSYISRDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSVSQKAFTDIKEKAELFITAHPEKSDTDTELALKEVCARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   gene            222880..224151
FT                   /locus_tag="spyM18_0250"
FT   CDS_pept        222880..224151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33341.1| (AE006493)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97033"
FT                   /protein_id="AAL97033.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEEINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   gene            224141..225079
FT                   /locus_tag="spyM18_0251"
FT   CDS_pept        224141..225079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0251"
FT                   /product="putative CMP-binding factor"
FT                   /note="best blastp match gb|AAK33342.1| (AE006493) putative
FT                   CMP-binding factor [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97034"
FT                   /protein_id="AAL97034.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVTEVRDYLEQMLFKIENATWQRIVRALYRKHDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTNRIFAMDNRSFYKPNY"
FT   gene            complement(225220..225636)
FT                   /locus_tag="spyM18_0253"
FT   CDS_pept        complement(225220..225636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0253"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97035"
FT                   /protein_id="AAL97035.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHWINHYP
FT                   KRLFNYKSPVEMLKLANFNLKFGLINIMQEFNLR"
FT   gene            225865..226680
FT                   /gene="purR"
FT                   /locus_tag="spyM18_0255"
FT   CDS_pept        225865..226680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="spyM18_0255"
FT                   /product="putative purine operon repressor"
FT                   /note="best blastp match gb|AAK33343.1| (AE006493) putative
FT                   purine operon repressor [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97036"
FT                   /protein_id="AAL97036.1"
FT                   /translation="MVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIAIIKKAFEE
FT                   GNIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIYLSDLLSTP
FT                   KILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDLKITEGSTV
FT                   SVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEFDSTLVGVA
FT                   VFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   gene            226671..229292
FT                   /locus_tag="spyM18_0256"
FT   CDS_pept        226671..229292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0256"
FT                   /product="putative surface exclusion protein"
FT                   /note="best blastp match gb|AAK33344.1| (AE006493) putative
FT                   surface exclusion protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97037"
FT                   /protein_id="AAL97037.1"
FT                   /translation="MDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDRASGETK
FT                   ASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHLKEQQDN
FT                   EQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQADQHSKETALSEQK
FT                   ASISVETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSSELEKAK
FT                   ADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMKAPQGYP
FT                   LEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFVDPDNLT
FT                   PEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRPSFVYGQ
FT                   PGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGIYDSIKY
FT                   MLFTDHLHGNTYGHAINFLRVDKHNPKAPVYLGFSTSNVGSLNEHFVMFPESNIANHQR
FT                   FNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQAKVSQL
FT                   QGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKLASLKAA
FT                   LHQTEALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLAKTTSSL
FT                   LNAQEALAALQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDLQVAPPL
FT                   TGVKPLSYSKIDTTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEMVASNAI
FT                   VSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTGFRFRKE
FT                   SR"
FT   gene            229500..229913
FT                   /gene="rpsL"
FT                   /locus_tag="spyM18_0258"
FT   CDS_pept        229500..229913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="spyM18_0258"
FT                   /product="30S ribosomal protein S12"
FT                   /note="best blastp match sp|P58172|RS12_STRPY 30S RIBOSOMAL
FT                   PROTEIN S12"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97038"
FT                   /db_xref="GOA:P66378"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66378"
FT                   /protein_id="AAL97038.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   gene            229934..230404
FT                   /gene="rpsG"
FT                   /locus_tag="spyM18_0259"
FT   CDS_pept        229934..230404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="spyM18_0259"
FT                   /product="30S ribosomal protein S7"
FT                   /note="best blastp match gb|AAK33346.1| (AE006493) 30S
FT                   ribosomal protein S7 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97039"
FT                   /db_xref="GOA:P66620"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66620"
FT                   /protein_id="AAL97039.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFNAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   gene            230772..232850
FT                   /gene="fusA"
FT                   /locus_tag="spyM18_0260"
FT   CDS_pept        230772..232850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="spyM18_0260"
FT                   /product="elongation factor G"
FT                   /note="best blastp match sp|P82477|EFG_STRPY ELONGATION
FT                   FACTOR G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97040"
FT                   /db_xref="GOA:P69948"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69948"
FT                   /protein_id="AAL97040.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   gene            233197..234207
FT                   /gene="gapA"
FT                   /locus_tag="spyM18_0261"
FT   CDS_pept        233197..234207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="spyM18_0261"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, plasmin
FT                   receptor"
FT                   /note="best blastp match sp|P50467|G3P_STRPY GLYCERALDEHYDE
FT                   3-PHOSPHATE DEHYDROGENASE (GAPDH) (PLASMINOGEN-BINDING
FT                   PROTEIN) (PLASMIN RECEPTOR)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97041"
FT                   /db_xref="GOA:P68777"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:6FZH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68777"
FT                   /protein_id="AAL97041.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLL
FT                   KYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKE
FT                   AAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSS
FT                   DIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   gene            complement(234433..234549)
FT                   /locus_tag="spyM18_0262"
FT   CDS_pept        complement(234433..234549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0262"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97042"
FT                   /protein_id="AAL97042.1"
FT                   /translation="MAEKTDLSSAYRRLKSPNIKTRKRALKIIHEYKRYGKK"
FT   gene            complement(234691..235431)
FT                   /locus_tag="spyM18_0263"
FT   CDS_pept        complement(234691..235431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0263"
FT                   /product="putative amino acid ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="best blastp match gb|AAK33349.1| (AE006494) putative
FT                   amino acid ABC transporter (ATP-binding protein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97043"
FT                   /protein_id="AAL97043.1"
FT                   /translation="MSNSIIEIKNLKKSYGSNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYREKLGMVFQSFNLFENLNVLENAIV
FT                   AQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPKQLSGGQKQRVAIARALSVNPEAM
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMEFARDVSDRIIFMDKGLIAEE
FT                   GSPQQIFENPTQDRTKEFLQRFLK"
FT   gene            complement(235424..236992)
FT                   /locus_tag="spyM18_0264"
FT   CDS_pept        complement(235424..236992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0264"
FT                   /product="putative glutamine-binding periplasmic protein"
FT                   /note="best blastp match gb|AAK33350.1| (AE006494) putative
FT                   glutamine-binding periplasmic protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97044"
FT                   /protein_id="AAL97044.1"
FT                   /translation="MKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPFNWTQDD
FT                   ASNGAVPIEGTSQYANGYDVQVAKKIAKAMNKELLVVKTSWTGLIPALTSGKIDMIAAG
FT                   MSPTKERRNEISFSNSYYTSQPVLVVTANGKYADATSLKDFSGAKVTAQQGVWHVNLLT
FT                   QLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKKGFAVAE
FT                   SDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKASFLGQM
FT                   WAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALGQKLFGW
FT                   LLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSEIVRGGI
FT                   FAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVVE
FT                   LYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRYIERRFDADTYTTGANQMQIA
FT                   EVSNV"
FT   gene            237190..239115
FT                   /locus_tag="spyM18_0265"
FT   CDS_pept        237190..239115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0265"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33351.1| (AE006494)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97045"
FT                   /protein_id="AAL97045.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRAGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVTWQLHHLLTAYQDVAELNLTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKNKIVALETKISRRRALLQLLFGKVIPLVEVGFLLWQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEIRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQVTPAEKRKS
FT                   NSVQGLGCLLLILNSGLLIYLAIKESGLALIYLALMVLTMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKVHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGG
FT                   GGGGAF"
FT   gene            239181..240020
FT                   /locus_tag="spyM18_0268"
FT   CDS_pept        239181..240020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0268"
FT                   /product="putative undecaprenol kinase"
FT                   /note="best blastp match gb|AAK33352.1| (AE006494) putative
FT                   undecaprenol kinase (bacitracin resistance protein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97046"
FT                   /db_xref="GOA:P67394"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67394"
FT                   /protein_id="AAL97046.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTELARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   gene            240166..240927
FT                   /locus_tag="spyM18_0269"
FT   CDS_pept        240166..240927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0269"
FT                   /product="putative negative regulator of genetic
FT                   competence"
FT                   /note="best blastp match gb|AAK33353.1| (AE006494) putative
FT                   negative regulator of genetic competence [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97047"
FT                   /db_xref="GOA:P60188"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60188"
FT                   /protein_id="AAL97047.1"
FT                   /translation="MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVM
FT                   DELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPEDFF
FT                   KSLEQSMREKGDVKAHEKLEKIEEIMEDVVEATLANQSEAADPSTNHESEPLDYVHYVL
FT                   DFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEHAN
FT                   PGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   gene            240934..242103
FT                   /gene="rgpG"
FT                   /locus_tag="spyM18_0270"
FT   CDS_pept        240934..242103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="spyM18_0270"
FT                   /product="putative regulator of genetic competence"
FT                   /note="best blastp match gb|AAK33354.1| (AE006494) possibly
FT                   involved in regulation of genetic competence [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97048"
FT                   /protein_id="AAL97048.1"
FT                   /translation="MFSFTIDYVLVLIGALLMSLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFMSFLVASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAMIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQKDFFLTLTILVLIAAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   gene            242225..242995
FT                   /locus_tag="spyM18_0273"
FT   CDS_pept        242225..242995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0273"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33355.1| (AE006494) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97049"
FT                   /db_xref="GOA:Q8P2M5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2M5"
FT                   /protein_id="AAL97049.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNADKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   gene            243090..244352
FT                   /locus_tag="spyM18_0275"
FT   CDS_pept        243090..244352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33356.1| (AE006495)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97050"
FT                   /protein_id="AAL97050.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPELELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKTSANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDANIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRILMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   gene            244383..245609
FT                   /locus_tag="spyM18_0276"
FT   CDS_pept        244383..245609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0276"
FT                   /product="putative aminotransferase"
FT                   /note="best blastp match gb|AAK33357.1| (AE006495) putative
FT                   aminotransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97051"
FT                   /protein_id="AAL97051.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLTNKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQSSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   gene            245596..246075
FT                   /locus_tag="spyM18_0277"
FT   CDS_pept        245596..246075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0277"
FT                   /product="putative NifU protein"
FT                   /note="best blastp match gb|AAK33358.1| (AE006495) similar
FT                   to NifU protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97052"
FT                   /protein_id="AAL97052.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   gene            246068..247486
FT                   /locus_tag="spyM18_0278"
FT   CDS_pept        246068..247486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33359.1| (AE006495)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97053"
FT                   /protein_id="AAL97053.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   gene            complement(247638..248819)
FT                   /locus_tag="spyM18_0279"
FT   CDS_pept        complement(247638..248819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0279"
FT                   /product="putative DD-carboxypeptidase"
FT                   /note="best blastp match emb|CAC21495.1| (AJ300704)
FT                   DD-carboxypeptidase [Enterococcus faecalis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97054"
FT                   /protein_id="AAL97054.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHAEDVIDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIVAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNYNHTFLLICLAIFIITILLLSLVVFAMGRQ"
FT   gene            complement(248987..250219)
FT                   /gene="dacA"
FT                   /locus_tag="spyM18_0280"
FT   CDS_pept        complement(248987..250219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="spyM18_0280"
FT                   /product="putative penicillin-binding protein"
FT                   /note="best blastp match gb|AAK33360.1| (AE006495)
FT                   penicillin-binding protein (D-alanyl-D-alanine
FT                   carboxypeptidase) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97055"
FT                   /protein_id="AAL97055.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFDGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   gene            250550..252520
FT                   /gene="oppA"
FT                   /locus_tag="spyM18_0281"
FT   CDS_pept        250550..252520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="spyM18_0281"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp match emb|CAA61522.1| (X89237)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97056"
FT                   /protein_id="AAL97056.1"
FT                   /translation="MKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVFVND
FT                   PKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLRDGV
FT                   SWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEVGVK
FT                   ALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAYFLS
FT                   AFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYPNDP
FT                   TYKSAKKNYADNITYGMLSGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDFRQA
FT                   IQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEWKDV
FT                   NLADAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFKQSV
FT                   EASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDIMSP
FT                   VGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAYLTD
FT                   NAVDIPVVALGGTPRVTKAVPFSGGFSWAGSKGPLAYKGMKLQDKPVTAKQYEKAKEKW
FT                   MKAKAKSNAKYAEKLADHVEK"
FT   gene            252585..254087
FT                   /gene="oppB"
FT                   /locus_tag="spyM18_0282"
FT   CDS_pept        252585..254087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="spyM18_0282"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp match gb|AAK33361.1| (AE006495)
FT                   oligopeptide permease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97057"
FT                   /protein_id="AAL97057.1"
FT                   /translation="MKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDPNYNK
FT                   MTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEKYIDS
FT                   LGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARYIRLE
FT                   KDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVISQGQG
FT                   RTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVDPSMI
FT                   HNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYVVRFL
FT                   GGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRFARSK
FT                   GLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSIKSAN
FT                   NSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   gene            254087..255013
FT                   /gene="oppC"
FT                   /locus_tag="spyM18_0283"
FT   CDS_pept        254087..255013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="spyM18_0283"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp match gb|AAK33362.1| (AE006495)
FT                   oligopeptide permease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97058"
FT                   /protein_id="AAL97058.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   gene            255022..256092
FT                   /gene="oppD"
FT                   /locus_tag="spyM18_0284"
FT   CDS_pept        255022..256092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="spyM18_0284"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp match gb|AAK33363.1| (AE006495)
FT                   oligopeptide permease (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97059"
FT                   /protein_id="AAL97059.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLEFNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   gene            256085..257008
FT                   /gene="oppF"
FT                   /locus_tag="spyM18_0285"
FT   CDS_pept        256085..257008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="spyM18_0285"
FT                   /product="oligopeptide permease"
FT                   /note="best blastp match gb|AAG32327.1| (AF305548)
FT                   oligopeptide permease [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97060"
FT                   /db_xref="GOA:Q8P2L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2L5"
FT                   /protein_id="AAL97060.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKDLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   gene            258098..259432
FT                   /locus_tag="spyM18_r07"
FT   rRNA            258098..259432
FT                   /locus_tag="spyM18_r07"
FT                   /product="16S ribosomal RNA"
FT   gene            259965..262865
FT                   /locus_tag="spyM18_r08"
FT   rRNA            259965..262865
FT                   /locus_tag="spyM18_r08"
FT                   /product="23S ribosomal RNA"
FT   gene            263296..263877
FT                   /locus_tag="spyM18_0300"
FT   CDS_pept        263296..263877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0300"
FT                   /product="putative competence protein"
FT                   /note="best blastp match gb|AAK33365.1| (AE006496) putative
FT                   competence protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97061"
FT                   /protein_id="AAL97061.1"
FT                   /translation="MHNEKSNRTLVSCCFFVVLFILGIVKKKRRLKMSIETRAAFEKVK
FT                   PIILKLKRHYYIQLWDRDDWLQEGHIILLQLLERYPELIEEEERLYRYFKTKFSSYLKD
FT                   LLRRQESQKRQFHKLAYEEIGEVAHAIPSRGLWLDDYVAYQEVIASLENQLNSQERMQF
FT                   KALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   gene            264379..264963
FT                   /locus_tag="spyM18_0301"
FT   CDS_pept        264379..264963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33367.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97062"
FT                   /protein_id="AAL97062.1"
FT                   /translation="MLFQKKYDKIESTNYFGDDMSIDDYRPTYMVEAIYDLRANDLLRH
FT                   GITAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNKHSRVERAVSRFGV
FT                   DFISRALKPFAYGIEKAIARYGFDRNEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   gene            264963..266081
FT                   /locus_tag="spyM18_0302"
FT   CDS_pept        264963..266081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33368.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97063"
FT                   /protein_id="AAL97063.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIERINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLSRFDFINGERQGFTAF
FT                   FDNQLELHRTKLAGADAFYDKHVGTLLTPPGKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNGQKDSKAIVAAWAPEGVAVIVRKAII"
FT   gene            266106..266414
FT                   /locus_tag="spyM18_0303"
FT   CDS_pept        266106..266414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33369.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97064"
FT                   /protein_id="AAL97064.1"
FT                   /translation="MLTSKQRAFLKSEAHSLKPIVQIGKNGLNDHIKTSIRQALDAREL
FT                   IKVTLLQNTDEDIHEVAEILEEEIGCDTVLKIGRILILYKVSAKKENRKLSPKVKAI"
FT   gene            266483..267115
FT                   /locus_tag="spyM18_0304"
FT   CDS_pept        266483..267115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33370.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97065"
FT                   /db_xref="GOA:Q8P2L2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2L2"
FT                   /protein_id="AAL97065.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLCMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMIYLTEQHPDVDYYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKQVLDYITQEGLYQ"
FT   gene            267112..267705
FT                   /locus_tag="spyM18_0305"
FT   CDS_pept        267112..267705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33371.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97066"
FT                   /protein_id="AAL97066.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECPDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LKDKDILRAIEIHTVGAAEMTLLDKVLYVADYIEEGRIFPLVDDARKIAKLDLNQAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEY"
FT   gene            267729..268082
FT                   /locus_tag="spyM18_0306"
FT   CDS_pept        267729..268082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33372.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97067"
FT                   /protein_id="AAL97067.1"
FT                   /translation="MKKEELLKIVVEATDEKRAKDILALDLEGLTSLTDYFVIASATNS
FT                   RQLEAIADNIREKVKEAGGDASHVEGNSQAGWVLLDLTDVVVHLFLEDERYHYNLEKLW
FT                   HEAPAVALDAYLA"
FT   gene            268082..268873
FT                   /locus_tag="spyM18_0308"
FT   CDS_pept        268082..268873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33373.1| (AE006496)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97068"
FT                   /protein_id="AAL97068.1"
FT                   /translation="MLQRDLVNTTGFLRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSL
FT                   RHLPKSKGRNRLLELACGTGIQSVRFAQAGFDVTGLDLSQDMLAIAKKRAQSAKKKIDF
FT                   IQGNMLDLSQVGQFDFVTCYSDSICYMQDEVDVGDVFKEVYDVLANDGIFIFDVHSTYQ
FT                   TDECFPGYSYHENADDFAMVWDTYADEGPHSVVHELTFFIQEDDGRFSRFDEVHEERTY
FT                   ELLTYDILLEQAGFKSFKVYADFEDKEPTKTSKRWFFVAYK"
FT   gene            269127..270233
FT                   /locus_tag="spyM18_0309"
FT   CDS_pept        269127..270233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33374.1| (AE006497)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97069"
FT                   /db_xref="GOA:Q7CNK9"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNK9"
FT                   /protein_id="AAL97069.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLETAEGLKIIAMSGNFMQRGEPALI
FT                   DKWIRSEMALKNGADIVVELPFFVSVQSADYFAQGAIDILCQLGIQQLAFGTENVIDYQ
FT                   KLIKVYEKKSEQMTAYLSTLEDTLSYPQKTQKMWEIFAGVKFSGQTPNHILGLSYAKAS
FT                   AGKHIQLCPIKRQGAAYHSKDKNHLLASASAIRQHLNDWDFISHSVPNAGLLINNPHMS
FT                   WDHYFSFLKYQILNHSDLTSIFQVNDELASRIKKAIKVSQNIDHLVDTVATKRYTKARV
FT                   RRILTYILVNAKEPTLPKGIHILGFTSKGQAHLKKLKKSRPLITRIGAETWDEMTQKAD
FT                   SIYQLGHQDIPEQSFGRIPIIIKNERLN"
FT   gene            270714..271430
FT                   /locus_tag="spyM18_0311"
FT   CDS_pept        270714..271430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33376.1| (AE006497)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97070"
FT                   /db_xref="GOA:P67190"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67190"
FT                   /protein_id="AAL97070.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   gene            271633..272475
FT                   /locus_tag="spyM18_0312"
FT   CDS_pept        271633..272475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33377.1| (AE006497)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97071"
FT                   /protein_id="AAL97071.1"
FT                   /translation="MVKKQYLGRATIALASTLVLAACGSSKKAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   gene            272803..273648
FT                   /locus_tag="spyM18_0314"
FT   CDS_pept        272803..273648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33378.1| (AE006497)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97072"
FT                   /protein_id="AAL97072.1"
FT                   /translation="MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQA
FT                   RWDKVEELLKKDNITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
FT                   "
FT   gene            273898..274962
FT                   /locus_tag="spyM18_0315"
FT   CDS_pept        273898..274962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0315"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33379.1| (AE006497) putative
FT                   ABC transporter (ATP-binding protein)h [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97073"
FT                   /db_xref="GOA:Q8P2K6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2K6"
FT                   /protein_id="AAL97073.1"
FT                   /translation="MNEAIIQLDHIDITFRQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFDQGKIQLSANALRQKRRDTGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSNPKEALTQKFITTATGIDEALEKINQQDIVKHLPANALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHIPVGDMIVVLEGQAENILAAEKAL
FT                   HEAGVDVSILKRGA"
FT   gene            274963..275655
FT                   /locus_tag="spyM18_0316"
FT   CDS_pept        274963..275655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0316"
FT                   /product="putative ABC transporter (permease protein)"
FT                   /note="best blastp match gb|AAK33380.1| (AE006497) putative
FT                   ABC transporter (permease protein) [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97074"
FT                   /protein_id="AAL97074.1"
FT                   /translation="MSQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGAIG
FT                   LLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAILASFTYLLLRTTLGAT
FT                   AALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFVIQFIGDS
FT                   LTRRFSHK"
FT   gene            complement(275709..277079)
FT                   /locus_tag="spyM18_0317"
FT   CDS_pept        complement(275709..277079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0317"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /note="best blastp match gb|AAK33381.1| (AE006497) putative
FT                   branched-chain amino acid transport protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97075"
FT                   /protein_id="AAL97075.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHQILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSGDVESLARPISKWYAILYSSILYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNTTNKAIYAILFFGLSYFLAIKPSKLAENIGKFLTPTLLVVISILVIA
FT                   SFVHPAGNYGDAFNAGVGVNNAFKDFPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKITLISGAIAILLLALVYIFVGRIGATSQSLFPFSDGSFTLHGNPVNGGQI
FT                   LSHASRFYLGGIGQAFLAVVIFLACLTTSTGLITSSAEYFHKLVPALSHIAWATIFTLL
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKYFNNDPIVYRTTIGLTFIPAI
FT                   FDALLTLSQMTGLFNLPEPVTTFFQKTVPLGQFSMGWIIFAIIGFLLGFILSKTKKS"
FT   gene            277313..278527
FT                   /locus_tag="spyM18_0318"
FT   CDS_pept        277313..278527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0318"
FT                   /product="putative sodium/dicarboxylate symporter"
FT                   /note="best blastp match gb|AAK33382.1| (AE006497) putative
FT                   sodium/dicarboxylate symporter [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97076"
FT                   /db_xref="GOA:Q8P2K3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2K3"
FT                   /protein_id="AAL97076.1"
FT                   /translation="MKKIYDLWVRVSLIKKIGIGVVIGVMLGILAPDLTGFSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGRQTNMTLIIFLYLFGTFASALVAVLTAYLFPLTL
FT                   VLNTPVNTELSPPQGVAEVFQSLLLKLVDNPINALATANYIGVLSWAIIFGLALKAASQ
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFTTISENGVGILSDYAFLILVLVGTMV
FT                   FVALVVNPLIAVLITRQNPYPLVLRCLRESGLTAFFTRSSAANIPVNMQLCQKIGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIPIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKKA"
FT   gene            complement(278582..279256)
FT                   /locus_tag="spyM18_0320"
FT   CDS_pept        complement(278582..279256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33383.1| (AE006497)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97077"
FT                   /protein_id="AAL97077.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   gene            complement(279266..280657)
FT                   /locus_tag="spyM18_0321"
FT   CDS_pept        complement(279266..280657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0321"
FT                   /product="putative V-type Na+-ATPase subunit J"
FT                   /note="best blastp match gb|AAK33384.1| (AE006497) putative
FT                   V-type Na+ -ATPase subunit J [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97078"
FT                   /protein_id="AAL97078.1"
FT                   /translation="MSGGNMKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNG
FT                   PNTVYLDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTIAMALMQIGGLGLVTLIAVSTFA
FT                   LKRKMRLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFSLEAFAAIVIMIDFIPRFGWKN
FT                   GIFNSIFLAVSAFCNAGFDNLGSSSLKDFMLNPTLNVIITFLIISGGLGFAVWVDLGVA
FT                   FKKYFFERPHCYGATFRKLSNQSRLVLQTTAVILFLGTFLTWFLEKDNSKTIANFSLHQ
FT                   QLMVSFFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITF
FT                   LLFKAELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMIGFILLLSVEPHIAPIPLL
FT                   FESISAIATVGVSMDLTPQLSTAGRLIVIVLMFVGRVGPITVLISLIQRKEKTIQYATT
FT                   DILVG"
FT   gene            complement(280727..281440)
FT                   /gene="gidB"
FT                   /locus_tag="spyM18_0323"
FT   CDS_pept        complement(280727..281440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="spyM18_0323"
FT                   /product="putative glucose-inhibited division protein"
FT                   /note="best blastp match gb|AAK33385.1| (AE006497) putative
FT                   glucose-inhibited division protein [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97079"
FT                   /db_xref="GOA:Q8P2K1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2K1"
FT                   /protein_id="AAL97079.1"
FT                   /translation="MTPQDFYRTLEEDGFSLSSKQKEQFDTYFKLLVEWNTKINLTAIT
FT                   EENEVYLKHFYDSIAPILQGFLANEPIKLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRISFLTLLAQELGLENVHFFHGRAEDFGQDKAFRGQFDVVTARAVARMQVLSELTIPF
FT                   LKIRGKLIALKAQAADQELEEAKNALCLLFGKVIKNHSYQLPNGDSRFITIVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   gene            281590..282147
FT                   /gene="lemA"
FT                   /locus_tag="spyM18_0324"
FT   CDS_pept        281590..282147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="spyM18_0324"
FT                   /product="putative cytoplasmic membrane protein"
FT                   /note="best blastp match gb|AAK33386.1| (AE006498) putative
FT                   cytoplasmic membrane protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97080"
FT                   /protein_id="AAL97080.1"
FT                   /translation="MPTVLIILVVLGVLALWLMISYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYASYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTSLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLQLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   gene            282194..283090
FT                   /gene="htpX"
FT                   /locus_tag="spyM18_0325"
FT   CDS_pept        282194..283090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="spyM18_0325"
FT                   /product="putative heat shock protein"
FT                   /note="best blastp match gb|AAK33387.1| (AE006498) putative
FT                   heat shock protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97081"
FT                   /db_xref="GOA:Q8P2K0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2K0"
FT                   /protein_id="AAL97081.1"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVL
FT                   ALVIGVIYATSMIFQSTSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPQNAAVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAVTVISSIGGRMLWYGGGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAIS
FT                   RQREYLADASSVELTRNPQGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSL
FT                   FSTHPPIEERIERLKNM"
FT   gene            283324..283857
FT                   /locus_tag="spyM18_0326"
FT   CDS_pept        283324..283857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33388.1| (AE006498)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97082"
FT                   /protein_id="AAL97082.1"
FT                   /translation="MLAISEIRKHPDGLSFDRLCDVKSMLLERDQQIIDIKAVKAVGNV
FT                   RYDRGLYLLDYQLSYEVILPSSRSMVPVCLSEVQHIQELFIEATDLADKKELVEDNLVL
FT                   VLDKDAINLEESIVDNILLAIPLQVLTEEEKKSKELPAGQNWAVLTEEDYQCLKEEKQK
FT                   ENNPFASLQGLFDE"
FT   gene            284124..284810
FT                   /gene="covR"
FT                   /locus_tag="spyM18_0328"
FT   CDS_pept        284124..284810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covR"
FT                   /locus_tag="spyM18_0328"
FT                   /product="CovR"
FT                   /note="best blastp match gb|AAC64935.1| (AF082668) CsrR
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97083"
FT                   /protein_id="AAL97083.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEK
FT                   EFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRATFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEIPLTKREYDLL
FT                   NILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   gene            284816..286318
FT                   /gene="covS"
FT                   /locus_tag="spyM18_0329"
FT   CDS_pept        284816..286318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covS"
FT                   /locus_tag="spyM18_0329"
FT                   /product="CovS"
FT                   /note="best blastp match gb|AAC64936.1| (AF082668) CsrS
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97084"
FT                   /protein_id="AAL97084.1"
FT                   /translation="MENQKQKQKKYKNSLPKRLSNIFFVLFFCIFSAFTLIAYSSTNYF
FT                   LLKKEKQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRKGSRVIRSER
FT                   DITNTLDANQDIYVYNIDKQMIFTTDNEESSPGLHGPIGRVYHDHIEDQYRGFSMTQKV
FT                   YSNRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILITTRRFLKPLH
FT                   NLHEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKLETHTKLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQNDMTVLEDSIETVVGNFRVLREDFIFTWQSENPKTIARIYKNHFEQALMILIDNAVK
FT                   YSRKEKKIAINLSVTGKQEAIVRVQDKGEGISKEDIEHIFERFYRTDKSRNRTSTQAGL
FT                   GIGLSILKQIVDGYHLQMKVESELNEGSVFILHIPLAQSNES"
FT   gene            286533..287027
FT                   /locus_tag="spyM18_0330"
FT   CDS_pept        286533..287027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33390.1| (AE006498)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97085"
FT                   /db_xref="GOA:P67322"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67322"
FT                   /protein_id="AAL97085.1"
FT                   /translation="MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTYENEVS
FT                   STAIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITNRVRGKKKRLNNDET
FT                   N"
FT   gene            287011..288186
FT                   /locus_tag="spyM18_0331"
FT   CDS_pept        287011..288186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0331"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33391.1| (AE006498)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97086"
FT                   /protein_id="AAL97086.1"
FT                   /translation="MMKPIDTFTYLKRNKVTLDSVTLIQLYFPIIGSDAVSIYQYFIHF
FT                   FDDGLQRHKFSEILNHLQFGMKRFEDALAILTAMELVSVYQLSDTYLITLHQPLSRDLF
FT                   FQHPAYSRLLEQKIGEVAVSELQVTVPSQARNISKRFSDIFGVQGDLTNVPQKPQKNFD
FT                   LSSFQQLMVRDGLQFEDNQKDIISLYSIAEQYDMTWFDTYQIAKATAVNGKIRPERLLA
FT                   KKNQSMTKPSKENFSQAEQIILREAKQDSALVFLEKIKKARRATITKDERILLQTLAKM
FT                   NFLDDVINVMVLYTFNKTKSANLQKSYVLKMANDFAYQKVSTAEEAIVVLRAFTDRQSR
FT                   RQSKVKTSQSNVPKWSNPDYQETTSQEEQAKLDQFKQAALKRLENLGKGGD"
FT   gene            288208..289089
FT                   /locus_tag="spyM18_0332"
FT   CDS_pept        288208..289089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0332"
FT                   /product="putative primosome component (helicase loader)"
FT                   /note="best blastp match gb|AAK33392.1| (AE006498) putative
FT                   primosome component (helicase loader) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97087"
FT                   /protein_id="AAL97087.1"
FT                   /translation="MAKLGQNTRVNSDQLIQTILADPEVASFISQHHLSQEQINLSLSK
FT                   FNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAAISERIQL
FT                   VSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSAEQKGLYLYGDMGIGKSYLLA
FT                   AMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDDIGAEQAT
FT                   SWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWATIKGSDETWQAKRVMERVRYL
FT                   AREFHLEGANRR"
FT   gene            289152..290462
FT                   /locus_tag="spyM18_0334"
FT   CDS_pept        289152..290462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0334"
FT                   /product="putative phosphoglycerate dehydrogenase"
FT                   /note="best blastp match gb|AAK33393.1| (AE006498) putative
FT                   phosphoglycerate dehydrogenase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97088"
FT                   /db_xref="GOA:P64065"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64065"
FT                   /protein_id="AAL97088.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEAEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTIDKDNHTVAKWEADIRDQFQFLTYAPIIFVSALTKQRLNKLP
FT                   DLIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   gene            290672..293767
FT                   /gene="snf"
FT                   /locus_tag="spyM18_0335"
FT   CDS_pept        290672..293767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="spyM18_0335"
FT                   /product="putative SNF helicase"
FT                   /note="best blastp match gb|AAK33394.1| (AE006498) putative
FT                   SNF helicase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97089"
FT                   /protein_id="AAL97089.1"
FT                   /translation="MARLIPGRVRNEGIKLYEQGLVSFQDDNKGILQIEVETYQVQYGA
FT                   DDEDITCQCDTFHMKHYCKHIAAVEYFLKNDQKGKLFLKQLTNQTKIKETTKKITSFGS
FT                   LFLDSLAMNEDDSVKYRLSALGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQLIK
FT                   KEGFYQIGKNCFEQLSWLQFDPSSQDLIEFLWRLASDTDKGDNENIFPNHARHLRLPSG
FT                   FFEEGIHYLTSLYDFTFEGPSQTYHHLFVRSLEAEAGLYEFKVEVHRKSIELQIAEKNV
FT                   QYLFDNDYLLYQDTFYHLTLKQRKMVQAIRSLPIEADLAKHIHFDLDDHAKLAASLSDF
FT                   KQIGLVEAPKSFAIRDFEVTFQFDLLNRDEISCQLMFDYGNYQVSDKASLEALPFASHL
FT                   KKEEKINRSLLAFGFSPQFYSKKRLTSAKELYTFFEETVPCFERLGNVALSTAIQALQV
FT                   KEMPKIAIKRNQGLLDISFDFSTIIENDIDQAVTALFQNNPYFVSQTGQLVVFDDETQK
FT                   VSKSLQELRARQLKNGHLQLDGIRALQVSKLFEGMTSVHFSKELEELAYHLQHPETFSI
FT                   KPLPVKAQMRDYQRNGVQWLSMLNHYGFGGILADDMGLGKTLQTLAFLASHLKSDSKVL
FT                   ILSPSSLIYNWFDECQKFTPQLDVVVSYGLKQIRDQIIEEGHQITITSYSSFRQDFETY
FT                   QAFHYDYLILDEAQVIKNAQTKISHCLRAFNTANCFALSGTPIENKMLEIWSIFQIVLP
FT                   GLLPTKKEFLKLTAEQVSRYIKPFVMRRKKEDVLPELPDLIETNYSNEMTDEQKAIYLA
FT                   QLRQMQDQIRNSSDVDISRQKIEILSGITRLRQICDTPSLFMNYQGKSGKLDSLRILLT
FT                   QIKENGHRALIFSQFRGMLDLAKQEMTALGLTSYQMTGSTPANERQEMTRAFNNGSKDA
FT                   FLISLKAGGVGINLTGADTVILIDLWWNPAVEMQAISRAYRIGQKENVEVYRLITRGTI
FT                   EEKILELQESKRNLVTTVLDGNESRASMSIEEIKEILGLNTH"
FT   misc_feature    293779..293796
FT                   /note="phi SpeA attL"
FT   misc_feature    293783..332797
FT                   /note="phi speA"
FT   gene            complement(293882..295078)
FT                   /gene="int"
FT                   /locus_tag="spyM18_0336"
FT   CDS_pept        complement(293882..295078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="spyM18_0336"
FT                   /product="putative integrase"
FT                   /note="best blastp match pir||C75509 probable integrase -
FT                   Deinococcus radiodurans (strain R1)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97090"
FT                   /protein_id="AAL97090.1"
FT                   /translation="MKYNKTKYPNIFWYETLKGKRYYIRRSYFFQGKKKEITKSGLKTI
FT                   PEARAALTEIEKQINEKSIGINMNITVSGYWEIFHEKRVATKRWTPNTEETYKSLMKNN
FT                   ILKEYGSVKLRNLNRNDYEVYIANMLMTKPRESVKCINNCFMAMLNDAVLNGNIPANRL
FT                   KGIYVGESTIPPKNKKVTMEQFQEWFIKAEQMMDKIFFSLTYLTIFGLRRGEIFGIRQM
FT                   DIRFHHDGRAILKLHDSRSNHTKNGRHGLKTKESERYVMLDLKGTELLLFLRDNATAIK
FT                   KRLSIIKDKEWDYISIKEDGNLINPNKLNDEFEKVNESVGFRVTPHMMRHFFTTQSIIA
FT                   GVPMEALSKALGHTKMYMTDKYNQVHDELSVQVTDTFSAFLDNNISRLNSPTEGKKAR"
FT   gene            complement(295389..296129)
FT                   /locus_tag="spyM18_0338"
FT   CDS_pept        complement(295389..296129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0338"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB41605.1| (AP003130)
FT                   hypothetical protein [Staphylococcus aureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97091"
FT                   /protein_id="AAL97091.1"
FT                   /translation="MDKFQKSNLEKLNLSTEKMKQLTVENPNHFKTSRLGQSMTNYSNQ
FT                   LEREIRGKRRRNRTFHYGTVVYVDFGINFGSEFSAPHYAITLEKSDSKNKNTITVIPLT
FT                   SKPGRNNLKLEFNLAQGLGLLTHQLIQSAQQKVEEEIKTKYNNKELREVFEDLETQGKD
FT                   DEIERIDALLVKLEDSVDQAFTRLKKYRSDLDKTTYAKIDAITTIDKIKIFKQIGPLDA
FT                   LGIAQLLEPQMKIISDEIKSRYLI"
FT   gene            complement(296140..296532)
FT                   /locus_tag="spyM18_0339"
FT   CDS_pept        complement(296140..296532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0339"
FT                   /product="orf122 phage protein"
FT                   /note="best blastp match ref|NP_049992.1| orf122 gp
FT                   [Streptococcus thermophilus bacteriophage Sfi21]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97092"
FT                   /protein_id="AAL97092.1"
FT                   /translation="MSVSTKQLVQTYGYELVFYDDRGADKKAFANHECKVIGIGSYLEE
FT                   KEKKKAIYHELGHRDHTLTQYELNRELCELQADRCMIHHLLKEELSHWDNIEDFNYVHF
FT                   MEKYELTSLADESMVIEEFYNLAKII"
FT   gene            complement(296536..296886)
FT                   /locus_tag="spyM18_0340"
FT   CDS_pept        complement(296536..296886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0340"
FT                   /product="putative repressor protein"
FT                   /note="best blastp match gb|AAF12710.1|AF066865_8
FT                   (AF066865) repressor protein [bacteriophage TPW22]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97093"
FT                   /protein_id="AAL97093.1"
FT                   /translation="MFPTFEKIKELADRQGISINKLEENLGYSRNTIYNLKTKKPNAER
FT                   IAEIADYFNVSTDYLLGRTDNPKIANSTISKEKIDFKKIAAESMSYDGKSLTDDDIDLI
FT                   AAVLEQRFKNRD"
FT   gene            297175..297450
FT                   /locus_tag="spyM18_0341"
FT   CDS_pept        297175..297450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0341"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97094"
FT                   /protein_id="AAL97094.1"
FT                   /translation="MPMEKLAKSFLSDIEATVKLIDTIADSAFVELLKECDNLSELETR
FT                   TFHFNKYPDLPAETATICEMVASRVRKMASAYIDNEKSQHKIVLGE"
FT   gene            297485..297697
FT                   /locus_tag="spyM18_0342"
FT   CDS_pept        297485..297697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0342"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97095"
FT                   /protein_id="AAL97095.1"
FT                   /translation="MSQQHQIWIDLVKEKMSQKGWNRSDLAQVAGVSTTMISRLLNEGH
FT                   GSDEFKKHISDKLGIREPWELFEEK"
FT   gene            297771..297905
FT                   /locus_tag="spyM18_0343"
FT   CDS_pept        297771..297905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0343"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97096"
FT                   /protein_id="AAL97096.1"
FT                   /translation="MTAKIISNWQKKNHQLSQLMIDSLEGLDVWETILILGKIRKGIL"
FT   gene            298577..299296
FT                   /locus_tag="spyM18_0344"
FT   CDS_pept        298577..299296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0344"
FT                   /product="putative antirepressor"
FT                   /note="best blastp match emb|CAC28354.1| (AJ004687)
FT                   putative antirepressor [Neisseria gonorrhoeae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97097"
FT                   /protein_id="AAL97097.1"
FT                   /translation="MNEIFNFNGQKVRTLTINNEPYFVGKDVADVLGYQNPQKAIRDHV
FT                   DFDDKLTEQIVQSGQNREMIIINESGLYSLILSSKLQQAKEFKRWVTSEVLPQIRKQGA
FT                   YVPENLSDEAFIALFQGQKKLKQQQQELAQDVDYLKNEQPIHPSFAQALLKKRKSRVVM
FT                   WLGGIDSPAYGDKVFAQSVFREAEMDFKAHFNVSRYDMLPKKFEDAALSYWMTWEPSTN
FT                   TKMKIADLNRSSQLYLV"
FT   gene            299310..299627
FT                   /locus_tag="spyM18_0345"
FT   CDS_pept        299310..299627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0345"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97098"
FT                   /protein_id="AAL97098.1"
FT                   /translation="MREHALNKNEQLDYITKEIAMDKILLSLSDWIKSIIKDTLNKLIE
FT                   IESENDNYPELMDISTTSNFLGIGETTFRNQYRYMQDFPKELPAKRWSKRAIKKWLSEQ
FT                   L"
FT   gene            299720..299911
FT                   /locus_tag="spyM18_0346"
FT   CDS_pept        299720..299911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0346"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97099"
FT                   /protein_id="AAL97099.1"
FT                   /translation="MKELINEPKRLTNYYADLAIKESKDFSEAMNLIQEFSDLSVLGNA
FT                   IKKAIQDEIVKRALNSKI"
FT   gene            300207..301547
FT                   /locus_tag="spyM18_0348"
FT   CDS_pept        300207..301547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0348"
FT                   /product="putative DNA polymerase III delta prime subunit"
FT                   /note="best blastp match gb|AAK34812.1| (AE006635) DNA
FT                   polymerase III delta prime subunit [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97100"
FT                   /protein_id="AAL97100.1"
FT                   /translation="MEDFKMLPHDPVSEQAVLGSIFINPEKIIEVAEYLKPDDFYKPAH
FT                   RILFKAMLSISGNAEPIDVVTVKSVLESQDNLATIGGITYLLEVVNAVPTSAHAEHYAK
FT                   IVAKKAQLRSIIDNLSDSIGNAYDENMDIDEIIAKTERSLIEVSQSSNKSSFRPIHDVL
FT                   AENYQKIEERSNNNTQITGIATGFYDFDKLTTGLHEDQLIILAARPAMGKTAFALNIAQ
FT                   NVATKSNKAVAVFSLEMGAESLVERMLANEGTIESHHIRTGQLTVEEWQRLIYVQGELA
FT                   EAPIFIDDTAGVKITDIRARARRLSQETDGLGLIVIDYLQLIQGSRSDNRQQEVSEISR
FT                   QLKILAKELKVPVIALSQLSRSVEQRQDKRPIMSDLRESGSIEQDADIVAFLYRDDYYT
FT                   DKSDDQPESNLTELIIKKNRHGSLGTVNLYFHKEYTKFSSVREEKND"
FT   gene            301540..302301
FT                   /locus_tag="spyM18_0349"
FT   CDS_pept        301540..302301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0349"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match ref|NP_038304.1| ORF4
FT                   [Streptococcus thermophilus bacteriophage 7201]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97101"
FT                   /protein_id="AAL97101.1"
FT                   /translation="MIKKSEVTGFLAFFKFPKPFIYDGKYKTLSNNAKLMYMLLFGRLE
FT                   LSIKNGWHDKEGNVFQYYTNEQLMVDLNSSEKTIIKFKKELKDVGLLEEVRQGNNLPNR
FT                   IYISAVDGTVNSTVSELEILQHGTVKNTVSELEILQTNKTNINKTENNNNKLLICKEVI
FT                   SYLNLNANKNFKVDTASHHKFIKARLKEGYTLEDFKKVVDVMSARWIGTEYEQYLQPQT
FT                   LFGNKMDNYLNTTMPKRSQLLASAVDERLGF"
FT   gene            302301..303113
FT                   /locus_tag="spyM18_0350"
FT   CDS_pept        302301..303113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0350"
FT                   /product="putative phage DNA replication protein"
FT                   /note="best blastp match gb|AAK05517.1|AE006372_16
FT                   (AE006372) prophage pi3 protein 46, DNA replication protein
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97102"
FT                   /protein_id="AAL97102.1"
FT                   /translation="MKFQTKEVLGELCEVHGCQLWMTLVPIKGKLEQLKQCPECTKAAI
FT                   GIFEKKLNAESEVNSKLADTYAVFNRDSLISDKLRAKSLDNYEIKSEIDQKAINFVKRM
FT                   EQFYRQDKTGNAIVTGPSGVGKSHLTYGFAKWLNEQFKAYDNPKSVLFVSVVSLFNKIE
FT                   ESFTVDNGFSKAKMVDLLTRVDYLFLDDLGKESRKDGNKAKNEWRHQVLYEILDNRSNT
FT                   IINTNLSSKDIKQLYSDDFGNGALSSRILEGVTGNSFVYPQETEDRRY"
FT   gene            303110..303340
FT                   /locus_tag="spyM18_0351"
FT   CDS_pept        303110..303340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0351"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97103"
FT                   /protein_id="AAL97103.1"
FT                   /translation="MMFKLQHIVNGFYPITIGNFDNVQDAVDAIKSHVRANSAIINPRY
FT                   AKSMSGEAIRIDYGAKDCYYLLTLINEANGC"
FT   gene            303330..303479
FT                   /locus_tag="spyM18_0352"
FT   CDS_pept        303330..303479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0352"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97104"
FT                   /protein_id="AAL97104.1"
FT                   /translation="MDARTGGNMTVKELIAKLQEFPDFMNVKISLIDVERTDISEITIS
FT                   AIGC"
FT   gene            303496..303939
FT                   /locus_tag="spyM18_0353"
FT   CDS_pept        303496..303939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0353"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33873.1| (AE006543)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97105"
FT                   /protein_id="AAL97105.1"
FT                   /translation="MIPKYRAFNKKTKKMYGVDGFRAFERKIYRCSLADDEFRHGHMET
FT                   IHFVEDSLDDYILMQSTGLFDENGEETFEGDIVMTTRFKIRADEIGGCYEYEKDYKGIV
FT                   KLLEGSWVIDTGKDAVNLWTEIEENIVIGNSYENPELLERLEG"
FT   gene            304103..304372
FT                   /locus_tag="spyM18_0355"
FT   CDS_pept        304103..304372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0355"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34273.1| (AE006582)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97106"
FT                   /protein_id="AAL97106.1"
FT                   /translation="MTEQQMIDCLLYELVTKDKAIKKKSIIIAALIAVLCLVSVFSIAL
FT                   QSHYKPQIAGLRTQLSRTQKQLKRASEQNQRQTKWIAELTGNGG"
FT   gene            304362..305006
FT                   /locus_tag="spyM18_0356"
FT   CDS_pept        304362..305006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0356"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33636.1| (AE006521)
FT                   conserved hypothetical protein, phage associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97107"
FT                   /protein_id="AAL97107.1"
FT                   /translation="MGGDMIKIDEIHRILGIDEVYKAPKRLMDILFDKDSREDIFRQFL
FT                   DIETDLSYDWFMRYFEDEHADRKNKKQDFTPLSVSKLLTGLVSGHTYHESAVGTGGILI
FT                   QAWQRHRISSNPFTYKPSDYWYQVEELSDRALPFLLFNMSIRGINGVVVHGDSLTRQVK
FT                   NIYFLQNTKDDMLSFSDINVMPRTQDIEQEFNVKEWIGDAIVHVESKLNTR"
FT   gene            305011..305496
FT                   /locus_tag="spyM18_0357"
FT   CDS_pept        305011..305496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0357"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33874.1| (AE006543)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97108"
FT                   /protein_id="AAL97108.1"
FT                   /translation="MNIEEAIKKIRELEAFNYSDFKGNLIRRIDVLGIIDQLKVIVQQC
FT                   VADWYEKHKDNLEYDLYLYQMSIYDEKVEEDDFYYWMQKSKNPVRTLINMHQFGYEIEQ
FT                   EQLYTVDLPNGQPLVRGKNTLYFSQNLTAENAKLTESEIRKDFDWAWREGFAKEVRE"
FT   gene            305493..305714
FT                   /locus_tag="spyM18_0358"
FT   CDS_pept        305493..305714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0358"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97109"
FT                   /protein_id="AAL97109.1"
FT                   /translation="MNNLEKIREEKGISDVQLSSVVQKILEEKYIKGLRFEQVNALTIM
FT                   CELGYIHFDKRLSEVYEQALNSIGDYKK"
FT   gene            305711..306103
FT                   /gene="ssb"
FT                   /locus_tag="spyM18_0359"
FT   CDS_pept        305711..306103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="spyM18_0359"
FT                   /product="putative single strand binding protein"
FT                   /note="best blastp match gb|AAK34552.1| (AE006609) putative
FT                   single strand binding protein - phage associated ?
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97110"
FT                   /db_xref="GOA:Q8P2H3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2H3"
FT                   /protein_id="AAL97110.1"
FT                   /translation="MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKE
FT                   ADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTRNYENQQGQRVYVTEVVAESFQILE
FT                   KRDNTANTSSLADSMPDYGPEPDLPF"
FT   gene            306396..306734
FT                   /locus_tag="spyM18_0360"
FT   CDS_pept        306396..306734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0360"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97111"
FT                   /protein_id="AAL97111.1"
FT                   /translation="MKLRIKYLRQALGLTQSAFAAKAHVHKNMIANHESQNSNPSLKQI
FT                   EKIALAFNVEPAWLAGWDTKPQIVIKEKVVRVQDPSARIPNDWKNDECGRLIKWKESGK
FT                   QFYKSFGG"
FT   gene            306737..307564
FT                   /locus_tag="spyM18_0361"
FT   CDS_pept        306737..307564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0361"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match pir||E75514 B-cell receptor
FT                   associated protein-related protein -- Deinococcus
FT                   radiodurans (strain R1)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97112"
FT                   /protein_id="AAL97112.1"
FT                   /translation="MKKEEKLVFTVAFLIIGGVFFRTTAVTRIPANTVGVKVSATSGVQ
FT                   KQTLSTGYHLKVPFIDKIYKMPTSVQQKKIKKITTQTEDAQWLDTTLDVKYRVSEKNAM
FT                   NVFKDYQSMENVNKSLIKAAVQRAVEQVTVNYDIYEALGSKRNELYAEIEKSLSERLAK
FT                   ESIELVSVTLTDQDAGDEIEKAIKDESVKQKQVDSAKQDKEKAKIEAETKQIQAQAEAD
FT                   AQVIKAKGEAESNNTKAASITDNLIKMKEAEARYKHGWVEVQTSGEVITNKGQ"
FT   gene            307579..307980
FT                   /locus_tag="spyM18_0362"
FT   CDS_pept        307579..307980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0362"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97113"
FT                   /protein_id="AAL97113.1"
FT                   /translation="MKLSKKDYDLLDKELMQFKDIDKSIATRQMELMSKDGINFLTYRT
FT                   NGLLNHPDMIVEKWSDDLTLRNMDIFKETVQKLIEVMDDEQKEIFSLHWLGHQYNWEEV
FT                   MFSINCSKSSVYRKRKSILKIYAKLKGWH"
FT   gene            308140..308715
FT                   /locus_tag="spyM18_0363"
FT   CDS_pept        308140..308715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0363"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB07758.1| (AP001520) BH4039;
FT                   unknown conserved protein [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97114"
FT                   /protein_id="AAL97114.1"
FT                   /translation="MKIVQPIRDTDQIDMIKDYLKGWNPRNFLLLLFGLNTGLRIGDIL
FT                   PLKVKDVTAGNYIDIIEQKTGKQKRFPINKTLRREIDKYIKDKQLKPWDYLFESQKKCT
FT                   EPGKEGQKKPISREQAWKILNKAAKQFGIHHIGTHSMRKSFGYHMYQKTQDIAMLMEMF
FT                   NHSSPDITLRYIGINQERIDDAVADFSL"
FT   gene            308869..309162
FT                   /locus_tag="spyM18_0364"
FT   CDS_pept        308869..309162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0364"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97115"
FT                   /protein_id="AAL97115.1"
FT                   /translation="MRPKRYPYGKSYPSNKLSKPIKELTIIFRGNESVPEVILNGINFK
FT                   NSRAGLVSLNLNWHTKDIQSIDELVERKVSLEYYDNPGLDMSLCKLSQSFKL"
FT   gene            309220..309423
FT                   /locus_tag="spyM18_0365"
FT   CDS_pept        309220..309423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0365"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97116"
FT                   /protein_id="AAL97116.1"
FT                   /translation="MYKIAPKGMIMFIANKYCEVRPKSIQKGIDWAWKWYQSFNKGSLV
FT                   PSEWLEYHNQFKKEHDYPCFKK"
FT   gene            309449..309835
FT                   /locus_tag="spyM18_0366"
FT   CDS_pept        309449..309835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0366"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97117"
FT                   /protein_id="AAL97117.1"
FT                   /translation="MRKTKIEKEFSHHIMWLQRYYKKSQGNPLNSILLQMLEEKEEKTG
FT                   LNRFNDIDCRIYFAWLSAISYMINHTDSNMMQLIKDVYVHRILNMTSAGAKYLNYAKSQ
FT                   TQQNVRDWFVELNRQHYEKVIAND"
FT   gene            309828..310133
FT                   /locus_tag="spyM18_0367"
FT   CDS_pept        309828..310133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0367"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB43056.1| (AP003135)
FT                   hypothetical protein [Staphylococcus aureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97118"
FT                   /protein_id="AAL97118.1"
FT                   /translation="MIKIDTTSKESMYRTFYHKTEWRKLREIAIIRDKRECIWCRQNGK
FT                   RTTTNLEVDHIKEVKDYPELALDLANLRTLCKDCHNRRHGRYQKKKNRWDDETFEW"
FT   gene            310275..310592
FT                   /locus_tag="spyM18_0368"
FT   CDS_pept        310275..310592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0368"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97119"
FT                   /protein_id="AAL97119.1"
FT                   /translation="MKISELKKELLGLVDQESSFEVEIVERYLNLVKIYRKLDQSLKEN
FT                   GYMILVKNGAQSFLKANSAIGEKTKINQQLIKLGEFFQKKKEEIKNEQNNTNFADPSEF
FT                   L"
FT   gene            310605..312335
FT                   /locus_tag="spyM18_0369"
FT   CDS_pept        310605..312335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0369"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB43054.1| (AP003135)
FT                   hypothetical protein [Staphylococcusaureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97120"
FT                   /protein_id="AAL97120.1"
FT                   /translation="MIGYVQDYIDDFEKGRVIFNQERQDLVAYIYREIVPRIDKKEIFF
FT                   DEKNIKNCINFIEKWFFKLENFQKFIISFVFLRYSETNRNVYKKILIMMGRGGGKNGLI
FT                   SGIIAYLLSPFHGIKNYNVSLVANSEDQAKTSFDEIYNTVESNPKLKEIYYNTKSEIKS
FT                   IHTNSVMRFRTSNGNTKDGLRDGMVVFDEIHQYESNKDVRVHKSGLGKVKNAREFYIGT
FT                   DGYVREGFIDSMKDKAKKVLSGNARWNSMFPFICKIDEEHEVDDKEKWQKANPMFHEPM
FT                   SDYAQELFDMVCEQYEEMVEDPSNREEFMTKRMDFPVMDVERSVASHEELVATKRELPD
FT                   MRGEVCIGGLDYAAIRDFAAVGLLFKNGADYVWLSHSFVRKEFVDTYYGYSKRKDSING
FT                   KRQFAPIKKWEQEGLLTVIDEASINPQYIVDWFVKMRDEEGYDLQRIVSDNFRMEILKP
FT                   LFEREGFEVLSKNTFTAPPGYQIEIVRNPRAIDSLLAPRIETAFANHKVIFGHNDMMRW
FT                   YTHNILRRLKSDGNVEYVKKEDTRRKTDGFKAFEYAMYRADTLEITSDADFYDDIMEWY
FT                   "
FT   gene            312703..313890
FT                   /locus_tag="spyM18_0370"
FT   CDS_pept        312703..313890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0370"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB43053.1| (AP003135)
FT                   hypothetical protein [Staphylococcusaureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97121"
FT                   /protein_id="AAL97121.1"
FT                   /translation="MGILDFFSFKKSGTLSDDDSGSTTSEKLTNVVLKEDALYKCVNYL
FT                   ARIISKSTFRIKAPEKLTENQKDWLYWINTKANPNQSASQFWVEVVQKLLVDGETLIFV
FT                   IPGKGIYVADAFTQDKKLSGNKFKVSRVQGQTYEKIFTFDQVIYLKNDNSDLMLKVESL
FT                   WEEYGELLGHVINNQKIANQIRFTMTPPKDKVRERAQENSDGGRQPKSDKDFFKRTIEK
FT                   IRTESVVGIPVTANTNYEEYGSKNTGSVKSYVDDIKKLKDQYMAEFAEMLGIPISLLHG
FT                   DIADNQKNYELLLEGPIESLITNIVDGLEYAIFDKSETLEGSFIKVTGLKNYDLFSISS
FT                   QADKLISSGFVFIDEVREEIGLPELPDGLGKVLYMTKNYESVLERGGEVDEEVET"
FT   gene            313871..314677
FT                   /locus_tag="spyM18_0371"
FT   CDS_pept        313871..314677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0371"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match ref|NP_038326.1| ORF25
FT                   [Streptococcus thermophilus bacteriophage 7201]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97122"
FT                   /protein_id="AAL97122.1"
FT                   /translation="MKKLKLNGPVVSEGDKWYYDWWEKPCITAKQVHDFLDSAGGEDIQ
FT                   VRLNSGGGEVFVGSEIYSALKDYPGNVEVVITGLAASIASIIMLAGDVIKASPMAQIMI
FT                   HNASWGSYGDYRQLKHDSEVVENASISLAGMYAQKTGKQETEIRELLDAETWFTANSAK
FT                   EIGLIDDILYNEMPSLVAGIDMVPKDKIEEFKNMVAHEKAQTNQQNDDFEARVKAIVEP
FT                   MINDFKNRPVSELKVSIDADELTEVIGDAVTEIKEKSSSPFAKFIF"
FT   gene            314694..315827
FT                   /locus_tag="spyM18_0372"
FT   CDS_pept        314694..315827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0372"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB43051.1| (AP003135)
FT                   hypothetical protein [Staphylococcus aureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97123"
FT                   /protein_id="AAL97123.1"
FT                   /translation="MAINLKELPKYREAVAELSAKISAGATPEEQEKLFEAAFTTMGDE
FT                   ILAKNEEEMERMFDLRDKNRELTAEEIKFFNDIDKNVGGKDKFKLLPEETMVQVFDDLV
FT                   AEHPLLKVINFKNTSLRLKALTAETSGTAVWGDIFGEIKGQLKQAFKEQDFSQFKLTAF
FT                   VVIPKDALKFGPKWLKQFITEQLKEAIAVALELAIVKGNGLLQPVGLLKDLSQPTVDQS
FT                   TGRDITTYKTDKEAIADLSDLDPDTAVELLVPVMKHLSVNDKKHPLKIAGQVKLLLNPE
FT                   DRWTLEAKFTSRNQFGEYVTVLPHGITILESLAVETGKAIAFVANRYDAFMATASTIEE
FT                   YDQTFAMEDLQLYLTKNYFYGKAKDNHTAALLTLAGG"
FT   gene            315841..316014
FT                   /locus_tag="spyM18_0373"
FT   CDS_pept        315841..316014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0373"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97124"
FT                   /protein_id="AAL97124.1"
FT                   /translation="MKLKVLKPFGDHKENIIRQVGEVFEVSKTRFDELSASVPADFYEE
FT                   VKATKAKKSEEE"
FT   gene            316014..316322
FT                   /locus_tag="spyM18_0374"
FT   CDS_pept        316014..316322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0374"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97125"
FT                   /protein_id="AAL97125.1"
FT                   /translation="MAIDAQEVTNKYLAAFKTRMRIFDSDEEEDKNVSSMLSASIKAVA
FT                   NLTGATEASEELLELAFERARYVYYDALDEFQKNYADEIETLYLTNKYKDIEELSHD"
FT   gene            316315..316677
FT                   /locus_tag="spyM18_0375"
FT   CDS_pept        316315..316677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0375"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match dbj|BAB43048.1| (AP003135)
FT                   hypothetical protein [Staphylococcusaureus subsp. aureus
FT                   N315]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97126"
FT                   /protein_id="AAL97126.1"
FT                   /translation="MIKGKSIKKAKTGNGELKTVIKFYTSTTDDSLDGRDTKLDLVYKT
FT                   RGEVYNPSSKDIEIANMRKVEAKMTLKIRDPLNQYHPSNSDFVEIVDSRIKGKLGIIDV
FT                   RPDFNDRKFLIIVAGG"
FT   gene            316679..317077
FT                   /locus_tag="spyM18_0376"
FT   CDS_pept        316679..317077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0376"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97127"
FT                   /protein_id="AAL97127.1"
FT                   /translation="MSGFANLKGVEELLANMEKKLGPAKVNRVVNRSLKEIGKELEPSF
FT                   KSAISIYKRTGETTESAVVSGVRREDGIPKVKLGFTTPRWNIVHLQELEYGWKHNRRGV
FT                   GVIRRYSDILETIYPRGIRDKLKRGFDG"
FT   gene            317070..317450
FT                   /locus_tag="spyM18_0378"
FT   CDS_pept        317070..317450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0378"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97128"
FT                   /protein_id="AAL97128.1"
FT                   /translation="MVRDMLAEVFDLLKADNVLKLVKIKSFERPESLLDDQTSIVILPI
FT                   TAPKQSTFGSDTALSKKFLYQIEVESTSRLECKDLQCRIEKQLEKIGFYQNDAGFERFD
FT                   RDTGRYLDARTFRGFSNIYEDY"
FT   gene            317462..318046
FT                   /locus_tag="spyM18_0379"
FT   CDS_pept        317462..318046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0379"
FT                   /product="putative major tail protein"
FT                   /note="best blastp match ref|NP_075509.1| major tail
FT                   protein [Staphylococcus aureus temperate phage phiSLT]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97129"
FT                   /protein_id="AAL97129.1"
FT                   /translation="MQAIGFKRMTITVLDSTTNSFIIEGTKDKGATKVAKISGLASEPV
FT                   KTFGSDIAYYTSRRGVGDVKMETEAIDIPFDVLKKILGYKDGSSSTGVTFVGEDTESPE
FT                   VSVLLEAPATGGKNAYLGFFKGTFSMDDIEWKSKEEKNEGLDSQKLVFTAQPGDEDEAK
FT                   GQYVGWAFDAEAEGKGTNAKQLEQLLKVKKG"
FT   gene            318139..318441
FT                   /locus_tag="spyM18_0380"
FT   CDS_pept        318139..318441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0380"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97130"
FT                   /protein_id="AAL97130.1"
FT                   /translation="MAILEIKITNDAGEKVVKECKSLTVRDYRDYLVLQQELSDSDAPE
FT                   YAKLDRQLEFIVGLFDGLTVDMMYDKLNMYELNNILADVYVKLIGGDPDDPKDNA"
FT   gene            318667..322767
FT                   /locus_tag="spyM18_0382"
FT   CDS_pept        318667..322767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0382"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63692.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97131"
FT                   /protein_id="AAL97131.1"
FT                   /translation="MGIGTPLGSMFIELGLDTSKFDPKLQSAKRAVNYFKAEARALDSA
FT                   LKSNGKNVGLLQAKYKTLTQAINAQKKVLTNLKADFDELDPGTDKWEASAVQIERENAK
FT                   LAQLEAQLGNVSKAFQEASGQTGFTGFLQRSGKQIDVFGQKLQTLADKTKWISAGFGAG
FT                   ALLSIKAASDFDTAFTGVKKTVDEVRDANGRVTYSYERLSNGIRKMAKEIPASTTEIAS
FT                   VAEAAGQLGIKTKDVLGFTRVMIDMGQSTNLSAEEAASSIAKIANITGLTSKEYSRFGS
FT                   SVVALGNNFSTTERDVIAMTNRIAASGKLAGLTNQEMLALATAMSSVGIEAEAGGTAMT
FT                   QTLSAIETAVINGGEDLTKFAQIANMSSKDFAKAWKEKPIVALQEFIKGLGQLDKKGES
FT                   ATKVLDELGLSGVRQSNMLKSLGLASETLGKAINVSNQAWRENKALTDEASKRYETFQS
FT                   KLKIFKNKINDIAIEIGGPLMEAASNALDALEPMFKTIGNIAKAYSNANPETKRFIAYL
FT                   IAGTAAASPFLRIIGKTSSGVGKLVEWIGRLAGARKGAAALKVLESAVEASGAAAGGAS
FT                   TKFGGLTSTMSLLSNPIGLLIGGTVALTGVLLALNHAKDKAREKSEEWGTTLTGTTRQA
FT                   LDSFKSKVDESTESMIRFDAIGSPAIQRVKDSFKGLLGDLENELTKANQRMEELGDKIG
FT                   LTAEQVAKGKEHNNRVVENARLMVDEIQNIYNRHNGNVRKLTAEERSIVENAQKELVRA
FT                   KLELMGLSNKQALSVMKAFNNDVTTLNETQLKKTMTALENAISEEKKLYDSKAKSLKEA
FT                   LDKEAISQEEYNSRMKSLKNEHEATMNALAEKYAQAAEARDFRQRARLKDWTTNIQENS
FT                   RRAKKFLREVGLSYDELANKVDAAAKKGGANLDLLAKSTANMSKETKEANALWTSLTFD
FT                   EKKAQVKSNAIDELIKASQSEEGWNQLKFMLKHANLESNARIKIAEALIANGDWQKMTP
FT                   EEKKLVFTNDEGLAKIYESKNLLEIWNQLTPKQKELALKNEDFVNKAGTAKKMLENWNN
FT                   LPVASKEITAIDGTPLPVSTAQQNLDSVVAGPPRPIEAEDKTGPTVAQAHASVNSPKQV
FT                   LPIDMFGLDKTGPSVAQTNNSVNSPKQRTPIAMFGKDSTAGPVASANRAVNSPKQNGPI
FT                   HINAQNNTGGVVSQVLGALAGIPRTITIGINAIKNFVGLENGTNYHSGGPALVNDQKGP
FT                   TYRELVVYPNGLSFIPEGRNVLLPDMPKGTKVLRASKTKDFMRSRGIPKYAHGVGISSE
FT                   SRFIKELSSANQSVNQTNISIDNRQVEALLKQLIELVKANGDKDQIIDLTVMLGNMTLV
FT                   QLKDKISELQRKDEALRLKSSSF"
FT   gene            322780..323550
FT                   /locus_tag="spyM18_0383"
FT   CDS_pept        322780..323550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0383"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33898.1| (AE006545)
FT                   conserved hypothetical protein - phage associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97132"
FT                   /protein_id="AAL97132.1"
FT                   /translation="MFRKIVNGKVTFLPLTTTVNGQLLEDVLKSDSASFKTIKIEGRHA
FT                   GEYNHQVTEVLGRHGAYYHQKTKDSLQLTWTVYLKASDVSSFGQLASNLHALLVKSKVT
FT                   KFEFSDDDGCYYLGQLKKIPDLKEKRCEAVVEIEIICYDPYKFKDVKLLQGGIINYQGQ
FT                   VKTKPIITLNLLSSTKGINLLHVESQKYIRLTGTYTTDEIKIDMATGKITQNGRNILGD
FT                   LDMVNSRYFELLPGNNTLQCANATITAEFREVYL"
FT   gene            323547..325598
FT                   /locus_tag="spyM18_0384"
FT   CDS_pept        323547..325598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0384"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33899.1| (AE006545)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97133"
FT                   /protein_id="AAL97133.1"
FT                   /translation="MIYLFDKLERLVATVGTDDLLSWHFKVKNNDWDQASFEVPVDYDI
FT                   EPFVYFGFFNYDPNLKEEVFKLFKVIDYNLEDSKFYKGLDKAESDLDTIAIIKDKRFRQ
FT                   SSADACIAGALEGTGYQVGKVEGITNVRTLSYYYISPRAALIKVVEAFNCEFNVRYTFV
FT                   QNKITSRYIDLKKRFGKPTGKQFEHGSNLLKVVYEESTDDIVTCLIGRGKGEEIQHEEA
FT                   EPKDVEGHLPQEEKRQGYGRRIEFTDVVWSVEKGDPIDKPAGQNFVALDSAREEYGLSQ
FT                   NGELKHRWGVFVNEEIEDKAELLKATWEELQRLSIPIRIYKAEILDIGPETWKGDSVAI
FT                   IYDEVKIGFETRVDEIDIDKLNFNRSVVTLGDYSTVQNRESRSRKEAVQNMINESLETI
FT                   TGLGMTFQEFLQDIEKRIETGKKEMEDNWRKVNLEFDNFKKKVELEGLQFKTLKEQIKE
FT                   VDERTDKELEEFRKTLKNLALPEEAIKKITDAIKVEDIPSIKQSFDDLKNKVSETSETS
FT                   RLNAEILGNNGKTRYNKNLLVGDPNRTKTYDEDYIEVEANDGGFKRGETYTISFSQTCE
FT                   LLKKVAITLTQINNKGVKLVLTPTKAKMEPQTFNLTKDKEVISVYPFSYTVLVTSDWYK
FT                   SKQIDLNASEVQELALDMSYKEVVDGNNATIAGQWSDSPQIILDGGNQ"
FT   gene            325595..326602
FT                   /gene="hylP"
FT                   /locus_tag="spyM18_0385"
FT   CDS_pept        325595..326602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylP"
FT                   /locus_tag="spyM18_0385"
FT                   /product="phage hyaluronidase"
FT                   /note="best blastp match sp|P15316|HYAL_BPH44
FT                   HYALURONOGLUCOSAMINIDASE (HYALURONIDASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97134"
FT                   /protein_id="AAL97134.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWARSTVILLEGEIGLETDTGYAKFGDG
FT                   KNRFSKLKYLNKPDLDAFAQKKETDNKIAKLESIKADKDTVYLKAESKKELDKKMNLTG
FT                   GTMTGQLQFKPNSHIKHSSSTGGAINIDMSKSAGAAMVMYTNKDTTDGPLMILRSDKDT
FT                   FDQSAQFVDYSGKTNAVNIVMRQPSTPNFSSALNITSANEGGSAMQIRGIERALGTLKI
FT                   THENPNVDAKYDENAAALSIDIVGKRGASGNGTAAQGIFINSSAGTTGKMLRIRNKNKD
FT                   KFYVNPDGGFHSYADSIVDGNLTVKDPTSGKHAATKDYVDKKFDELKKLIQKTD"
FT   gene            326612..328516
FT                   /locus_tag="spyM18_0386"
FT   CDS_pept        326612..328516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0386"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33658.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97135"
FT                   /protein_id="AAL97135.1"
FT                   /translation="MSRDPTLTLDESNLVIGKDGRVHYTFTAENDNPKVRLASKCLGTA
FT                   HFNQLMIERGDKATGYVAPVVVEGSGESTGVFKSLEEMLSGLQSINLELTDTKNSKLWS
FT                   KIKLTNRGMLQEYYDGTIKTEIINSAKGIATRISEETGQKLALINDTIDGIRREYQDAD
FT                   RRLSASYQAGIEGLKATMRDDKLDLQAEIQASAHGLSQKYDDKLKQLSAKITTTSSGTT
FT                   EAYENKLKGLRAEFTRSNQGMRTELESKISGLQSTQQATASQILQEIKDRQGAVSRVQQ
FT                   DLNSYQRRLQDAEGNYNSLKETVAGYERRISNQDNTISSNFTQLKSLINQSVTLEKIQS
FT                   LLRLSGDSIMLAIKDKIPQSKMSGSDIISAINLNSYGVTIAGKHIALDGNTTVNGTFTT
FT                   KIAEAIKIRADQIIAGTLDASKARIINLNASSIVGLDANFIKAKIGYAIVDMLEGKVIK
FT                   ARNSAMLIDLSSAKMDFNSNATINFNSRDNALVRKDGTHTAFVHFSNATPKGYTGSALY
FT                   ASIGITSSGDGVNSASSGRFAGLRSFRYATGYNHTAAVDQTELYGDNVLIADDFSINRG
FT                   FKFRPDKMEKVLDMNDLYAAVVALGRCWGHLANVGWNTAHSNFTNAVTRELSNYIGII"
FT   gene            328528..328956
FT                   /locus_tag="spyM18_0387"
FT   CDS_pept        328528..328956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0387"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34247.1| (AE006580)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97136"
FT                   /protein_id="AAL97136.1"
FT                   /translation="MDLTLKNKDLNTLYSVLDKIKVTNMRANRGRAKLLAKVVDKIKEY
FT                   AKDEGDLIDLYAQKDKDGKFVIDERKNIKLADPTKIDELNDLLSELGNEDITIKGHEYS
FT                   KRFIDFLEYLAESEDEFTSDEIIIIDNILEEFEESKGE"
FT   gene            328959..329591
FT                   /locus_tag="spyM18_0388"
FT   CDS_pept        328959..329591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0388"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33903.1| (AE006545)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97137"
FT                   /protein_id="AAL97137.1"
FT                   /translation="MKTLTLSGKPYPIHEGGKVVKTEVRLIGDNGLFIPIELIGDQTAK
FT                   GADDLIKEGLDAFVREYVTKYAVAESVQKVEELSLAQKEIEQNAEQAKVTAEAAEKQAK
FT                   SLELVIAKSQKMANLQAIHLLTSGSKVEPDIYKGLLELIEPAKKGEYQAYDVFTVVDES
FT                   HEEQAGEGNLVFVHVNEPFTYDKQTLKELEEEDKVTVIKYADLVKQD"
FT   gene            329603..329875
FT                   /locus_tag="spyM18_0389"
FT   CDS_pept        329603..329875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0389"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33661.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97138"
FT                   /protein_id="AAL97138.1"
FT                   /translation="MATELIFGLGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHDEQNKTLITMTEQIKNLNREVRELKDIMRGEA"
FT   gene            329872..330099
FT                   /locus_tag="spyM18_0390"
FT   CDS_pept        329872..330099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0390"
FT                   /product="putative holin"
FT                   /note="best blastp match gb|AAK34244.1| (AE006580) putative
FT                   holin - phage associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97139"
FT                   /protein_id="AAL97139.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTKGLSDSEQALTYHEPKQ"
FT   gene            330218..331435
FT                   /locus_tag="spyM18_0391"
FT   CDS_pept        330218..331435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0391"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="best blastp match emb|CAB07986.1| (Z93946)
FT                   N-acetylmuramoyl-L-alanine amidase [bacteriophage Dp-1]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97140"
FT                   /protein_id="AAL97140.1"
FT                   /translation="MVVDTEKAIAWMGLKKGRVSYSMDCRNGPDSYDCSSAICSALIYA
FT                   GASNPGWLLNTEYMHDWLVQNGFELIADNEDWDSQRADIAIWGFRGQSAGAGGHVVMFI
FT                   DADNIIHCNYANNNITIDNYNQTAAASGWMYSYVYRYTGAKAQPATNKSIDELVQEVLS
FT                   GKHGSGEQRKISLGANYDAVQAKVNELLKQPQVAEQSPAVKQDGDLLFNGAVLKKAILD
FT                   KILAKCKEHDILPSYAITVLHFEGLWGQSAVGRADNNWGGMTWTGQGNRPSGITVTQGT
FT                   ERPAVEGGHYMHYASVDDFLTDWFYLLRADGSYRVSGAKTFSEAVKGMFKVGGATYDYA
FT                   ASGFDSYIVGMAGRLKAIEQENGSLAKYDQQADIDVGQSDKIDVVIDSLEININGVTYT
FT                   ATKKPI"
FT   gene            complement(331557..332312)
FT                   /gene="speA"
FT                   /locus_tag="spyM18_0393"
FT   CDS_pept        complement(331557..332312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="spyM18_0393"
FT                   /product="exotoxin type A precursor"
FT                   /note="best blastp match sp|P08095|SPEA_STRPY EXOTOXIN TYPE
FT                   A PRECURSOR (SCARLET FEVER TOXIN) (ERYTHROGENIC TOXIN) (SPE
FT                   A)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97141"
FT                   /db_xref="GOA:P62561"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="PDB:1L0Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62561"
FT                   /protein_id="AAL97141.1"
FT                   /translation="MENNKKVLKKMVFFVLVTFLGLTISQEVFAQQDPDPSQLHRSSLV
FT                   KNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDK
FT                   NVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDI
FT                   ETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEF
FT                   TQSKYLMIYKDNETLDSNTSQIEVYLTTK"
FT   gene            332532..332714
FT                   /locus_tag="spyM18_0394"
FT   CDS_pept        332532..332714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0394"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97142"
FT                   /protein_id="AAL97142.1"
FT                   /translation="MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPGEGVRPWEV
FT                   LTEEKVEEVMRELDK"
FT   misc_feature    332790..332809
FT                   /note="phi SpeA attR"
FT   gene            333023..333625
FT                   /locus_tag="spyM18_0396"
FT   CDS_pept        333023..333625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0396"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33395.1| (AE006499)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97143"
FT                   /protein_id="AAL97143.1"
FT                   /translation="MVKNQFPLVADGIAISDPAKQMALYENEDLITNIRGYYQDKEYDD
FT                   IARNEEFTAKATSRQAPSSKRFCSNDEKHHYVKEARQKAKQDLKEKRQAYLAKEMTYVP
FT                   KQVSKKQQPADSSPSQKQATTEMSRFTKKLHQDNYILAELPKEYKEPKNLPQQGTTKKN
FT                   NYDFLKSSQIYNNKEMRQQREKTIAQELNLSRFEDLP"
FT   gene            333665..334993
FT                   /locus_tag="spyM18_0398"
FT   CDS_pept        333665..334993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0398"
FT                   /product="putative UDP-N-acetyl muramate-alanine ligase"
FT                   /note="best blastp match gb|AAK33396.1| (AE006499) putative
FT                   UDP-N-acetyl muramate-alanine ligase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97144"
FT                   /db_xref="GOA:Q8P2E1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2E1"
FT                   /protein_id="AAL97144.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHMVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITPDMELIVGNAFRENNKEVAYALRHQIPFKRYHDFLGDFMKSFIS
FT                   FAVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPYH
FT                   PEYSIITNIDFDHPDYFTGIADVRNAFNDYAKQVKKALFVYGEDDELKKIEAPAPIYYY
FT                   GFEEGNDFIAYDITRTTNGSDFKVKHQGEVIGQFHVPAYGKHNILNATAVIANLFVAGI
FT                   DMALVADHLKTFSGVKRRFTEKIVNDTIIIDDFAHHPTEIVATIDAARQKYPSKEIVAI
FT                   FQPHTFTRTIALLEDFACALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSQVV
FT                   TVENVSPLLDHDNAVYVFMGAGDIQLYEHSFEELLANLTKNNQ"
FT   gene            335039..335521
FT                   /locus_tag="spyM18_0399"
FT   CDS_pept        335039..335521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0399"
FT                   /product="putative arylalkylamine n-acetyltransferase"
FT                   /note="best blastp match gb|AAK33397.1| (AE006499) putative
FT                   arylalkylamine n-acetyltransferase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97145"
FT                   /protein_id="AAL97145.1"
FT                   /translation="MLIRQVQGSDLEVIATIESDNFSPQEATTRAVLEERIRLIPDTFL
FT                   VALIDQEIVGYIEGPVVTTPILEDSLFHGVTKNPKTGGYIAITSLSIAKHFQQQGVGTA
FT                   LLAALKDLVVAQQRTGLILTCHDYLISYYEMNGFINQGISESQHGGTLWYQMIWKL"
FT   gene            335639..337207
FT                   /locus_tag="spyM18_0401"
FT   CDS_pept        335639..337207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0401"
FT                   /product="putative aminodeoxychorismate lyase"
FT                   /note="best blastp match gb|AAK33398.1| (AE006499) putative
FT                   aminodeoxychorismate lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97146"
FT                   /protein_id="AAL97146.1"
FT                   /translation="MTDFKDKDQQDQQRSFKEQILAELEKANQIRKEKEEELFQKELEA
FT                   KEAARRTAQLYAEYKRQDAFQKESIAHNNKTAKHFQAIKDAVMTSEAIKPTLLSEKENS
FT                   SLKTTSKRVVQANELQETASKESQVPLTIEKGHSVRRKLSKRQQTERAAKKISTVLISS
FT                   IIITLLAVTLAGAGYVYSALNPVDKNSDAFVQVEIPSGSGNKLIGQILQKKGLIKNSTV
FT                   FSFYTKFKNFTNFQSGYYNLQKSMSLEEIASALQEGGTAEPTKPSLGKILIPEGYTIKQ
FT                   IAKAVEHNSKGKTKKAKTPFNEKDFLDLVTDEAFIQDMVKRYPKLLATIPTKEKAIYRL
FT                   EGYLFPATYNYYKETTMRELVEDMLAAMDATLVPYYDKIAASGKTVNEVLTLASLVEKE
FT                   GSTDDDRRQIASVFYNRLNSGMALQSNIAILYAMGKLGEKTTLAEDATIDTTINSPYNI
FT                   YTNTGLMPGPVASSGVSAIEATLNPASTDYLYFVANVHTGEVYYAKTFEEHSANVEKYV
FT                   NSQIQ"
FT   gene            337232..337762
FT                   /locus_tag="spyM18_0402"
FT   CDS_pept        337232..337762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0402"
FT                   /product="putative transcription elongation factor"
FT                   /note="best blastp match gb|AAK33399.1| (AE006499) putative
FT                   transcription elongation factor [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97147"
FT                   /db_xref="GOA:P64287"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64287"
FT                   /protein_id="AAL97147.1"
FT                   /translation="MFVFLIRSKKKREKTIMAEKTYPMTLTEKEQLEKELEELKLVRRP
FT                   EIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVA
FT                   IGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAA
FT                   TYDVEIISVEKTN"
FT   gene            complement(338386..339309)
FT                   /locus_tag="spyM18_0404"
FT   CDS_pept        complement(338386..339309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0404"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33400.1| (AE006499)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97148"
FT                   /db_xref="GOA:Q8P2D8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2D8"
FT                   /protein_id="AAL97148.1"
FT                   /translation="MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPIN
FT                   KRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVT
FT                   PSQNMEQANLPKKIKSNRNAGKQRKR"
FT   gene            complement(339391..339669)
FT                   /locus_tag="spyM18_0405"
FT   CDS_pept        complement(339391..339669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0405"
FT                   /product="putative acylphosphatase"
FT                   /note="best blastp match gb|AAK33401.1| (AE006499) putative
FT                   acylphosphatase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97149"
FT                   /protein_id="AAL97149.1"
FT                   /translation="MQKVRLIVSGRVQGVGFRYATHTLALDIGDIYGRVWNNNDGTVEI
FT                   LAQSKDSDKIATFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFQIGN"
FT   gene            339930..340667
FT                   /locus_tag="spyM18_0406"
FT   CDS_pept        339930..340667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0406"
FT                   /product="putative rRNA methylase"
FT                   /note="best blastp match gb|AAK33402.1| (AE006499) putative
FT                   rRNA methylase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97150"
FT                   /protein_id="AAL97150.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRKQSYLIEGWHLFEEAQKSGQVF
FT                   RHIFVLEEMVERLAGEQELVIVSPQVLKELTDSPSPQGIVAEVEIPKLAFPSDYKGKYL
FT                   VLEDVQDPGNLGTIIRTADAARFDGVFLSEKSADIYNQKTLRSMQGSHFHLPIWRTDVY
FT                   QLCRELQEYKTPILATTLSKKSVDYKSLTHHERLALVLGNEGQGISAEMAALADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSLI"
FT   gene            340706..341206
FT                   /locus_tag="spyM18_0407"
FT   CDS_pept        340706..341206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33403.1| (AE006499)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97151"
FT                   /protein_id="AAL97151.1"
FT                   /translation="MHYTEDKEYMEYVGHLIAHPRFQKLSHIVQHQHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKGHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATIAFPRYKESYIVTMVDKYWAVKEAVTPLRQKWSNRRFLRRKTLQS
FT                   HNR"
FT   gene            341221..341910
FT                   /locus_tag="spyM18_0408"
FT   CDS_pept        341221..341910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33404.1| (AE006499)
FT                   conserved hypothetical protein (putative membrane spanning
FT                   protein) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97152"
FT                   /db_xref="GOA:Q8P2D4"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2D4"
FT                   /protein_id="AAL97152.1"
FT                   /translation="MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRE
FT                   NLISILVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVA
FT                   YAQTTVFQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGM
FT                   MSYVISVISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   gene            342088..342330
FT                   /locus_tag="spyM18_0409"
FT   CDS_pept        342088..342330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0409"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33405.1| (AE006500)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97153"
FT                   /db_xref="GOA:P67297"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67297"
FT                   /protein_id="AAL97153.1"
FT                   /translation="MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK"
FT   gene            342508..343302
FT                   /locus_tag="spyM18_0411"
FT   CDS_pept        342508..343302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0411"
FT                   /product="putative glutamate racemase"
FT                   /note="best blastp match gb|AAK33406.1| (AE006500) putative
FT                   glutamate racemase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97154"
FT                   /db_xref="GOA:Q8P2D3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2D3"
FT                   /protein_id="AAL97154.1"
FT                   /translation="MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPR
FT                   PKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAI
FT                   KSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSVQVRSLACPKFVPIVESNEMCSSIAKK
FT                   IVYDSLSPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFD
FT                   INGNYHQKAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL"
FT   gene            343299..344285
FT                   /locus_tag="spyM18_0412"
FT   CDS_pept        343299..344285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0412"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33407.1| (AE006500)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97155"
FT                   /db_xref="GOA:Q8P2D2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2D2"
FT                   /protein_id="AAL97155.1"
FT                   /translation="MSEKIYEYKDENNWFIGKMTGHNLISGWGVKHTTIKKIDDLLDGI
FT                   AATLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETQREIKVIPHAGTILLMENAKLL
FT                   AVYLPEGGVSTATFFATSEQGFGDTILIATRNEGKTKEFRNLFGQLGYRVENLNDYPEL
FT                   PEVAETGTTFEENARLKAETISHLTGKMVLADDSGLKVDALGGLPGVWSARFSGPDATD
FT                   AKNNAKLLHELAMVFEQKKRSAQFHTTLVVAAPNKDSLVVEAEWPGYIATQPKGENGFG
FT                   YDPVFIVGETGRHAAELEADQKNQLSHRGQAVRKLMEVFPAWQAKQS"
FT   gene            344264..344785
FT                   /locus_tag="spyM18_0413"
FT   CDS_pept        344264..344785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33408.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97156"
FT                   /protein_id="AAL97156.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSD
FT                   PIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAAD
FT                   ICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKL
FT                   YPSLSKEFKR"
FT   gene            344782..345243
FT                   /locus_tag="spyM18_0414"
FT   CDS_pept        344782..345243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33409.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97157"
FT                   /protein_id="AAL97157.1"
FT                   /translation="MIAKEFETFLMSHLDNYLIPEQDLAIFIDTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMMYQSKRQLTDWEMSQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLIDFPFLPVVDRANRFVGIITRKSILKAVNSLLHDFTDDYTIIKK"
FT   gene            345240..345986
FT                   /locus_tag="spyM18_0415"
FT   CDS_pept        345240..345986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0415"
FT                   /product="putative integrase/recombinase"
FT                   /note="best blastp match gb|AAK33410.1| (AE006500)
FT                   hypothetical protein (possible (possible
FT                   integrase/recombinase) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97158"
FT                   /db_xref="GOA:Q8P2D0"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2D0"
FT                   /protein_id="AAL97158.1"
FT                   /translation="MKSYIEPFIASKALSQNSQKAYRYDLQQFCQLVGERVNQDKLLLY
FT                   QNSIANLSLSAKKRKLSTANQFLYYLYQIKYLNSYFRLTDTMKVMRTEKQQAAIINTDI
FT                   FYQKTPFVWGQLISLLILELGLTPSEVAGIEVANLDLNFQMLTLKTKKGVRVLPLSQIL
FT                   IPFLEQQLVGKEVYLFEHRGIPFSRQWFFNHLKTFVRSIGYEGLTAQKLREQFILKEKL
FT                   AGKSIIELSDILGLKSPVTLEKYYKS"
FT   gene            345986..346690
FT                   /locus_tag="spyM18_0416"
FT   CDS_pept        345986..346690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33411.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97159"
FT                   /db_xref="GOA:Q8P2C9"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2C9"
FT                   /protein_id="AAL97159.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETL
FT                   QVMKLEVAGDYMLMASQLMLIKSRRLLPKVVEHIEEEDLEQDLLEKIEEYSRFKTVSQA
FT                   LAKQHDQRAKWYSKPKQELIFEDAILQEDKTVMDLFLAFSNIMAAKRAVLKNNHTVIER
FT                   DDYKIEDMMASIKQRLEKENVISLSAIFEECQTLNEVISIFLASLELIKLHVVFVEQFS
FT                   NFGAIILRKEKK"
FT   gene            346687..347238
FT                   /locus_tag="spyM18_0417"
FT   CDS_pept        346687..347238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33412.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97160"
FT                   /db_xref="GOA:P60221"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60221"
FT                   /protein_id="AAL97160.1"
FT                   /translation="MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQK
FT                   YEKDQHSSLCLIETANTYRLVTKEGFAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPI
FT                   TRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDEL
FT                   IEVSAVEPADEEIALFRTQD"
FT   gene            347335..348081
FT                   /locus_tag="spyM18_0418"
FT   CDS_pept        347335..348081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0418"
FT                   /product="putative hypothetical protein"
FT                   /note="best blastp match gb|AAK33413.1| (AE006500) putative
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97161"
FT                   /protein_id="AAL97161.1"
FT                   /translation="MLKRKKNIMRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDL
FT                   ATTVKSGDVVEIEGSPIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYP
FT                   VGRLDWDTSGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDG
FT                   KKTKPARYNIVRVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLK
FT                   GLRPGEARRLNKKEISQLHNLANTKK"
FT   gene            348078..348338
FT                   /locus_tag="spyM18_0419"
FT   CDS_pept        348078..348338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match sp|P58128|Y370_STRPY hypothetical
FT                   protein SPY0370"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97162"
FT                   /db_xref="GOA:Q8P2C7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2C7"
FT                   /protein_id="AAL97162.1"
FT                   /translation="MMKKLLIVSVKAYQKYISPLSPPSCRYKPTCSAYMLTAIEKHGTK
FT                   GILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNEKF"
FT   gene            348427..349461
FT                   /locus_tag="spyM18_0421"
FT   CDS_pept        348427..349461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0421"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97163"
FT                   /protein_id="AAL97163.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGTRLKTLKRHDFIKKWL
FT                   DIDS"
FT   gene            349605..350153
FT                   /locus_tag="spyM18_0424"
FT   CDS_pept        349605..350153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0424"
FT                   /product="putative rRNA methylase"
FT                   /note="best blastp match gb|AAK33415.1| (AE006500) putative
FT                   rRNA methylase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97164"
FT                   /protein_id="AAL97164.1"
FT                   /translation="MTTKELINKNDKLKKARNHIVLFQPQIPQNTGNIARTCAATNAPL
FT                   HIIKPMGFPIDDRKMKRAGLDYWDKLELHFYDHLEQFINQCHGQLHLISKFAVNNYSQA
FT                   TYADGDSHYFLFGREDTGLPEDFMREHAEKALRIPMNDEHVRSLNVSNTVCMVIYEALR
FT                   QQGFQGLELKHTYEHDKLK"
FT   gene            complement(350145..351170)
FT                   /locus_tag="spyM18_0426"
FT   CDS_pept        complement(350145..351170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0426"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97165"
FT                   /protein_id="AAL97165.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGTDNACCQKLTLLKSPL
FT                   F"
FT   gene            351550..352113
FT                   /locus_tag="spyM18_0427"
FT   CDS_pept        351550..352113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33416.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97166"
FT                   /protein_id="AAL97166.1"
FT                   /translation="MSKTHKMIMIGILSAISFLLMLVSFAIIPGAAFLKIEFSIIPVLF
FT                   GLMIMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYTFAIPLYAIFANIDIRAYIGVTKYMMTMVIPFNLVE
FT                   GLIFAITFYFVYIASKPILERYLH"
FT   gene            352115..352768
FT                   /locus_tag="spyM18_0428"
FT   CDS_pept        352115..352768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33417.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97167"
FT                   /protein_id="AAL97167.1"
FT                   /translation="MMTNKQTHFLIASFALLIFVIIGYTVKFFPERLALLDNTIQAEIR
FT                   GNLPIVLTQFFRGVTVFGNVMTQILLVIVSVLVLFFMKWKIEALFILSNGAIAAFLITT
FT                   LKLFYQRPRPAIEHLVYAGGYSFPSGHAMGSMLIFGSLLIICYQRLHSKLLQFVTSMIF
FT                   IILILVIGLSRIYLGVHYPSDILAGFVLGFGILQFIYPFYKQKRFEWRFLLKQD"
FT   gene            353061..353981
FT                   /locus_tag="spyM18_0430"
FT   CDS_pept        353061..353981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33418.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97168"
FT                   /protein_id="AAL97168.1"
FT                   /translation="MKKRYQTLNEHYRQLFGAKMFKVPIDAGFDCPNRDGTVAHGGCTF
FT                   CTVSGSGDAIVAPDAPIKEQFYKEIDFMHRKWPDVNRYLVYFQNFTNTHDTVDVIRDRY
FT                   EQAINEPGVVGINIGTRPDCLPDDTIAYLAELSERMHVTVELGLQTTYEETSRLINRAH
FT                   SYDLYKDTVRRLRHYPNINIVSHLINGLPKETHDMMLENVRRCVTDNDIQGIKLHLLHL
FT                   MTNTRMQRDYHEGRLKLLSQKDYVSIICDQLEIIPKHIVIHRITGDAPRDMLIGPMWSL
FT                   NKWEVLNAIDKEMERRGSFQGCKVD"
FT   gene            354020..354574
FT                   /locus_tag="spyM18_0431"
FT   CDS_pept        354020..354574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33419.1| (AE006500)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97169"
FT                   /protein_id="AAL97169.1"
FT                   /translation="MLKRPIHLSHDFLAEVVDKSSVVVDATMGNGNDTAFLAQLAKKVY
FT                   AFDVQEQAIRKTSERLAQLGLSNAELILAGHEAVDQYVTEPVRAAIFNLGYLPSADKSI
FT                   ITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLDQRKVSAMLY
FT                   QPLNQVNTPPFLIMLEKLADV"
FT   gene            354707..356041
FT                   /gene="hylX"
FT                   /locus_tag="spyM18_0432"
FT   CDS_pept        354707..356041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylX"
FT                   /locus_tag="spyM18_0432"
FT                   /product="putative hemolysin"
FT                   /note="best blastp match gb|AAK33420.1| (AE006501) putative
FT                   hemolysin [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97170"
FT                   /protein_id="AAL97170.1"
FT                   /translation="MEDPVSQPLVIQFLLLVVLTLLNAFFSASEMALVSLNRSRVEQKA
FT                   ADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKVISGWLGNSATART
FT                   AGTIISLVFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGRLVSPFVWLLSAST
FT                   NLLSRLTPMTFDDADEQMTRDEIEYMLSKSEATLDAEEIEMLQGVFSLDEMMAREVMVP
FT                   RTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKRLLESGFRQGFDQI
FT                   NMRKMLQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLVTLEDLLEEIVGEI
FT                   DDETDKAEQFVHEIGDNTYIVVGTMTLNEFNDYFDTELESDDVDTIAGFYLTGIGTIPS
FT                   QEQKEAYEIDNKDKHLVLINDKVKDGRITKLKLILSNIEQIIEED"
FT   gene            356047..356910
FT                   /locus_tag="spyM18_0433"
FT   CDS_pept        356047..356910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0433"
FT                   /product="putative pyruvate-formatelyase activating enzyme"
FT                   /note="best blastp match gb|AAK33421.1| (AE006501) putative
FT                   pyruvate-formatelyase activating enzyme [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97171"
FT                   /protein_id="AAL97171.1"
FT                   /translation="MPSLFDEKCYNENVKTFTSNEGDAMTEKDYGQVTGMVHSTESFGS
FT                   VDGPGIRFIIFLQGCKLRCQYCHNPDTWEMETNNSKIRTVNDVLKEALQYKHFWGKKGG
FT                   ITVSGGEAMLQIDFITALFIEAKKLGIHTTLDTCGFTYRPTPEYHQVLDNLLAVTDLIL
FT                   LDLKEIDEKQHKIVTRQPNKNILQFARYLSDKQIPVWIRHVLVPGLTDIDDHLTRLGEF
FT                   VKTLKNVDKFEVLPYHTMGEFKWRELGIPYQLEGVKPPTKERVQNAKNLMQTESYTEYM
FT                   NRIHQS"
FT   gene            357041..357976
FT                   /locus_tag="spyM18_0434"
FT   CDS_pept        357041..357976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0434"
FT                   /product="putative manganese-dependent inorganic
FT                   pyrophosphatase"
FT                   /note="best blastp match gb|AAK33422.1| (AE006501) putative
FT                   manganese-dependent inorganic pyrophosphatase (intrageneric
FT                   coaggregation-relevant adhesin) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97172"
FT                   /db_xref="GOA:P65759"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65759"
FT                   /protein_id="AAL97172.1"
FT                   /translation="MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNE
FT                   ETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVAN
FT                   FETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVS
FT                   DHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVN
FT                   TVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFN
FT                   FTLDNNHAFLAGAVSRKKQVVPQLTESFGA"
FT   gene            358052..358705
FT                   /locus_tag="spyM18_0435"
FT   CDS_pept        358052..358705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0435"
FT                   /product="conserved streptococcal hypothetical protein"
FT                   /note="best blastp match gb|AAK33423.1| (AE006501)
FT                   conserved streptococcal hypothetical protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97173"
FT                   /protein_id="AAL97173.1"
FT                   /translation="MITIFHSDKLTRQPFFQDLINYLDQHDYVILREIKKAFPNVTGID
FT                   KAIESYVQAGYIRRENKRYGINLPLVSSDQQLALDTMLFVDTCSAMYENILAVVFETQL
FT                   TNQTNHVMIKEKTNITRDDLTLANYFYRLKRGEKPSADQMDLYDLLGDVNQEYALKYMT
FT                   TFLLKFTRKDLVMQKRPDIFVEALVTLGYLKQVEPTTYQLLMTLDKESLTFIAP"
FT   gene            complement(358750..359751)
FT                   /gene="fhuG"
FT                   /locus_tag="spyM18_0436"
FT   CDS_pept        complement(358750..359751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="spyM18_0436"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="best blastp match gb|AAK33424.1| (AE006501) putative
FT                   ferrichrome ABC transporter (permease) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97174"
FT                   /protein_id="AAL97174.1"
FT                   /translation="MKSHRHLLRLYTSLILLLVSLMGLALSLGESHLSFLDLVHVFLGK
FT                   SSHAISFIVINIRLPRILAACLGGGSLALSGLLLQRLTRNPLADSGVLGITIGAGIPLA
FT                   IVVSFSFFEQAHISHYLPLFAMLGAVVTTFSVYWLSLTKQGQIDPTRLILTGVAVTTML
FT                   SSLMVALVGHINRYKVDLVINWLSGQLIGDDWPTLSVIAPLLLCFWLLTYSQAHFLNIM
FT                   GLADNTAIGLGLPLNRKRRLILVLAAGLGALSVLLVGNISFIGLIAGHFSTYLVGSNHK
FT                   ITIPISILIGMILLLVADTVGRVYLVGSNIQTGILVSLIGAPYFLYLMAKTK"
FT   gene            complement(359748..360800)
FT                   /gene="fhuB"
FT                   /locus_tag="spyM18_0437"
FT   CDS_pept        complement(359748..360800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="spyM18_0437"
FT                   /product="putative ferrichrome ABC transporter (permease)"
FT                   /note="best blastp match gb|AAK33425.1| (AE006501) putative
FT                   ferrichrome ABC transporter (permease) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97175"
FT                   /protein_id="AAL97175.1"
FT                   /translation="MKTKHPFLCLERFCLKKTQIITKSHIFWLVFVLLSFSLCVAIYCH
FT                   LRFGAVALSHQDLNSILFGKQNGHKANVLLAIRLPRLFGATLTGSALAVSGTIMQAITR
FT                   NPIAEPGLLGINAGAGLALVLAYAFVPHLHYSLIILLSLLGSSLAATLVFGLSYQSGKG
FT                   YHQLRLVLAGAMVSILLSALGQGITNYYHLTNAVIGWQAGGLVGVNWQMIGYIAPLIIL
FT                   SLCLAQLLSYHLTVLSLSESQAKALGQKTNLISAVFMILVLILSSAAVAIAGSISFIGL
FT                   VIPHLMKHFTPHHYRYLLPLCAVSGASFMVWVDIACRNLNPPYETPLGALVSLIGFPCF
FT                   LWLIRRGGRY"
FT   gene            complement(360790..361722)
FT                   /gene="fhuD"
FT                   /locus_tag="spyM18_0438"
FT   CDS_pept        complement(360790..361722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="spyM18_0438"
FT                   /product="ferrichrome ABC transporter (ferrichrome-binding
FT                   protein)"
FT                   /note="best blastp match gb|AAK33426.1| (AE006501)
FT                   ferrichrome ABC transporter (ferrichrome-binding protein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97176"
FT                   /protein_id="AAL97176.1"
FT                   /translation="MKKLTLLLTLCLTTITLIACGNQATNHSNTASKSLSPMPQIAGVT
FT                   YYGDIPKQPKRVVSLASTYTGYLKKLDMNLVGVTSYDKKNPILAKTVKKAKQVAATDLE
FT                   AITTLKPDLIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVLSDFGRIFNKEGKAKKWL
FT                   KDWKTKTAAYEKEVKAVTGDKATFTIMGLYEKDVYLFGKDWGRGGEVIHQAFHYDAPEK
FT                   VKTEVFKQGYLSLSQEVLPDYIGDYVVVAAEDDKTGSALYESKLWQSIPAVKKHHVIKV
FT                   NANVFYFTDPLSLEYQLETLREAILSSEN"
FT   gene            complement(361748..362530)
FT                   /gene="fhuC"
FT                   /locus_tag="spyM18_0439"
FT   CDS_pept        complement(361748..362530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="spyM18_0439"
FT                   /product="putative ferrichrome ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="best blastp match gb|AAK33427.1| (AE006501) putative
FT                   ferrichrome ABC transporter (ATP-binding protein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97177"
FT                   /protein_id="AAL97177.1"
FT                   /translation="MTTISAEDLTIAYEQRTIIDKLSFYIPEGKITTIIGANGCGKSSL
FT                   LKALTRLLPPKQGVVYLNGQNIATLETKEVAKKLALLPQVQEATNGITVYELVSYGRFP
FT                   HQSYFGNLSPADKKAIHWAMQATNVMAYADQPVDALSGGQRQRVWLAMALAQGTDTIFL
FT                   DEPTTYLDLNHQLEILELVKSLNKDAGKTIVMVLHDLNLSARYSDHLIAMKHGKIHYTG
FT                   TIADVMTSPIIQDIFQIKPVLVDDPIHNCPIVLTYQLQ"
FT   gene            complement(362776..364221)
FT                   /gene="murE"
FT                   /locus_tag="spyM18_0440"
FT   CDS_pept        complement(362776..364221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="spyM18_0440"
FT                   /product="putative
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate
FT                   ligase"
FT                   /note="best blastp match gb|AAK33428.1| (AE006501) putative
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate
FT                   ligase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97178"
FT                   /db_xref="GOA:Q8P2B4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2B4"
FT                   /protein_id="AAL97178.1"
FT                   /translation="MITIEQLLDILKKDHNFREVLDADGYHYHYQGLSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAITNGLQLYISEVDYELGIPVVLVTDIKKAMSLIAMAFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHMLKESYKPAMFSTMNTTLDGKTFFKSQLTTPE
FT                   SLDLFAMMAECVTNGMTHLIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFSFLADQVADQEHVFYGPLSDNQITTSQAFSFEA
FT                   KGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGKLMLILGAPGNKGESRRADFGRVIHQHPNLTV
FT                   ILTADDPNFEDPEDISKEIASHIARPVEIISDREQAIQKAMSLCQGAKDAVIIAGKGAD
FT                   AYQIVKGQQVAYAGDLAIAKHYL"
FT   gene            364309..365943
FT                   /locus_tag="spyM18_0442"
FT   CDS_pept        364309..365943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33429.1| (AE006501)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97179"
FT                   /protein_id="AAL97179.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTASNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQIAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGLIFSVIMYLGSPLFASLSGGDDTLVPIMHSLSLAVFIFPVMSVIRGIFQGHNNIKP
FT                   YAISQIAEQLIRVIWMLLTTFFIMKLGSKDYLSAVTQSTLAAFVGMIASMAVLGYYLWK
FT                   LGLLKAICRKPNHHIDSDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWTFVNTMTLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMKAAARLIINN
FT                   IEMLVMFLLPALTGAIILARPLYSVFYGASEDRAIHLFVAVLFQTLLLALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQIPLIYLLHAYGPLLATTIALVVPIYLMYRRLYQVTH
FT                   FNRKLLQKRLLLTLIETLLMGLVVFVANWLLGYAFKPTGRLTSLLYLLIIGGLGMTVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   gene            366110..366739
FT                   /gene="upp"
FT                   /locus_tag="spyM18_0443"
FT   CDS_pept        366110..366739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="spyM18_0443"
FT                   /product="putative uracil phosphoribosyltransferase"
FT                   /note="best blastp match gb|AAK33430.1| (AE006502) putative
FT                   uracil phosphoribosyltransferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97180"
FT                   /db_xref="GOA:P67402"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67402"
FT                   /protein_id="AAL97180.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVDIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   NEETLEPVEYLVKLPEDINQRQIFLVDPMLATGGSAILAVDSLKKRGAANIKFVCLVAA
FT                   PEGVKKLQEAHPDIDIFTAALDDHLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            366708..366842
FT                   /locus_tag="spyM18_0444"
FT   CDS_pept        366708..366842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0444"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33431.1| (AE006502)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97181"
FT                   /protein_id="AAL97181.1"
FT                   /translation="MLVIVYLGQNKRDNHQIVAFLGQSFLILLKKSERFLFFKGKASL"
FT   gene            366963..367553
FT                   /gene="clpP"
FT                   /locus_tag="spyM18_0446"
FT   CDS_pept        366963..367553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="spyM18_0446"
FT                   /product="putative ATP-dependent protease proteolytic
FT                   subunit"
FT                   /note="best blastp match gb|AAK33432.1| (AE006502) putative
FT                   ATP-dependent protease proteolytic subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97182"
FT                   /db_xref="GOA:P69886"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69886"
FT                   /protein_id="AAL97182.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   gene            368048..368323
FT                   /locus_tag="spyM18_0447"
FT   CDS_pept        368048..368323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33433.1| (AE006502)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97183"
FT                   /db_xref="GOA:P60420"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60420"
FT                   /protein_id="AAL97183.1"
FT                   /translation="MFQKQERIGLVVYLYYNRDARKLSKFGDLYYHSKRSRYLIIYINK
FT                   NDLDTKLEEMRRLKCVKDIRPSAFDDIDRQFVGNLHRDETNNHQKG"
FT   gene            368572..369207
FT                   /gene="tdk"
FT                   /locus_tag="spyM18_0449"
FT   CDS_pept        368572..369207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="spyM18_0449"
FT                   /product="putative thymidylate kinase"
FT                   /note="best blastp match gb|AAK33434.1| (AE006502) putative
FT                   thymidylate kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97184"
FT                   /db_xref="GOA:Q8P2B1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2B1"
FT                   /protein_id="AAL97184.1"
FT                   /translation="MITGKLITVEGPDGAGKTTVLEQLIPPLKQKVAQEILTTREPGGV
FT                   AISEYIRELILDINHTTMDPKTELLLYIAARRQHLVEKVLPALEAGQLVFIDRFIDSSV
FT                   AYQGAGRGLIKADIQWLNEFATDGLEPDLTLYFDVPSEIGLARINANQQREVNRLDLET
FT                   IEIHQRVRKGYLALAKEHPKRIVTIDATKPLKEVVSVALEHVLALLLA"
FT   gene            369225..370100
FT                   /locus_tag="spyM18_0450"
FT   CDS_pept        369225..370100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0450"
FT                   /product="putative DNA polymerase III delta subunit"
FT                   /note="best blastp match gb|AAK33435.1| (AE006502) putative
FT                   DNA polymerase III delta subunit [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97185"
FT                   /protein_id="AAL97185.1"
FT                   /translation="MDLAQKAPNVYQAFQTILKKDRLNHAYLFSGDFANEEMALFLAKV
FT                   IFCEQKKDQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYEGK
FT                   RQVFIIKDCEKMHVNAANSLLKYIEEPQGEAYMFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLFQLAQERGLLRSQADLVAKLAKNVDQLEDLAQNSHFLEVMAQTERFVSIWLKDQL
FT                   QAYLALNRLVQLATEKEEQDLVLTLLTLLLARERAQTPLTQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMSE"
FT   gene            370119..370358
FT                   /locus_tag="spyM18_0451"
FT   CDS_pept        370119..370358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0451"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33436.1| (AE006502)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97186"
FT                   /protein_id="AAL97186.1"
FT                   /translation="MGKRSLSKDLPVATKVAAHRGKKAFEENTALATDLMKEVSRLMIQ
FT                   NQLEMTFINSVFPLDQHVVLIPFSAEEHMDFYNC"
FT   gene            complement(370502..370651)
FT                   /locus_tag="spyM18_0453"
FT   CDS_pept        complement(370502..370651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0453"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97187"
FT                   /protein_id="AAL97187.1"
FT                   /translation="MSLLWYHIQGIFSCFIGKSHLHHRDSKANGHKGLLLYPKSMITFD
FT                   FLVF"
FT   gene            370763..371086
FT                   /locus_tag="spyM18_0455"
FT   CDS_pept        370763..371086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33437.1| (AE006502)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97188"
FT                   /db_xref="GOA:Q8P2A7"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2A7"
FT                   /protein_id="AAL97188.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSHLEHETVAKNPFKQRKDHLEGIYDEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   gene            371091..371954
FT                   /locus_tag="spyM18_0456"
FT   CDS_pept        371091..371954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33438.1| (AE006502)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97189"
FT                   /db_xref="GOA:Q8P2A6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P2A6"
FT                   /protein_id="AAL97189.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKHFDIATKQISFHEHNAYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDSDIAVVALPGASAGITALIASGLAPQPHVFYGFLSRKAGQQKAFFEDKHH
FT                   YPETQMFYESPYRIKDTLTNMLACYGDRQVVLVRELTKLFEEYQRGSISEILSYLEETS
FT                   LKGECLLIVAGAQVDSEVELTADVDLVSLVQKEIQAGAKPNQAIKTIAKAYQVNRQELY
FT                   QQFHDL"
FT   gene            371981..372373
FT                   /locus_tag="spyM18_0457"
FT   CDS_pept        371981..372373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0457"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33439.1| (AE006502)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97190"
FT                   /protein_id="AAL97190.1"
FT                   /translation="MTEDQATILILGVYGIILAVFLLSALLCLIANWRLFKRAGYKGWH
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIASLIVAFGKTYTTQECHPVPHLLN"
FT   gene            complement(372420..373049)
FT                   /locus_tag="spyM18_0458"
FT   CDS_pept        complement(372420..373049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0458"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33440.1| (AE006502)
FT                   hypothetical protein (similar to Human CGI-32 protein
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97191"
FT                   /protein_id="AAL97191.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKSLVTYANKRIEIMIGGGVTAENCQNLSQLTGTAIVHGTKII"
FT   gene            373348..373704
FT                   /locus_tag="spyM18_0459"
FT   CDS_pept        373348..373704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0459"
FT                   /product="putative arsenate reductase"
FT                   /note="best blastp match gb|AAK33441.1| (AE006502) putative
FT                   arsenate reductase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97192"
FT                   /protein_id="AAL97192.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLVSDFEVIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGRVL
FT                   QVGYRKPYQELDLG"
FT   gene            complement(373778..374605)
FT                   /locus_tag="spyM18_0461"
FT   CDS_pept        complement(373778..374605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0461"
FT                   /product="putative 3'-exo-deoxyribonuclease"
FT                   /note="best blastp match gb|AAK33442.1| (AE006502) putative
FT                   3'-exo-deoxyribonuclease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97193"
FT                   /protein_id="AAL97193.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVAQDADIIAIQET
FT                   KLSAKGPTKKHIEALLSYFPNYLHVWRSSVEPARKGYAGTMFLYKNTLNPVSTFPEIGA
FT                   PTTMDAEGRIITLEFEDFFVTQVYTPNAGDGLRRLDDRQIWDHKYADYLTELDAQKPVL
FT                   AAGDYNVAHKEIDLANPSSNRRSPGFTDEERQSFTNLLARGFTDTFRHLHGDIPHVYTW
FT                   WAQRSKTSKINNTGWRIDYWLASNRLVDKVKRSEMISSGERQDHTPILLDIDL"
FT   gene            374839..376020
FT                   /locus_tag="spyM18_0462"
FT   CDS_pept        374839..376020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0462"
FT                   /product="putative lactate oxidase"
FT                   /note="best blastp match gb|AAK33443.1| (AE006502) putative
FT                   lactate oxidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97194"
FT                   /protein_id="AAL97194.1"
FT                   /translation="MAQKTVITEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVIPK
FT                   GAFGYIASGAGDTFTLHENIRSFNHKLIVPHSLKGVENPSTEITFDGDHLTSPLILAPV
FT                   AAHKLANEQGEVASAKGLKEFGSIYTTSSYSTTDLPEISAALGGTPHWFQFYYSKDDGI
FT                   NRNIMDRVKAQGCKAIVLTADATVGGNREVDRRNGFVFPVGMPIVQEYLPDGAGKTMDY
FT                   VYKSAKQALTSKDIEYIATYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQLDG
FT                   GPAAFDSLQEVAEAVDQKVPIVFDSGIRRGQHIFKALASGADLVALGRPAIYGLAMGGS
FT                   IGTRQVFEKLNDELKMVMQLAGTQTIQDVKAFNLRHNPYDSSIPFDQNALRLD"
FT   gene            376287..381230
FT                   /locus_tag="spyM18_0464"
FT   CDS_pept        376287..381230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0464"
FT                   /product="putative cell envelope proteinase"
FT                   /note="best blastp match gb|AAK33444.1| (AE006503) putative
FT                   cell envelope proteinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97195"
FT                   /protein_id="AAL97195.1"
FT                   /translation="MEKKQRFSLRKYKSGTFSVLIGSVFLMMTTTVAADELSTMSEPTI
FT                   TNHTQQQAQHLTNTELSSAESKSQDTSQITPKTNREKEQPQGLVSEPTTTELADTDAAP
FT                   MANTGPDATQKSASLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIDTGIDPAHQSMRI
FT                   SDVSTAKVKSKEDMLARQKAAGINYGSWINDKVVFAHNYVENSDNIKENQFEDFDEDWE
FT                   NFEFDAEAEPKAIKKHKIYRPQSTQAPKETVIKTEETDGSHDIDWTQTDDDTKYESHGM
FT                   HVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVFANDVMGSAESLFIKAIEDAVALGA
FT                   DVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYGSDHDDPLAINPDY
FT                   GLVGSPSTGRTPTSVAAINSKWVIQRLMTVKELENRADLNHGKAIYSESVDFKNIKDSL
FT                   GYDKSHQFAYVKESTDAGYKAQDVKDKIALIERDPNKTYDEMIALAKKHGALGVLIFNN
FT                   KPGQSNRSMRLTANGMGIPSAFISHEFGKAMSQLNGNGTGSLEFDSVVSKAPSQKGNEM
FT                   NHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTSMASPQIAGASLLVKQYLE
FT                   KTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYVTG
FT                   KDNYGSISLGNITDTMTFDVTVHNLSNKDKTLRYDTELLTDHVDPQKGRFTLTSRSLKT
FT                   YQGGEVTVPANGKVTVRVTMDVSQFTKELTKQMSNGYYLEGFVRFRDSQDDQLNRVNIP
FT                   FVGFKGQFENLAVAEESIYRLKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVS
FT                   TKTISDNGLHTLGTFKNADGKFILEKNAQGNPVLAISPNGDNNQDFAAFKGVFLRKYQG
FT                   LKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKSTTLLGTAFSGKSLTGAELPD
FT                   GYYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATFDPETNRFKPEPLKDRGLAGV
FT                   RKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQADGSFILPLDKAKLGDFYYM
FT                   VEDFAGNVAIAKLGDHLPQTLGKTPIKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQA
FT                   QLAVVHRNQPQSQLTKMNQDFFISPNEDGNKDFVAFKGLKNNVYNDLTVNVYAKDDHQK
FT                   QTPIWSSQAGASASAIESTAWYGITARGSKVMPGDYQYVVTYRDEHGKEHQKQYTISVN
FT                   DKKPMITQGRFDTINGVDHFTPDKTKALGSSGIVREEVFYLAKKNGRKFDVTEGKDGIT
FT                   VSDNKMYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGNVSFATLRDLKAVGKDKAVVN
FT                   FGLDLPVPEDKQIVNFTYLVRDADGKPIENLEYYNNSGNSLILPYGKYTVELLTYDTNA
FT                   AKLESDKIVSFTLSADNNFQQVTFKMTMLATSQITAHFDHLLPEGSRVSLKTAQGQLIP
FT                   LEQSLYVPKAYGKTVQEGTYEVVVSLPKGYRIEGNTKVNTLPNEVHELSLRLVKVGDAS
FT                   DSTGDHKVMSKNNSQALTAFATPTKTTTSATAKALPSAGEKMGLKLRIVGLVLLGLTCV
FT                   FSRKKSTKD"
FT   gene            381999..382706
FT                   /locus_tag="spyM18_0467"
FT   CDS_pept        381999..382706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33445.1| (AE006503)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97196"
FT                   /protein_id="AAL97196.1"
FT                   /translation="MSKKKRKHYQVYEGLRCAMTLCFISGYVNAFTYMTQGKRFAGVQT
FT                   GNLLSFAIRLSEQQLKEALQFLLPMIVFMLGQSFTYFMHRWATKKGLHWYLLSSVMLTG
FT                   LAFGTALFTPFLPSNVTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKNAAYLLTKG
FT                   LYEKNHELTHIGRNTLIVILAFAVGVVCSTLLCIAYGEYALMPILMPLLYVNYLLAQEF
FT                   YHIQTKIKPIKRT"
FT   gene            382949..384946
FT                   /gene="metS"
FT                   /locus_tag="spyM18_0468"
FT   CDS_pept        382949..384946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="spyM18_0468"
FT                   /product="putative methionyl-tRNA synthetase"
FT                   /note="best blastp match gb|AAK33446.1| (AE006503) putative
FT                   methionyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97197"
FT                   /db_xref="GOA:Q8P298"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P298"
FT                   /protein_id="AAL97197.1"
FT                   /translation="MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFY
FT                   LTGLDEHGQKIQTKAKEAGISPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVV
FT                   AAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEW
FT                   VSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTWG
FT                   VPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWNGTVFHMVGKDILRFHSIYW
FT                   PILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLP
FT                   VGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQ
FT                   LIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMA
FT                   HLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPANTKVVAKGTPIFP
FT                   RLDMEAEIDYIKAQMGDSSAISQEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKEV
FT                   SKVEGSEKLLRFRVDAGDGQDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMVKKYI
FT                   SQGMILSAEHGDQLTVLTVDSSVPNGSIIG"
FT   gene            385440..386453
FT                   /gene="nrdF"
FT                   /locus_tag="spyM18_0470"
FT   CDS_pept        385440..386453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="spyM18_0470"
FT                   /product="putative ribonucleotide reductase 2"
FT                   /note="best blastp match gb|AAK33447.1| (AE006503) putative
FT                   ribonucleotide reductase 2 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97198"
FT                   /protein_id="AAL97198.1"
FT                   /translation="MTQHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRSRVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   gene            386457..386945
FT                   /gene="nrdI"
FT                   /locus_tag="spyM18_0471"
FT   CDS_pept        386457..386945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="spyM18_0471"
FT                   /product="putative ribonucleotide reductase"
FT                   /note="best blastp match gb|AAK33448.1| (AE006503) putative
FT                   ribonucleotide reductase (NrdI protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97199"
FT                   /db_xref="GOA:P65551"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65551"
FT                   /protein_id="AAL97199.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNRPLEVSTHYLL
FT                   IVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKL
FT                   QVPLLHQFELLGTATDVKKVQAIFARLKHHTHDKQKQTNNLITERTHPCHKPMRHTSH"
FT   gene            386912..389092
FT                   /locus_tag="spyM18_0472"
FT   CDS_pept        386912..389092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0472"
FT                   /product="ribonucleoside-diphosphate reductase, large
FT                   chain"
FT                   /note="best blastp match gb|AAK33449.1| (AE006503)
FT                   ribonucleoside-diphosphate reductase, large chain
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97200"
FT                   /protein_id="AAL97200.1"
FT                   /translation="MSQTNASYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPDQ
FT                   MAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSY
FT                   ALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISAR
FT                   KFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLS
FT                   FETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVEAGNAA
FT                   NHAVGLGVMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKGAFAGF
FT                   SLSTYADGTYFAKYLQEDVKPQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYE
FT                   VGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQD
FT                   VLAGSEQYDEDSLVTAPGASDETTTECQSCMI"
FT   gene            complement(389324..390049)
FT                   /locus_tag="spyM18_0476"
FT   CDS_pept        complement(389324..390049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33450.1| (AE006504)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97201"
FT                   /protein_id="AAL97201.1"
FT                   /translation="MLKKRYQLAMILLLSCFSLIWQTEGLVKLFVCEHYERAVCEGTPA
FT                   YFTFSDQKGAETLIKKRWGKGLVYPRTEQEAMAAYTCQQAALINTSLDKTKGELSQLTP
FT                   ELRDQVAQLDAATHRLVIPWNIVVYRYVYETFLRDIGVSHADLTSYYRNDQFDPHILCK
FT                   IKLGTRYTKHSFMSTTALKNGAMTHRPVECASVSKKGPKQPLSSLIRLCLQRLSSCFQE
FT                   AVSWRSLELTCHRTTKSST"
FT   gene            390507..390857
FT                   /locus_tag="spyM18_0477"
FT   CDS_pept        390507..390857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0477"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97202"
FT                   /protein_id="AAL97202.1"
FT                   /translation="MKTRSKRFLNLATLCLALLGTILLMEQPVKAEAIRTDGQTEHISQ
FT                   STDGQSTDRQKDRDAGYEAGLRDGRRDAQTLSEPREPDQDQGDFKSLDYCDGYFIGYYR
FT                   GWDEVRYPVQTF"
FT   gene            391272..391523
FT                   /locus_tag="spyM18_0479"
FT   CDS_pept        391272..391523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0479"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33453.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97203"
FT                   /protein_id="AAL97203.1"
FT                   /translation="MSEKKVLPVLSMVVSFVCLLDHIFFFATYSYLYLPLVASSLALIG
FT                   LVQNKGRQKVWSLAGLVLAALAVAVVAYAYYDPTVIPY"
FT   gene            complement(391617..392117)
FT                   /locus_tag="spyM18_0480"
FT   CDS_pept        complement(391617..392117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0480"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33454.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97204"
FT                   /protein_id="AAL97204.1"
FT                   /translation="MKKTLTLLLALFAIGVTSSVRAEESSWVPLPRQQKVLDDNRNEIP
FT                   VHITGNKVTVTLPPGWSAWIDKNTKQRNSNSVTTTVTLDISTSQPPKEFTIYFQGDDGF
FT                   LAGTMTFIDSETLKNEQYKAFDDEYAENLFENSRLREEQKTWRNKVRDVFQDAWWNFKG
FT                   LFQ"
FT   gene            392440..392715
FT                   /locus_tag="spyM18_0482"
FT   CDS_pept        392440..392715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0482"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33458.1| (AE006504)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97205"
FT                   /protein_id="AAL97205.1"
FT                   /translation="MPKVSISSIKENNMTFEEILPGLKAKKKYVRTGWGGAENYVQLFD
FT                   TLEVDGKVLQATPYFLIHVTGAGEGFSMWAPTPCDVLAEDWIEVND"
FT   gene            392708..393406
FT                   /locus_tag="spyM18_0483"
FT   CDS_pept        392708..393406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0483"
FT                   /product="putative dehydrogenease / oxidoreductase"
FT                   /note="best blastp match gb|AAK33459.1| (AE006504) putative
FT                   dehydrogenease / oxidoreductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97206"
FT                   /protein_id="AAL97206.1"
FT                   /translation="MTKVVLVTGCSSGIGYAQARYFLRQGYHVYGVDKSDKPDLSGNFH
FT                   FIKLDLSSELSPLFKVVPSVDILCNTAGILDAYKPLLDVSDEEVEHLFDINFFATVKLT
FT                   RHYLRHMVEKQSGVIINMCSIASFIAGGGGVAYTSSKHALAGFTRQLALDYAKDQIHIF
FT                   GIAPGAVKTAMTASDFEPGGLADWVARETPIGRWTEPDEVAELTGFLASGKARSMQGEI
FT                   VKIDGGWTLK"
FT   gene            393482..394441
FT                   /locus_tag="spyM18_0484"
FT   CDS_pept        393482..394441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33460.1| (AE006504)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97207"
FT                   /protein_id="AAL97207.1"
FT                   /translation="MKLAVLGTGMIVKEVLPVLQKIDGIDLVAILSTVRSLTTAKDLAK
FT                   AYKMPLATSKYEAVLGNEEIDTVYIGLPNHLHFAYAKKALLAGKHVICEKPFTMTAGEL
FT                   DELVVIAKKRKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQYSSRYDAFKRG
FT                   DIAPAFNPKMGGGALRDLNIYNIHFVVGLFGRPKTVHYLANVEKGIDTSGMLVMDYEQF
FT                   KVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVQLSLHGHEPQVINHNKHGHRMY
FT                   EEFVAFRDMIDQRDFEKVNQALEHSRAVMSVLERAVHS"
FT   gene            394774..396111
FT                   /gene="glpT"
FT                   /locus_tag="spyM18_0485"
FT   CDS_pept        394774..396111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="spyM18_0485"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="best blastp match gb|AAK33461.1| (AE006504) putative
FT                   glycerol-3-phosphate transporter [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97208"
FT                   /protein_id="AAL97208.1"
FT                   /translation="MEEDYNKREPEKFTQFLRRQKVVFFVVFFGYVCAYLVRNNFKLMS
FT                   NTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICILI
FT                   GFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSALL
FT                   PLTIALLTSMGLVVPANGNILLAFLIPGVLVFLFALCCWKLGGDNPESEGLDSLRTMYG
FT                   DAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQ
FT                   VANMSEAHIHFAISMLEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYERL
FT                   TATGAPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNM
FT                   GANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   gene            396284..397666
FT                   /gene="glmU"
FT                   /locus_tag="spyM18_0486"
FT   CDS_pept        396284..397666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="spyM18_0486"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /note="best blastp match gb|AAK33462.1| (AE006505) putative
FT                   UDP-N-acetylglucosamine pyrophosphorylase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97209"
FT                   /db_xref="GOA:Q8P286"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P286"
FT                   /protein_id="AAL97209.1"
FT                   /translation="MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISP
FT                   EKSVTVIGHKSEMVRAVLADQSAFVHQTEQLGTGHAVMMAETQLEGLEGHTLVIAGDTP
FT                   LITGESLKSLIDFHVNHKNVATILTATAPDPFGYGRIVRNKDGEVIKIVEQKDANEYEQ
FT                   QLKEINTGTYVFDNKRLFEALKCITTNNAQGEYYLTDVVAIFRANKEKVGAYILRDFNE
FT                   SLGVNDRVALATAETVMRQRITQKHMVNGVTFQNPETVYIESDVEIAPDVLIEGNVTLK
FT                   GRTHIGSGTVLTNGTYIVDSEIGQGSIITNSMIESSVLAAGVTVGPYAHLRPGTTLDRE
FT                   VHIGNFVEVKDSHIGEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDGQNKYETVIGDH
FT                   AFIGSNSTLIAPLEVGDNALTAAGSTISKTVPADSIVIGRSRQVTKEGYAKRLAHHPSR
FT                   SK"
FT   gene            397700..398254
FT                   /locus_tag="spyM18_0487"
FT   CDS_pept        397700..398254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33463.1| (AE006505)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97210"
FT                   /protein_id="AAL97210.1"
FT                   /translation="MKFEEKTLKRQTVFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAITPERKIVLVKQYRKAIESVSYEIPAGKLEIGEEGSKLKAAARELEEETAYTGT
FT                   LTFLYEFYTAIGFCNEKITLFLATDLTQVANPKPQDDDEVIEVLELTYQECMDLVAQGK
FT                   LADAKTLIALQYYALHFEGEQ"
FT   gene            398254..398505
FT                   /locus_tag="spyM18_0489"
FT   CDS_pept        398254..398505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0489"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33464.1| (AE006505)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97211"
FT                   /protein_id="AAL97211.1"
FT                   /translation="MGRPLLTDDIIEKARRMETFEPDDAVDFDTKVMTLPEKDEKARIY
FT                   KSRRIENAKRSQLQSKLNVILIAVMLLIAILVYAIFYL"
FT   gene            398525..399220
FT                   /gene="pfs"
FT                   /locus_tag="spyM18_0490"
FT   CDS_pept        398525..399220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="spyM18_0490"
FT                   /product="putative MTA/SAH nucleosidase"
FT                   /note="best blastp match gb|AAK33465.1| (AE006505) putative
FT                   MTA/SAH nucleosidase
FT                   (5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97212"
FT                   /protein_id="AAL97212.1"
FT                   /translation="MKIGIIAAMKEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELIL
FT                   VQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATA
FT                   FGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKT
FT                   AFSDVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQIL
FT                   MTFLENLPV"
FT   gene            399371..399712
FT                   /locus_tag="spyM18_0491"
FT   CDS_pept        399371..399712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0491"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33466.1| (AE006505)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97213"
FT                   /protein_id="AAL97213.1"
FT                   /translation="MTLKKYYYLLSLLALVTVGAAFNTSQSVSAQVYSNEGYHQHLTGP
FT                   KSHLQYSKDNAQLQLRNILNGYQSDLGRNYSSYYYYNLRTVMGLSSKQEIEEHYEKLKD
FT                   ELYRMYNHY"
FT   gene            complement(399813..400460)
FT                   /locus_tag="spyM18_0492"
FT   CDS_pept        complement(399813..400460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0492"
FT                   /product="putative metal-dependent transcriptional
FT                   regulator"
FT                   /note="best blastp match gb|AAK33467.1| (AE006505) putative
FT                   metal-dependent transcriptional regulator [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97214"
FT                   /protein_id="AAL97214.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQETKITNKMVAEKMHVSAPAVSEMIKKM
FT                   ISQGWIVKDKAKGYLLKDKGYALVANLYRKHRLIEVFLIRQLGYNTQEVHQEAEVLEHT
FT                   VSDTFIDRLDKILDFPDFCPHGGTIPRYGQPLVEMNTTTLNTITELGRFRLSRIHDHFD
FT                   LIQYLETHHLNINTELTLTQIDTFAKTYTICYGDKELVIPENIAKQLYVTAL"
FT   gene            400606..401538
FT                   /gene="mtsA"
FT                   /locus_tag="spyM18_0494"
FT   CDS_pept        400606..401538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="spyM18_0494"
FT                   /product="putative metal binding protein of ABC transporter
FT                   (lipoprotein)"
FT                   /note="best blastp match gb|AAK33468.1| (AE006505) metal
FT                   binding protein of ABC transporter (lipoprotein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97215"
FT                   /db_xref="GOA:Q8P280"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P280"
FT                   /protein_id="AAL97215.1"
FT                   /translation="MGKKMSLILGAFLSVFLLVACSSTGTKTAKSDKLKVVATNSIIAD
FT                   MTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDVEKTSNADVIFYNGINLEDGGQAWFTKL
FT                   VKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKD
FT                   PKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAY
FT                   IWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTD
FT                   SIAKKGKPGDSYYAMMKWNLDKISEGLAK"
FT   gene            401602..402327
FT                   /gene="mtsB"
FT                   /locus_tag="spyM18_0496"
FT   CDS_pept        401602..402327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="spyM18_0496"
FT                   /product="ATP-binding protein MtsB"
FT                   /note="best blastp match gb|AAD56937.1|AF180520_2
FT                   (AF180520) ATP-binding protein MtsB [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97216"
FT                   /protein_id="AAL97216.1"
FT                   /translation="MITTNNLCVTYDGNSNALEAINVTIEGPSIVGIIGPNGAGKSTFM
FT                   KAILNLIDYQGHVTVDGKDGRKLGHTVAYVEQRSMIDYNFPITVKECVALGTYSKLGLF
FT                   RRVGKKQFEQVDKVLKQVGLEDFGHRPIKSLSGGQFQRMLVARCLIQESDYIFLDEPFV
FT                   GIDSVSEKIIVDLLKELKMAGQTILIVHHDLSKVEHYFDKLMILNKHLVAYGNVCEVFT
FT                   VDTLSKAYGNHLILGKEMV"
FT   gene            402328..403182
FT                   /gene="mtsC"
FT                   /locus_tag="spyM18_0498"
FT   CDS_pept        402328..403182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="spyM18_0498"
FT                   /product="integral membrane protein MtsC"
FT                   /note="best blastp match gb|AAD56938.1|AF180520_3
FT                   (AF180520) integral membrane protein MtsC [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97217"
FT                   /protein_id="AAL97217.1"
FT                   /translation="MSMKFFEGLMSYHFLQNALITAVVIGIVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGVNFFIGAIIFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGVILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSIFVLGVISLFFKELLLTSFD
FT                   PILAKSMGVKVNAYHYLLMVLLTLVAVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSLLGALASVLGLYLGYTFNVAAGSSIVLTSAMMFLISFFVSPKQGYLKRWMQKKE
FT                   KTP"
FT   gene            complement(403330..404136)
FT                   /gene="cypB"
FT                   /locus_tag="spyM18_0499"
FT   CDS_pept        complement(403330..404136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypB"
FT                   /locus_tag="spyM18_0499"
FT                   /product="putative cyclophilin-type protein"
FT                   /note="best blastp match gb|AAK33471.1| (AE006505) putative
FT                   cyclophilin-type protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97218"
FT                   /protein_id="AAL97218.1"
FT                   /translation="MKKLLSLSLVAISLLSLSACESVDRAIKGDKYIDEKTAKEESEAA
FT                   SKAYEESIQKALKADASQFPQLTKEVGKEEAKVVMRTNQGDITLKLFPKYAPLAVENFL
FT                   THAKKGYYDNLTFHRVINDFMIQSGDPKGDGTGGESIWKGKDPKKDAGNGFVNEISPFL
FT                   YHIRGALAMANAGANTNGSQFYINQNKKNQSKGLSSTNYPKPIISAYEHGGNPSLDGGY
FT                   TVFGQVIDGMDVVDKIAATSINQNDKPEQDITITSIDIVKDYRFKN"
FT   gene            404353..406758
FT                   /gene="ftsK"
FT                   /locus_tag="spyM18_0500"
FT   CDS_pept        404353..406758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="spyM18_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33472.1| (AE006505)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97219"
FT                   /db_xref="GOA:Q8P276"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P276"
FT                   /protein_id="AAL97219.1"
FT                   /translation="MVKRNQRKKSAPKKRLTKAEVEKQRAIKRMILSVLMALLLIFAML
FT                   RLGVFGVTTYNMIRFLVGSLAYPFMFAWLIYLFCFKWLRQKDGMIAGVVIAFLGLLVEW
FT                   HAFLFAMPRMLDQDIFLGTARLITRDLLALRVTEFVGGGMLGALLYKPIAFLFSNIGSY
FT                   FIGFLFILLGLFLMTPWDIYDVSHFVKEAVDKLAVAYQENKEKRFIKREEHRLQTEKEA
FT                   LEKQAQEEEKRLAELTVDPETGEIVEDSQSQVSYDLAEDMTKEPEILAYDSHLKDDEAS
FT                   LFDQEDLAYAHEKIGAYDSLSALASSEDEMDMDEPVEVDFTPKTHLLYKLPTIDLFAPD
FT                   KPKNQSKEKNLVRKNIKVLEDTFQSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISN
FT                   LADDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANPENLLEVPL
FT                   GKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFMMIDPKMV
FT                   ELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGYNTKVEEFN
FT                   ASSEQKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSVD
FT                   VISGLIKANVPSRMAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQGSF
FT                   ISDDDVERIVNFIKDQAEADYDDAFDPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLE
FT                   TQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTN"
FT   gene            complement(406828..407181)
FT                   /locus_tag="spyM18_0502"
FT   CDS_pept        complement(406828..407181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0502"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33473.1| (AE006505)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97220"
FT                   /protein_id="AAL97220.1"
FT                   /translation="MMIYKLTALAFLIVTPLFAMIVTSLFKLNKKGFKFPDVALLLFAI
FT                   EILLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVIRTQSFSYHRFMKLFWRVGFLVTVI
FT                   FYLILVIFIFTLA"
FT   gene            407425..407850
FT                   /gene="rl11"
FT                   /locus_tag="spyM18_0503"
FT   CDS_pept        407425..407850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl11"
FT                   /locus_tag="spyM18_0503"
FT                   /product="50S ribosomal protein L11"
FT                   /note="best blastp match gb|AAK33474.1| (AE006506) 50S
FT                   ribosomal protein L11 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97221"
FT                   /db_xref="GOA:P66059"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66059"
FT                   /protein_id="AAL97221.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQ
FT                   VQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTVTD"
FT   gene            407956..408645
FT                   /gene="rl1"
FT                   /locus_tag="spyM18_0504"
FT   CDS_pept        407956..408645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl1"
FT                   /locus_tag="spyM18_0504"
FT                   /product="50S ribosomal protein L1"
FT                   /note="best blastp match gb|AAK33475.1| (AE006506) 50S
FT                   ribosomal protein L1 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97222"
FT                   /db_xref="GOA:P66098"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66098"
FT                   /protein_id="AAL97222.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGI
FT                   KVDPNSL"
FT   gene            408967..409695
FT                   /gene="pyrH"
FT                   /locus_tag="spyM18_0505"
FT   CDS_pept        408967..409695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="spyM18_0505"
FT                   /product="putative uridylate kinase"
FT                   /note="best blastp match gb|AAK33476.1| (AE006506) putative
FT                   uridylate kinase (UMP-kinase) [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97223"
FT                   /db_xref="GOA:P65940"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65940"
FT                   /protein_id="AAL97223.1"
FT                   /translation="MEPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGV
FT                   QIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IQRVVFGEHIGTTVSNKVCD"
FT   gene            409724..410281
FT                   /gene="rrf"
FT                   /locus_tag="spyM18_0506"
FT   CDS_pept        409724..410281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /locus_tag="spyM18_0506"
FT                   /product="putative ribosome recycling factor"
FT                   /note="best blastp match sp|P82556|RRF_STRPY RIBOSOME
FT                   RECYCLING FACTOR (RIBOSOME RELEASING FACTOR) (RRF)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97224"
FT                   /db_xref="GOA:Q8P274"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P274"
FT                   /protein_id="AAL97224.1"
FT                   /translation="MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSG"
FT   gene            410390..411247
FT                   /locus_tag="spyM18_0507"
FT   CDS_pept        410390..411247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33478.1| (AE006506)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97225"
FT                   /protein_id="AAL97225.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIQKEGFTFTLSKAEGERQIGDMV
FT                   TGFAYIDIKQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVDTGIPNKEIVVSLDVLP
FT                   EMKELWPKKGDKLYIRLDVDKKDRIWGLPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEEIKAIFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   gene            411320..411829
FT                   /gene="msrA"
FT                   /locus_tag="spyM18_0509"
FT   CDS_pept        411320..411829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="spyM18_0509"
FT                   /product="putative peptide methionine sulfoxide reductase"
FT                   /note="best blastp match gb|AAK33479.1| (AE006506) putative
FT                   peptide methionine sulfoxide reductase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97226"
FT                   /db_xref="GOA:Q8P272"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P272"
FT                   /protein_id="AAL97226.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPEEISYKELVELYWAQTDPTDAFGQFEDRGDNYRPVIYYTTERQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIRHQF
FT                   LEENWS"
FT   gene            411826..412041
FT                   /locus_tag="spyM18_0510"
FT   CDS_pept        411826..412041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33480.1| (AE006506)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97227"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNH7"
FT                   /protein_id="AAL97227.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELIS
FT                   RYLEDQASFSFNLGQFDEIWEDYLAH"
FT   gene            412197..413378
FT                   /locus_tag="spyM18_0511"
FT   CDS_pept        412197..413378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0511"
FT                   /product="putative 42 kDa protein"
FT                   /note="best blastp match gb|AAK33481.1| (AE006506) putative
FT                   42 kDa protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97228"
FT                   /protein_id="AAL97228.1"
FT                   /translation="MIITKKSLFVTSVALSLAPLVTAQAQEWTPRSVTEIKSELVLVDN
FT                   VFTYTVKYGDTLSTIAEAMGIDVHVLGDINHIANIDLIFPDTILTANYNQHGQATTLTV
FT                   QAPASSPASVSHVPSSEPLPQASATSQSTVPMAPSATPSDVPTTPLASAKPDSFVTASS
FT                   ELTSSTNDVSTELSSESQKQPEVSQEAVPTPKAAETTEVEPKTDISEDPTSANRPVPNE
FT                   SASEEASSAAPAQAPAEKEETSQMLTAPAAQKAVADTTSVATSNGLSYAPNHAYNPMNA
FT                   GLQPQTAAFKEEVASAFGITSFSGYRPGDPGDHGKGLAIDFMVPVSSTLGDQVAQYAID
FT                   HMAERGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSITENHYDHVHVSFNA"
FT   gene            413693..415465
FT                   /locus_tag="spyM18_0512"
FT   CDS_pept        413693..415465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0512"
FT                   /product="67 kDa Myosin-crossreactive streptococcal
FT                   antigen"
FT                   /note="best blastp match gb|AAK33482.1| (AE006506) 67 kDa
FT                   Myosin-crossreactive streptococcal antigen [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97229"
FT                   /protein_id="AAL97229.1"
FT                   /translation="MYYTSGNYEAFATPRKPEKVDQKSAYIVGTGLAGLAAAVFLIRDG
FT                   HMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREMENHFECMWDMYRSIPSLEIPG
FT                   ASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQSKELIHLIMKTEESLGDQ
FT                   TIEEFFSEDFFKSNFWVYWATMFAFEKWHSAVEMRRYAMRFIHHIDGLPDFTSLKFNKY
FT                   NQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKVAKTIHMTVSGEAKAIELTP
FT                   DDLVFVTNGSITESSTYGSHHEVAKPTKALGGSWNLWENLAAQSDDFGHPKVFYQDLPA
FT                   ESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSNWMMSFAIHRQPHFK
FT                   EQKENETTVWIYGLYSNSKGNYVHKKIEECTGQEITEEWLYHLGVPVEKIKDLASQDYI
FT                   NTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAESPSRDTVFTTEYPIRTAM
FT                   EAVYSFLNVERGIPEVFNSAYDIRELLKAFYYLNDKKAIKDMDLPIPALIEKIGHKKIK
FT                   DTFIEELLKDANLI"
FT   gene            415624..416676
FT                   /gene="phoH"
FT                   /locus_tag="spyM18_0513"
FT   CDS_pept        415624..416676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="spyM18_0513"
FT                   /product="phosphate starvation-induced protein"
FT                   /note="best blastp match gb|AAK33483.1| (AE006506)
FT                   phosphate starvation-induced protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97230"
FT                   /protein_id="AAL97230.1"
FT                   /translation="MQEYSIDITLTHPDDVLALFGSNERHLKLIEAHLGVIVHARTERV
FT                   QVIGEDEEAVELARLTIKALLVLVGRGMVVNTSDVVTALSMAESHQIDQFMALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEEMKDLLKPKASDVEADYQPGL
FT                   TKYPVIGQEH"
FT   gene            416722..417297
FT                   /locus_tag="spyM18_0514"
FT   CDS_pept        416722..417297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33484.1| (AE006506)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97231"
FT                   /protein_id="AAL97231.1"
FT                   /translation="MDDLTKAIMADEANLSYTERGIFPLYDAPQTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYHSGLFGIIPMDFYYPGKGKSGDLPPREGFAAK
FT                   WHPPLRALMPEVELTILVGRYAQDFYLGKKAYKTLTETVRHFEEYLPDCFPLVHPSPRN
FT                   QLWLAKNPWFEQDLLPILQKRVEAILTK"
FT   gene            417456..417953
FT                   /locus_tag="spyM18_0515"
FT   CDS_pept        417456..417953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33485.1| (AE006507)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97232"
FT                   /db_xref="GOA:P67142"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67142"
FT                   /protein_id="AAL97232.1"
FT                   /translation="MYIEMIDETGQVSQEIMEQTLDLLNFAAQKTGKEEKEMSVTFVTN
FT                   ERSHELNLEYRDTDRPTDVISLEYKPETPILFSQEDLAADPSLAEMMAEFDAYIGELFI
FT                   SIDKAREQSQEYGHSFEREMGFLAVHGFLHINGYDHYTLEEEKEMFTLQEEILTAYGLT
FT                   RQ"
FT   gene            417928..418341
FT                   /locus_tag="spyM18_0516"
FT   CDS_pept        417928..418341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0516"
FT                   /product="putative diacylglycerol kinase"
FT                   /note="best blastp match gb|AAK33486.1| (AE006507) putative
FT                   diacylglycerol kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97233"
FT                   /protein_id="AAL97233.1"
FT                   /translation="MLMALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHL
FT                   LSACLACVAGLFFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNA
FT                   KDMAAGAVLMISGYAVLTGLIIFIPKIWNIFVH"
FT   gene            418461..419357
FT                   /gene="era"
FT                   /locus_tag="spyM18_0517"
FT   CDS_pept        418461..419357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="spyM18_0517"
FT                   /product="putative GTP-binding protein"
FT                   /note="best blastp match sp|Q9RIK5|ERA_STRPY GTP-BINDING
FT                   PROTEIN ERA HOMOLOG"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97234"
FT                   /db_xref="GOA:P64088"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64088"
FT                   /protein_id="AAL97234.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   gene            419377..419853
FT                   /locus_tag="spyM18_0518"
FT   CDS_pept        419377..419853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33488.1| (AE006507)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97235"
FT                   /protein_id="AAL97235.1"
FT                   /translation="MPQDYISYIRSKVGHDKIILNFAGGILTNDDGKVLMQLRGDKKTW
FT                   AIPGGTMELGESSLETCKREFLEETGIEVEAVRLLNVYTHFEEVYPNGDAVQTIVFIYE
FT                   LTAVSDMAIDNFHNEETLKLQFFSHEEIAELESVSAKHRLMLEEYFSDSFAMGH"
FT   gene            complement(420159..420413)
FT                   /locus_tag="spyM18_0520"
FT   CDS_pept        complement(420159..420413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0520"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33489.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97236"
FT                   /protein_id="AAL97236.1"
FT                   /translation="MSGLFYHKSYFFKSKQVYDLLNEIRMRYPHAHIILIGNHINYEEI
FT                   FKNHYRVFGVIDTTSHKSLKSIRDQIQLYLDELYNSNNG"
FT   misc_feature    420703..420921
FT                   /note="spyM18_0521; probable gene fragment; best blastp
FT                   match emb|CAC10170.1| (AJ278301) response regulator
FT                   [Streptococcus pneumoniae]"
FT   misc_feature    complement(421004..421450)
FT                   /note="spyM18_0522; probable gene fragment; best blastp
FT                   match sp|Q03727|COMA_STRPN TRANSPORT ATP-BINDING PROTEIN
FT                   COMA"
FT   misc_feature    complement(421673..422374)
FT                   /note="spyM18_0523; probable gene fragment; best blastp
FT                   match emb|CAC18585.1| (AJ278419) ABC transporter
FT                   [Streptococcus pneumoniae]"
FT   misc_feature    complement(422479..422715)
FT                   /note="spyM18_0524; probable gene fragment; best blastp
FT                   match emb|CAC03519.1| (AJ276410) putative ABC transporter
FT                   BlpAORF1 [Streptococcus pneumoniae]"
FT   misc_feature    423013..423237
FT                   /note="spyM18_0525; probable gene fragment; best blastp
FT                   match emb|CAC03530.1| (AJ276411) BlpU protein
FT                   [Streptococcus pneumoniae]"
FT   misc_feature    423215..423391
FT                   /note="spyM18_0526; probable gene fragment; best blastp
FT                   match hypothetical"
FT   misc_feature    424082..424210
FT                   /note="spyM18_0527; probable gene fragment; best blastp
FT                   match hypothetical"
FT   misc_feature    424608..424835
FT                   /note="spyM18_0528; probable gene fragment; best blastp
FT                   match hypothetical"
FT   misc_feature    424884..425201
FT                   /note="spyM18_0530; probable gene fragment; best blastp
FT                   match emb|CAB75884.1| (AJ272077) hypothetical protein
FT                   [Leuconostoc mesenteroides]"
FT   misc_feature    425214..425336
FT                   /note="spyM18_0531; probable gene fragment; best blastp
FT                   hypothetical"
FT   misc_feature    425492..425935
FT                   /note="spyM18_0533; probable gene fragment; best blastp
FT                   match gi|565038|emb|CAA55220.1| (X78469) orfB; orfA and
FT                   orfB are possibly translated as one large transposase
FT                   protein through a frameshift motif [Lactococcus lactis]"
FT   misc_feature    426191..426406
FT                   /note="spyM18_0534; probable gene fragment; best blastp
FT                   match gb|AAK04151.1|AE006243_15 (AE006243) transposase of
FT                   IS904A [Lactococcus lactis subsp. lactis]"
FT   gene            426620..427825
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0536"
FT   CDS_pept        426620..427825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0536"
FT                   /product="transposase-IS1562"
FT                   /note="best blastp match gb|AAK34692.1| (AE006623)
FT                   transposase - IS1562 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97237"
FT                   /protein_id="AAL97237.1"
FT                   /translation="MLHKEKPDYNRNQYGFYTLDQLVPDEHFLRQVEAVIDFDFIYDLV
FT                   EDTYSSDNGRPSLDPVMLVKIPLIQCFYGIRSMRQTIKDIEVNTAYRWFLGLTLDDKVP
FT                   HFTTYGKNYSRRFQEKGMIESIFTHILGLCINTGLIDPTEIFIDGTHIKAAANNRKFIN
FT                   REVEKQAKFMSEQLEIEINRDREKHGKKPLGPAKELEPVAKKISTTDPESGWFHKGDHK
FT                   EVFAYSAQVACDKYGWALAYSVEAGNIHDSQAFPALFAKLEPLKPQFIIADSGYNIPSI
FT                   AKFLIDKEITPVLPYTRPRGKKDLLRPKELIYDEHFDCVICPEHQALTYRTTTREGYRE
FT                   YKSDPAICANCPLLSVCTTSKNYQKVVIRHIWKDYLAQPRNTTISAIRERKASPKWKIR
FT                   LD"
FT   misc_feature    427732..428031
FT                   /note="spyM18_0537; probable gene fragment; best blastp
FT                   match dbj|BAB16031.1| (AB030747) transposase [Streptococcus
FT                   pyogenes]"
FT   gene            428266..429015
FT                   /locus_tag="spyM18_0538"
FT   CDS_pept        428266..429015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0538"
FT                   /product="putative response regulator"
FT                   /note="best blastp match emb|CAC10174.1| (AJ278302)
FT                   response regulator [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97238"
FT                   /protein_id="AAL97238.1"
FT                   /translation="MNIFVLEDDFLHQTRIEKIIYKILTDNKLEVNHLEVYGKPNQLLE
FT                   DISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNRDPHAVIVFVTTHSEFMPVSFQYQVS
FT                   ALDFIDKELPEELFSHRIEKAITYVQDNQGKTLAEDSFVFINVKSQIQVPFSDLLYIET
FT                   SLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLK
FT                   GGLSCIVSRLKIRSLIKVVEELHTKEK"
FT   gene            429016..430350
FT                   /locus_tag="spyM18_0539"
FT   CDS_pept        429016..430350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0539"
FT                   /product="putative histidine kinase"
FT                   /note="best blastp match emb|CAC10171.1| (AJ278301)
FT                   histidine kinase [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97239"
FT                   /protein_id="AAL97239.1"
FT                   /translation="MIYLINMIVITLNVVVLLLIHARIFGYRMDTKKSLLGILTFYICS
FT                   LLSTSLSNLLSVGFLGGLLLYPLFFLLYTRYIARRKVNGSLLLFYSLFPIAFWDVIHSF
FT                   IVYFIVFNISFLKNNYHSNIIIMIFSIVAGTMVLLLIQAFNYDFSHLRKKKLNQRTRTI
FT                   ISIANFSMILYFITIPMIDFIEEVENINFTHYQEMITAIYFLLFICFVNLLDRNLRQEL
FT                   QKQVVLQKELQLQNMARYSKQIEGLYQNIRSFRHDYAHILTSLKIGIDCKDIEMISSIY
FT                   HKVLKDSGKVLRGEKFNLARLRNINDLPLKSLLFVKLSEAQRLSIPVSIEIGEPISIEN
FT                   IELIDFLTLVSILIDNAIEGAAESGIVLCFFEQFGKQILIVQNDTFEKQINLSTIFERG
FT                   VSSKGNNRGVGLSNVREILESYPTVTLKTVSNHFVFKQILEIEIL"
FT   gene            complement(430498..430623)
FT                   /locus_tag="spyM18_0540"
FT   CDS_pept        complement(430498..430623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0540"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97240"
FT                   /protein_id="AAL97240.1"
FT                   /translation="MNNKKTKNNFSTLSESELLKVIGGDIFKLVIDHISMKARKK"
FT   misc_feature    complement(430700..431317)
FT                   /note="spyM18_0541; sequence confirmed upstream
FT                   mutation-gene fragment; best blastp match emb|CAC03518.1|
FT                   (AJ276410) BlpB protein [Streptococcus pneumoniae]"
FT   gene            complement(431482..432063)
FT                   /locus_tag="spyM18_0542"
FT   CDS_pept        complement(431482..432063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0542"
FT                   /product="N-terminal fragment of BlpB"
FT                   /note="best blastp match emb|CAC03518.1| (AJ276410) BlpB
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97241"
FT                   /protein_id="AAL97241.1"
FT                   /translation="MNPNLFKSAEFYHRRHHNFATFLILPSVLLVSFLVLFSLFAKKEI
FT                   TITSQGEMTPTKVIASVQSTSDHTIVVNNLKNNKFIKKGDVIIQYSKTMENSQKKALEK
FT                   QLATLNKQKNGLQILKTSLEQETNLFKGEDEFGYSDTFNHFLKQTQDIIIGFAKKMLKS
FT                   IIKQVLLIMPFQLLLVSLTNFIKKLQIMKS"
FT   gene            complement(432074..434227)
FT                   /locus_tag="spyM18_0543"
FT   CDS_pept        complement(432074..434227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0543"
FT                   /product="putative transport ATP-binding protein"
FT                   /note="best blastp match sp|Q03727|COMA_STRPN TRANSPORT
FT                   ATP-BINDING PROTEIN COMA"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97242"
FT                   /protein_id="AAL97242.1"
FT                   /translation="MISYRKTFVAQIDARDCGVAALASIAKYYGSDYSLAHLRELAKTN
FT                   KEGTTALGIVKAAKLMGFETRAIQADMTLFDIEDVPYPFIVHVNKEGKFQHYYVVYQNK
FT                   KNYLIIGDPDPTVKVTKMTKERFTSEWTGVAIFLAPEPSYKPHKDKKNGLINFLPLIFK
FT                   QRSLIFYIILASLLVTLINIVGSYYLQGILDDYIPNQLKSTLGIISIGLIITYILQQMM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANAIIDALAS
FT                   TILSLFLDVSILTIVGTVLLVQNTNLFLLSLVSVPLYIVIIFIFMHPFEKMNNDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQKIDSEFVDYLDKSFKLSKYSILQSSLKQGAQ
FT                   LILNVIVLWFGAKLVMGGKISVGQLITFNTLLSYFTNPLENIINLQTKLQSAKVANNRL
FT                   NEVYLVDSEFQEAGTLVNQELLHGDIQFEELSYKYGFGRDTLSNINLTIKQGDKVSLVS
FT                   ISGSGITTLAKMIVNFFEPYNGRITINHNDLKMIDKKSLRQHINYLPQQAYIFNGSILE
FT                   NLTLGANDCTSHEDILRACEVAEIRQDIEQMPMGYQTELSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKRVIDNLLAMTDKTIIFVAHRLSISARTNQVIVLDEGK
FT                   IIETGSHQELMTKQGFYHHLFSG"
FT   gene            434445..434741
FT                   /locus_tag="spyM18_0544"
FT   CDS_pept        434445..434741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0544"
FT                   /product="putative BlpM homologue"
FT                   /note="best blastp match emb|CAC03524.1| (AJ276410) BlpM
FT                   protein [Streptococcus pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97243"
FT                   /protein_id="AAL97243.1"
FT                   /translation="MIFCTSSRLQRDKFKNYEKKLFDMEIKKLETFHQMTIEKLAKVEG
FT                   GKNNWQANVSGVIAAGSAGAAIGFPVCGVACGYIGAKTAITLWAGVTGATGGF"
FT   gene            434754..434954
FT                   /locus_tag="spyM18_0545"
FT   CDS_pept        434754..434954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33492.1| (AE006507)
FT                   conserved hypothetical protein - bacteriocin like peptide
FT                   associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97244"
FT                   /protein_id="AAL97244.1"
FT                   /translation="MTTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLPHPV
FT                   LAGGCVVGFTVGGAYLGYTAN"
FT   gene            435315..435443
FT                   /locus_tag="spyM18_0547"
FT   CDS_pept        435315..435443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0547"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33493.1| (AE006507)
FT                   conserved hypothetical protein - bacteriocin like peptide
FT                   associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97245"
FT                   /protein_id="AAL97245.1"
FT                   /translation="MTGMAGAAQGVTVCAQTGVFIPWQGYILCGAAGAATNIIWPH"
FT   gene            436625..437689
FT                   /locus_tag="spyM18_0548"
FT   CDS_pept        436625..437689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0548"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33494.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97246"
FT                   /protein_id="AAL97246.1"
FT                   /translation="MLRDVKVKMSSLLVGCAATLLVSLSSTVAADSVHSSDRRFGVGYK
FT                   EETTSQFSSDQPSQVVLYRGEANTVRFTYTNQMYLMKDIRIALDGSGKSLTAQTVPGMG
FT                   HVYEGFQTSARGIFTMSGVPESTVPVANPNVQTKYTRYFKVIDDMHNTMYKGTVFLVQP
FT                   QAWKYTMKSVDQLPVDDLNHIGVAGIERMTTLIKNAGALLTTGSSGAFPDNIKASINPR
FT                   GGQATIIYGDGSTDIIPSAVLWEKGSVKEPTEADQSVGTPTPGIPGKFKRDQSLNEHEA
FT                   MVNVEPLSHVVKDNIKVIDEKSTGRFEPFRPNEDEKEKPASDVKVRPAEVGSWLEPATA
FT                   LPSVEMSAEDRLKS"
FT   gene            437734..438180
FT                   /locus_tag="spyM18_0549"
FT   CDS_pept        437734..438180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0549"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33495.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97247"
FT                   /protein_id="AAL97247.1"
FT                   /translation="MEVSSEVAVSASQPEELHRLPNRLIPEEDNNKLSRVAKEVVTEPR
FT                   LNNPFLLPKKVLSLEDDAAILNHLEEDRNVNKLFLEPVAAEAKREINFHPSDQQVTAKV
FT                   KESSDFHQKQHQTGITYGDDTLADLTHHLLHSDGVLPSLNDKSA"
FT   gene            complement(438529..438798)
FT                   /locus_tag="spyM18_0550"
FT   CDS_pept        complement(438529..438798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0550"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33496.1| (AE006507)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97248"
FT                   /protein_id="AAL97248.1"
FT                   /translation="MTKKQFYLILAISILCFILAVSPKPPIPKHTIERKRTAMTIGHSK
FT                   QNPHKKEALKHKKNKNKTLFLPSGDSAIKSVISMTVRLLLDDQS"
FT   gene            438999..439106
FT                   /locus_tag="spyM18_0551"
FT   CDS_pept        438999..439106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0551"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97249"
FT                   /protein_id="AAL97249.1"
FT                   /translation="MNGNDVSSMVLIQSFFITYQADKPAASAISLNTTA"
FT   gene            439869..440735
FT                   /locus_tag="spyM18_0554"
FT   CDS_pept        439869..440735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0554"
FT                   /product="putative positive transcriptional regulator"
FT                   /note="best blastp match gb|AAK33497.1| (AE006507) putative
FT                   positive transcriptional regulator [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97250"
FT                   /protein_id="AAL97250.1"
FT                   /translation="MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITC
FT                   SRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDY
FT                   ERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLL
FT                   TKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFY
FT                   EKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGGKGDE
FT                   DWSEADL"
FT   gene            440907..441734
FT                   /locus_tag="spyM18_0555"
FT   CDS_pept        440907..441734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0555"
FT                   /product="putative formamidopyrimidine-DNA glycosylase"
FT                   /note="best blastp match gb|AAK33498.1| (AE006508) putative
FT                   formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97251"
FT                   /db_xref="GOA:Q8P250"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P250"
FT                   /protein_id="AAL97251.1"
FT                   /translation="MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTL
FT                   PGQIIQSVGRRGKYLLIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTL
FT                   VYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRT
FT                   YRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP"
FT   gene            441731..442324
FT                   /locus_tag="spyM18_0556"
FT   CDS_pept        441731..442324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0556"
FT                   /product="putative dephosphocoenzyme A kinase"
FT                   /note="best blastp match sp|P58102|COAE_STRPY DEPHOSPHO-COA
FT                   KINASE (DEPHOSPHOCOENZYME A KINASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97252"
FT                   /db_xref="GOA:P63834"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63834"
FT                   /protein_id="AAL97252.1"
FT                   /translation="MIIGITGGIASGKSTVVKVIRKAGYQVIDADQVVHDLQEKGGRLY
FT                   EALREAFGNQILKADGELDRTKLSEMLFSNPDNMATSSAIQNQIIKEELAAKRDHLAQS
FT                   QAIFFMDIPLLMELGYQDWFDAIWLVYVDAQTQLQRLMARNRLDKGKARQRIASQLPIE
FT                   EKKPYASLVIDNNGDMETLIKQVQSALLSLANPR"
FT   gene            442514..444016
FT                   /locus_tag="spyM18_0558"
FT   CDS_pept        442514..444016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33500.1| (AE006508)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97253"
FT                   /protein_id="AAL97253.1"
FT                   /translation="MTTMTIAKGNQPIALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLTKAGEVTDKLAARLATIGVSDYQPQAFPVRMWDVFGQNGQ
FT                   PLRTTISEMGPMMLSRLLNLNDTQTGVLNIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNIAKQSIGAIQRSLLTLEQEGAHQFFGEPALDVADLMQLDVASGYGAINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQSPLDLPETVLAQLGNRIQHALRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSEIESQQLVQ
FT                   SSPFASKYSQSIDRESAYEKLAAKVLEDNRLAQEAIATAQREKEAKEAIKAQAATKKAN
FT                   RRSVGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   gene            444162..445331
FT                   /gene="proP"
FT                   /locus_tag="spyM18_0559"
FT   CDS_pept        444162..445331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="spyM18_0559"
FT                   /product="putative multi-drug resistance efflux pump"
FT                   /note="best blastp match gb|AAK33501.1| (AE006508) putative
FT                   multi-drug resistance efflux pump [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97254"
FT                   /protein_id="AAL97254.1"
FT                   /translation="MAWLGNFFTGASFSLVMPFMALYVENLGTPTELVEYYAGLAVAVT
FT                   ALASALFAPVWGKLADRYGRKPMMLRASFVMTFTMGGLAIIPNVFWLLILRLLTGVFAG
FT                   YVPNATALIASQAPKEESGYALGTLATGVTAGALIGPLLGGILAELLGIRQVFLLVGVI
FT                   LFLCSLMTAVYVKEEFKPIRRFEMIPTKVILKQVKSPQIMLGLFVTSMIIQISAQSVAP
FT                   ILSLYIRHLGQTHNLMFTSGLVVSAMGFSSLFSSSYLGKLGNRFGNHRLLLAALCYSFI
FT                   MYFSSALAQTSFQLGVLRFAYGFGVGALMPSINSLLTKLTPKEGISRVFAYNQMSSNLG
FT                   QVIGPFIGSNVAVVLGYRSVFYVTSLIVFVNLIWSLIIFRKYIKVKDIV"
FT   gene            445520..445756
FT                   /locus_tag="spyM18_0561"
FT   CDS_pept        445520..445756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0561"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33502.1| (AE006508)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97255"
FT                   /protein_id="AAL97255.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALVLAILSSK"
FT   gene            445850..448183
FT                   /gene="vacB"
FT                   /locus_tag="spyM18_0562"
FT   CDS_pept        445850..448183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="spyM18_0562"
FT                   /product="putative exoribonuclease R"
FT                   /note="best blastp match gb|AAK33503.1| (AE006508) putative
FT                   exoribonuclease R [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97256"
FT                   /protein_id="AAL97256.1"
FT                   /translation="MMKERIMTYLKEHGKSNVNDLAAALEMAGAKHFPSLIKTISKMES
FT                   QSLLRFSDDGSLALRKEREKKKEPTVQGVFRANKAGFGFLHVDENEDDMFIGRNDVGYA
FT                   IDGDTVEVVVKKPADRLKGTAAEAKVVAIVDRSLKTAVGTFILDDDKPKYAGYIRSKNQ
FT                   KIQQKIYIKKEPVVLKGTEIIKVDIDKYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLE
FT                   SMDIVSEFPAEVLAEANAISEAPTATDLIGRVDLRQETTITIDGADAKDLDDAIHIKLL
FT                   DNGNYELGVHIADVSYYVTEGSALDKEAIARGTSVYVTDRVVPMLPERLSNGICSLNPN
FT                   VDRLTQSALMEINSQGHVVNYQICQSVIKTTYRMTYSTVNDMIAGDEEALQEFASIADD
FT                   VTLMVTLHRILEAMRSKRGALNFDTQEAKIIVNDKGMPVDVVLRQRGIAERMIESFMLA
FT                   ANECVAEHFAKAKLPFIYRIHEEPKVEKLQQFIDYASTFGIHIQGTANKISQEALQAFM
FT                   AKVEGQPGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMV
FT                   REYNQPSQEKRDHFAQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGI
FT                   VASVVKFGFFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLV
FT                   KADKETGDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGTKKKEPKEVAKAKTK
FT                   GKTKKGSKKPFYKEQAKKKSRKRS"
FT   gene            448186..448653
FT                   /gene="smpB"
FT                   /locus_tag="spyM18_0563"
FT   CDS_pept        448186..448653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="spyM18_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33504.1| (AE006508)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97257"
FT                   /db_xref="GOA:Q8P244"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P244"
FT                   /protein_id="AAL97257.1"
FT                   /translation="MAKGEGHILAQNKKARLDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLVNVHIAPFEQGNIWNADPERTRKLLLKKREITHLANELKGTGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHDYDKRETIKRRDQERDIKKQMKHYNAR"
FT   gene            448659..449378
FT                   /locus_tag="spyM18_0564"
FT   CDS_pept        448659..449378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0564"
FT                   /product="putative glutamine cyclotransferase"
FT                   /note="best blastp match gb|AAK33505.1| (AE006508) putative
FT                   glutamine cyclotransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97258"
FT                   /protein_id="AAL97258.1"
FT                   /translation="MSIMITKGQVRLLRTYSYDSNLYTQGLEQLNNNHILLSAGRYGFS
FT                   KVGVYDLTQEIFSEKIAFPDTVFAEGLTVVEDYFWLLTYKEGVAYKFDKATCNCLGAYP
FT                   FEGDGWGLAYDKENQCLWMTSGNAFLQKRDPKDFALLDTVLVAIESVPISMLNELEYVD
FT                   GYLYANIWQTNTIVKLQPDSGKVVATYDISPLLKALNLDKSHYPDLNVLNGIAHLDQQR
FT                   FLITGKLYPLMLEVVLD"
FT   gene            complement(449493..450140)
FT                   /gene="pcp"
FT                   /locus_tag="spyM18_0565"
FT   CDS_pept        complement(449493..450140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="spyM18_0565"
FT                   /product="putative pyrrolidone carboxyl peptidase"
FT                   /note="best blastp match sp|Q01328|PCP_STRPY
FT                   PYRROLIDONE-CARBOXYLATE PEPTIDASE (5-OXOPROLYL-PEPTIDASE)
FT                   (PYROGLUTAMYL-PEPTIDASE I) (PGP-I) (PYRASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97259"
FT                   /db_xref="GOA:Q8P243"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P243"
FT                   /protein_id="AAL97259.1"
FT                   /translation="MKILITGFDPFGGEAINPALEAIKKLPATIHGAEIKCIEVPTVFQ
FT                   KSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDARIPDNEGNQPIDTPIRA
FT                   DGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGF
FT                   MHIPFMMEQVVDKPNTAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH"
FT   gene            complement(450190..451116)
FT                   /locus_tag="spyM18_0566"
FT   CDS_pept        complement(450190..451116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33507.1| (AE006508)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97260"
FT                   /protein_id="AAL97260.1"
FT                   /translation="MANIANLVLETIYILIGLQLFHTAYCTFKDKTNPVYFGTALFWGL
FT                   LGVTFVGGAFLPNKVIGFIVIVLALLTLFKQVRIGTLPVFNEQKAEESAHRIGNWIFLP
FT                   VMLMAMISLLLALILPDFSKSAIGIAGILATIAILIITKQKPSALLAENNRMNQQVSTS
FT                   GILPQLLGALGAIFAAAGVGEVIASLIREIVPADSRFFGVLAYVLGMVIFTMIMGNAFA
FT                   AFTVITTGIGVPFVFALGADPIIAGALAMTAGFCGTLLTPMAANFNALPVALMEIKDRN
FT                   AVIKKQAPIALVLIISHIALMYLLAYY"
FT   gene            complement(451116..451799)
FT                   /locus_tag="spyM18_0567"
FT   CDS_pept        complement(451116..451799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33508.1| (AE006508)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97261"
FT                   /protein_id="AAL97261.1"
FT                   /translation="MEWIKLIGIVIIVLGFILKFDAIATVVVAGLVTALVSGISFIDFL
FT                   DILGKEFTNQRLLTIFFITLPLIGLSETYGLKHRATQLIQRVQALTVGRLLTLYLIIRE
FT                   LAGLFSIRLGGHPQFVRPLIQPMGEAAAKANIGEELTDAEKDDIKAMAAANENFGNFFA
FT                   QNTFVGAGGVLLIAGTLEQLGYDGNQAKIAFSSILIAIISIIIVAIYNYLFEKKMERQH
FT                   QKGDN"
FT   gene            complement(452010..452936)
FT                   /locus_tag="spyM18_0568"
FT   CDS_pept        complement(452010..452936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0568"
FT                   /product="putative sugar transferase"
FT                   /note="best blastp match gb|AAK33509.1| (AE006509) putative
FT                   sugar transferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97262"
FT                   /protein_id="AAL97262.1"
FT                   /translation="MTLLSIIVPCFNEEANILPYFEEMHQLETSMTNQLAFEYIFIDDG
FT                   SKDNTLGILRELAARFPNVHYLSFSRHFGKEAGLLAGLKEAKGNYITVMDVDLQDPPEL
FT                   LPVMYAKLKEGYDIVGTRRQNRQGEPLIRSMCSNLFYGLIKHLSDTEMVNGVRDYRLMT
FT                   RQVVDSILELGEVNRFSKGIFSWVGYRITYLSFENQKRKYGKSRWHFWELLRYSLDGFI
FT                   NFSEMPLTIATWTGTFSFLISIFAILFIIIRKILFGDPVSGWASTVSIILFMGGIQLFC
FT                   MGIIGKYISKIFLETKKRPLYIIKEKH"
FT   gene            complement(453081..453458)
FT                   /locus_tag="spyM18_0569"
FT   CDS_pept        complement(453081..453458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0569"
FT                   /product="putative lactoylglutathione lyase"
FT                   /note="best blastp match gb|AAK33510.1| (AE006509) putative
FT                   lactoylglutathione lyase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97263"
FT                   /protein_id="AAL97263.1"
FT                   /translation="MKALHTCIRVKDLDQSVAFYTSAFPFKENYRKDFPDSQFTLVYLA
FT                   LEGESYELELTYNYGHGDYDLGNGYGHIALGSEHFEADHKKHRQAGFPVTDIKELADKS
FT                   ARYYFIQDPDGYKIEVIDLNN"
FT   gene            complement(453469..454134)
FT                   /locus_tag="spyM18_0570"
FT   CDS_pept        complement(453469..454134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0570"
FT                   /product="putative NAD(P)H-flavin oxidoreductase"
FT                   /note="best blastp match gb|AAK33511.1| (AE006509) putative
FT                   NAD(P)H-flavin oxidoreductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97264"
FT                   /protein_id="AAL97264.1"
FT                   /translation="MDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSS
FT                   VGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
FT                   RGIKEGDGLNSRLKLYESFQKEDMDMADNPRALFDWTAKQTYIALGNMMMTAALLGIDT
FT                   CPIEGFHYDKVNHILAKHNVIDLEKEGIASMLSLGYRLRDPKHAQVRKPKEEVISVVK"
FT   gene            complement(454183..455268)
FT                   /gene="pepQ"
FT                   /locus_tag="spyM18_0571"
FT   CDS_pept        complement(454183..455268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="spyM18_0571"
FT                   /product="putative XAA-PRO dipeptidase"
FT                   /note="best blastp match gb|AAK33512.1| (AE006509) putative
FT                   XAA-PRO dipeptidase; X-PRO dipeptidase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97265"
FT                   /protein_id="AAL97265.1"
FT                   /translation="MTKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVNKFHGLQTIFSGQFNNLTPYVQGMRLVKSADEINKMMIAGQFADKAVQVGFDNISLD
FT                   ATETDVIAQIEFEMKKQGIHKMSFDTMVLTGNNAANPHGIPGTNNIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGQPDQFKIDIYNLCLEAQLAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNDLVLEEGMCFSVEPGIYIPGKVGVRIEDCGH
FT                   VTKNGFEVFTHTPKELLYFEG"
FT   gene            complement(455299..456309)
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0572"
FT   CDS_pept        complement(455299..456309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0572"
FT                   /product="putative transposase-IS1239"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97266"
FT                   /protein_id="AAL97266.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGKINSKLDFLSFF"
FT   gene            456528..457529
FT                   /gene="ccpA"
FT                   /locus_tag="spyM18_0573"
FT   CDS_pept        456528..457529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="spyM18_0573"
FT                   /product="catabolite control protein A"
FT                   /note="best blastp match gb|AAK33513.1| (AE006509)
FT                   catabolite control protein A [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97267"
FT                   /protein_id="AAL97267.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPVVLAGTVDLDHQLPSVNI
FT                   DYRAAVSNVVDILAENHKCIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   gene            457660..458658
FT                   /locus_tag="spyM18_0574"
FT   CDS_pept        457660..458658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0574"
FT                   /product="putative sugar transferase"
FT                   /note="best blastp match gb|AAK33514.1| (AE006509) putative
FT                   sugar transferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97268"
FT                   /protein_id="AAL97268.1"
FT                   /translation="MKVLLYLEAENYLRKSGIGRAIKHQAKALSLVGQHFTTNPRKTYD
FT                   LVHLNTYGLKSWLLMIKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPWFKKYLCHFYN
FT                   KADAIITPTLYSKSLIESYGVKSPIFAVSNGIDLEQYGADPKKEAAFRRYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRQMVNGNHPKNLIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYYGWVDQSSAEL
FT                   ATDIPGFIEALKKVFSGASNKVEAGYKVAQSRRLETVGHALVDVYKKVMEL"
FT   gene            458660..459994
FT                   /locus_tag="spyM18_0575"
FT   CDS_pept        458660..459994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0575"
FT                   /product="putative glucosyl transferase"
FT                   /note="best blastp match gb|AAK33515.1| (AE006509) putative
FT                   glucosyl transferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97269"
FT                   /protein_id="AAL97269.1"
FT                   /translation="MRVGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKHYNLDIIHTQTEFSLGLLGKMI
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDITAEEVTNLKAELGIAGDETMLLSLSRISYEKNI
FT                   QAIINQMPAILAENAKIKLIIVGDGPYLQDLKHFAMQLEVDKHVTFTGMVPHDKVALYY
FT                   KACDFFISASTSETQGLTYIESLASGTPIIAHGNPYLDDVVTDKMFGTLYYAETDLTDA
FT                   IIDAILKTPVMDKRLLAKKRYEISAQHFGKSIYTFYLDTLIARNSKEAQKLRLYLNHSG
FT                   KSSSLKLVQGAIHLPKRAAKVTAITSVKVVKAPIKLVHAIKDFLD"
FT   gene            460415..462358
FT                   /locus_tag="spyM18_0576"
FT   CDS_pept        460415..462358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0576"
FT                   /product="putative threonyl-tRNA synthetase 1"
FT                   /note="best blastp match gb|AAK33516.1| (AE006509) putative
FT                   threonyl-tRNA synthetase 1 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97270"
FT                   /db_xref="GOA:Q8P234"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P234"
FT                   /protein_id="AAL97270.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFDIAESISKSLAKKALAGKFNDQLI
FT                   DTTRAIEEDGSIEIVTPDHKDAYEVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNAEGQISNEDLPRIEAEMQKIVTENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRIYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWDHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVRSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIQEEFQR
FT                   ALQLIIDVYADFNLTDYRFRLSYRDPNDTHKYYDNDEMWENAQSMLKAALDEMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEDKSVNVRRYGSKATHTESVEEFVENILA
FT                   DIARKSRPDAQA"
FT   gene            complement(462359..463360)
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0577"
FT   CDS_pept        complement(462359..463360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0577"
FT                   /product="putative transposase-IS1239"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97271"
FT                   /protein_id="AAL97271.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGKPIRTSFCH"
FT   gene            463585..464577
FT                   /locus_tag="spyM18_0579"
FT   CDS_pept        463585..464577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0579"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33517.1| (AE006509) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97272"
FT                   /protein_id="AAL97272.1"
FT                   /translation="MVMIEVSHLQKNFSKTIKEPGLKGALKSFVHPQREIFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINGKIPQDNRQDYVRDIGAVFG
FT                   QRTQLWWDLALQETYVVLKEIYDVPEKAFRKRMDFLNEVLDLNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQSFGKMKSLSFELKPGQEQVVSQFMGLPDITVERHE
FT                   LSLDIQYDSSRYQTADIIQKTMADFAVRDLKMTDVDIEDIVRRFYRKEL"
FT   gene            464579..465397
FT                   /locus_tag="spyM18_0580"
FT   CDS_pept        464579..465397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33518.1| (AE006509)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97273"
FT                   /protein_id="AAL97273.1"
FT                   /translation="MWSFWKRYRPFLSAGIQELITYRVNFFLYRIGDVMGAFVAYYLWK
FT                   AVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTKSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGFRWIVLMSVGFPFLMVLSGIKVMAGLSILQVLASSCLYLVSLLLAFLI
FT                   NFYFNICFGFSAFVFKNLWGSNLLKNALVTFMSGSLIPLAFFPKMVSIVLSFLPFSSLV
FT                   YTPVMIVIGKYSLSQIMVALSLQIFWLLVMVVLSQVIWKKVQYHLTIQGG"
FT   gene            465399..466184
FT                   /locus_tag="spyM18_0582"
FT   CDS_pept        465399..466184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33519.1| (AE006509)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97274"
FT                   /protein_id="AAL97274.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVTPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFIIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLVLSLKLWKWGLGAYESAGS"
FT   gene            complement(466288..467277)
FT                   /locus_tag="spyM18_0583"
FT   CDS_pept        complement(466288..467277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0583"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="best blastp match gb|AAK04344.1|AE006262_3
FT                   (AE006262) dihydroxyacetone kinase (EC 2.7.1.2)
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97275"
FT                   /protein_id="AAL97275.1"
FT                   /translation="MVTILNQTQTLISQYIASVLAAHPHLVQLQDLPIIYNRHLDDQLI
FT                   PILSGGGSGHEPAHSGFVGDGMLSAAIYGDIFTPPTATDILEALRFLDKGKGVFVIIKN
FT                   FEADIREFSQAIHLARQEGRNIKYIISHDDISVEPKKQFQMRHRGLAGTILLHKILGAA
FT                   AQSGASLDDLEHLAFDLATEIATIGFATKSASLPNAALPLFDLPDHQISYGIGIHGEEG
FT                   YRTVPFMSSEHLAVEIVNKLQIKFHWQEDEHFILLVNNLGTATDLEQGIFLNDIHQLLD
FT                   LEGLHLPFIKNGKFMTSLDMTGISVTLCRLKDRQWLDYLQAPTNAYAW"
FT   gene            complement(467292..467828)
FT                   /locus_tag="spyM18_0584"
FT   CDS_pept        complement(467292..467828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match dbj|BAB07113.1| (AP001518) BH3394;
FT                   unknown [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97276"
FT                   /protein_id="AAL97276.1"
FT                   /translation="MATSLITKKKIAKAFKKQLAVKSFEKISVVDIMDQAQIRRQTFYN
FT                   HFLDKYELLDWIFETELQEQVTHNLNYISGSQLLDELLFYFERNKTFYAQLFDIKGQND
FT                   FYSYFVDYCQVLMAKIISEYQSQEMSQSDDADYLAFLTHYHARALADMIKGYVSQSEPK
FT                   PCLTYLKQLILTSIH"
FT   gene            467980..468969
FT                   /locus_tag="spyM18_0585"
FT   CDS_pept        467980..468969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0585"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="best blastp match gb|AAK04346.1|AE006262_5
FT                   (AE006262) dihydroxyacetone kinase (EC 2.7.1.2)
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97277"
FT                   /protein_id="AAL97277.1"
FT                   /translation="MKKIMNDATQIVDDMLQGLAYMHDDLVERLDGYNVIVRKAEKTGK
FT                   VALVSGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQILEAIKAADEGAGVFMVIK
FT                   NYSGDIMNFEMAQELAEMEGIDVASVVVDDDIAVENSLYTQGRRGVAGTILVHKILGHA
FT                   AREGKSLADIKALADELVLNIKTIGLALSGATVPEVGKPGFVLEDDEFEYGVGIHGEPG
FT                   YKKEKLQSSSVLAQELVTKLADSFDMSAGQHYGVLVNGLGATPLMEQYVFANDVAKLLA
FT                   EKDVTVSFKKIGDYMTSIDMAGLSLTLIKLDKDEWTEALQSDVITPAW"
FT   gene            468980..469555
FT                   /locus_tag="spyM18_0586"
FT   CDS_pept        468980..469555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0586"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="best blastp match gb|AAK04347.1|AE006262_6
FT                   (AE006262) dihydroxyacetone kinase (EC 2.7.1.2)
FT                   [Lactococcus lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97278"
FT                   /protein_id="AAL97278.1"
FT                   /translation="MQAQDAIKWMTLFNDKIQVNKDYLSQFDTPIGDGDHGGNMARGMS
FT                   AVMENLAGKEFASAADVFKVVAMQLLGKVGGASGPLYGSAFMGLSKASEDSSLADALQA
FT                   GLDMIQKRGKAEKGEKTMVDVWIPVIEALKNDGLTKDVVEEAVLATKDIQATKGRASYV
FT                   GERSVGHIDPGSFSSGLLFEAMLEAEVV"
FT   gene            469555..469929
FT                   /locus_tag="spyM18_0587"
FT   CDS_pept        469555..469929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK04348.1|AE006262_7
FT                   (AE006262) hypothetical protein [Lactococcus lactis subsp.
FT                   lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97279"
FT                   /protein_id="AAL97279.1"
FT                   /translation="MSDLGIIIVSHSKNIAQGVVDLISEVATDVAITYVGGTEDGGIGT
FT                   SFDQVQAIVDANPKDDLLAFFDLGSARMNIEMVSDFSDKTITLNVVPIVEGAYTAAALI
FT                   QAGADKDAILSQLEELAINK"
FT   gene            469943..470653
FT                   /locus_tag="spyM18_0588"
FT   CDS_pept        469943..470653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0588"
FT                   /product="putative glycerol uptake facilitator"
FT                   /note="best blastp match gb|AAK05342.1|AE006356_8
FT                   (AE006356) glycerol uptake facilitator [Lactococcus lactis
FT                   subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97280"
FT                   /protein_id="AAL97280.1"
FT                   /translation="MNFIGELLGTFILVLLGDGVVSACILNKTKAQNSGWIAIVLGWGI
FT                   AVTVAVYISGFMSGAHLNPAVTLAMAAIGSLPWSQVVTYLVAQFLGAMLGALVLYLHYY
FT                   PHWNETKDAGTILACFSTGPAIRHTWSNLFGEALGTAVLVITVMAIGPNKVAAGFGPII
FT                   VGFVVMAVGFSLGATTGYAINPARDLGPRIMHALLPIPNKGDSDWSYAWIPVLGPILGG
FT                   VAGALIYQAILNMM"
FT   gene            470788..471357
FT                   /locus_tag="spyM18_0589"
FT   CDS_pept        470788..471357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0589"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97281"
FT                   /protein_id="AAL97281.1"
FT                   /translation="MRRLLSTMIKCNQDLPKNSLVVDMTLEKAAQLYENQVLTDTQRFR
FT                   KIRLSESGLTLEVRFLKKQPVQWLSESTNSNQLKAKTNKFLINDDQTINISQAALAHFL
FT                   EDTGDQKPIHREAPYVLPGAFLLEQVSDRLTIDYRRLHLRFYAPVVLDSPIQLMVKGRA
FT                   IGLFQTGKLVAKGDYDHDGCLYCCRP"
FT   gene            471326..472474
FT                   /locus_tag="spyM18_0590"
FT   CDS_pept        471326..472474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0590"
FT                   /product="putative acetyl-CoA c-acetyltransferase"
FT                   /note="best blastp match gb|AAK33520.1| (AE006510) putative
FT                   acetyl-CoA c-acetyltransferase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97282"
FT                   /protein_id="AAL97282.1"
FT                   /translation="MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPI
FT                   DQVICGNTVGTGGNIGRLMTLYSHLGESVSALTVDMQCASAGVALSVGYAKIKAGMASN
FT                   LLVGGIESSSLQPESVYASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREYGFTKEY
FT                   LNHWTLRSHQKASYCQEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHVIS
FT                   AANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLAKHGLGMAD
FT                   MTAIEWNEAFAVIDGLFETHYPDLLDRCNIFGGALAYGHPYGASAAIIILHLMRALEIK
FT                   NGRYGIAAIAAAGGQGFAVLLKYHKEFSHADKARILGKAMPK"
FT   gene            472431..473678
FT                   /locus_tag="spyM18_0592"
FT   CDS_pept        472431..473678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0592"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33521.1| (AE006510)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97283"
FT                   /protein_id="AAL97283.1"
FT                   /translation="MLTKLEYWAKQCPNKKAIVADQISLTYQELWQAVLIKDQTIKDSV
FT                   PYIISHSRYLNQLLSFLRGLKEGSCPIILHPNISGTFQQQIKHVDSELLKKADFAVLSS
FT                   GTTGKAKLFWRCLSTWTRLFDYQNKVFGMTGNSCLFLHGSFSFTGNLNLALAQLWAGGC
FT                   LVLSQKLSLKTWLNLWQAKKVSHLYLLPTYLNRLLPYLTKNNMTATHLLTSSQMISQEL
FT                   LRHYYKKFPQLEIVIFYGASELSFITWCNGRAAVKINGLVGQPFPDVSISFKDKEIFVE
FT                   TPYSVEGMSQPYSVSDLGKMSPAGLILEGRQDDWVNQRGVKCHLPSLVELAHQAPNVKE
FT                   AHALKIGKGENETLILVLVLTKKDCLAPIKDFLALYLNSGQLPKYYLVIDCLPLKDNGK
FT                   INREVLLNKIPKQWLS"
FT   gene            473773..474768
FT                   /locus_tag="spyM18_0593"
FT   CDS_pept        473773..474768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0593"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33522.1| (AE006510)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97284"
FT                   /protein_id="AAL97284.1"
FT                   /translation="MKQAILDRYQALKCYQNAGLSNQAFRAIAKEPIIDNRLGSPTFWV
FT                   IWPIEKENQSAKQLLTFLLDLVEMPFELSGQLHETQTLLTRFHPSLLPDHMFWKELASL
FT                   VDQAFPGKTLSQAGELEKRLHQFRYVISSQQAQSIRNHYKMIEMTDAQALALFLRSKKG
FT                   PCLWRQAPDYTLMDSARLHNKLRFEDNKVIFPSQEVSYNIKVLLWFHTEFILDSTGFFL
FT                   NEVDAEVVTEKGIVNGASFNYGTDGPRHWDLDVDPINRHDPQFRRDTLKGFRSPKRVFR
FT                   QWFRAQKDDFMFSYFNAKGLFAYHNKSSFARVKKSAKQFKRQIHPIKGWF"
FT   gene            474930..475640
FT                   /gene="vicR"
FT                   /locus_tag="spyM18_0594"
FT   CDS_pept        474930..475640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="spyM18_0594"
FT                   /product="two-component response regulator"
FT                   /note="best blastp match gb|AAK33523.1| (AE006510)
FT                   two-component response regulator [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97285"
FT                   /protein_id="AAL97285.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVELTH
FT                   REFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   gene            475633..476985
FT                   /gene="vicK"
FT                   /locus_tag="spyM18_0595"
FT   CDS_pept        475633..476985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="spyM18_0595"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="best blastp match gb|AAK33524.1| (AE006510)
FT                   two-component sensor histidine kinase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97286"
FT                   /protein_id="AAL97286.1"
FT                   /translation="MTRDIIGNLSTFELAILILLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINDRYTDIIDEKADIELMELSDQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLSKEEALKKNITDLLEGDTSYTYRDLVSKTPVVTV
FT                   NSRNDMGEFVSLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLAVE
FT                   MTNFTAFITSILNRFDLVKNQHTGTGKVYEIVRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKTDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEEDVD"
FT   gene            476989..477798
FT                   /gene="vicX"
FT                   /locus_tag="spyM18_0596"
FT   CDS_pept        476989..477798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="spyM18_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33525.1| (AE006510)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97287"
FT                   /protein_id="AAL97287.1"
FT                   /translation="MNESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDIYANEKTWQLMDECNMLGKLDASQ
FT                   KHIFQRDKVLTFGDVDIESFGVSHDAIDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDLGHLSNEDGAGAMIRSLGYNTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   gene            478241..478933
FT                   /gene="rnc"
FT                   /locus_tag="spyM18_0597"
FT   CDS_pept        478241..478933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="spyM18_0597"
FT                   /product="putative ribonuclease III"
FT                   /note="best blastp match gb|AAK33526.1| (AE006510) putative
FT                   ribonuclease III [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97288"
FT                   /db_xref="GOA:P66672"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66672"
FT                   /protein_id="AAL97288.1"
FT                   /translation="MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDAYIKLGK
FT                   GEEKSGGRRRDTILGDLFEAFLGALLLDKGIDAVRRFLKQVMIPQVEKGNFERVKDYKT
FT                   CLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLSKGLGKSKKLAEQDAAKN
FT                   ALAQLSEV"
FT   gene            478934..482473
FT                   /gene="smc"
FT                   /locus_tag="spyM18_0598"
FT   CDS_pept        478934..482473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="spyM18_0598"
FT                   /product="putative chromosome segregation SMC"
FT                   /note="best blastp match gb|AAK33527.1| (AE006510) putative
FT                   chromosome segregation SMC protein [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97289"
FT                   /protein_id="AAL97289.1"
FT                   /translation="MFLKEIELEGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKNLRGGKMPDVIFAGTQNRNPLNYAKVAVVLDNSDHFIKTAKKEIRVERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQIKLNQTQDNLDRLEDIIYELDTQLAPLEKQAKVAKQFLELDANR
FT                   KQLQLDILVKDIDIAQERQTKDTEALAALQQDLASYYAKRQSMEEDYQKFKQKKQVLSQ
FT                   ESDQTQTTLLELTKLIADLEKQIELVKLESGQEAEKKAEAKKHLEQLQEQLDGFQAEEK
FT                   QRTEQLLHIDQQLCDVKQQLNELSNALERFSSDPDQLMETLREEFVLLMQKEAALSNQL
FT                   TALKAHLDKEKQARQHKAQEYQLLVTKLDQLNDESQKAQAHYKAQKEQVEMLLQNYQKG
FT                   DKRVQELERDYQLNQERLFDLLDQKKGKEARKASLESIQKSHSQFYAGVRAVLQSQKKL
FT                   GGIIGAVSEHLSFDSDYQTALEVALGANSQHIIVTDEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSEHYHRQLATCEGYLGTAESLVRYDDSLSAIIQNLLSSTAIFETIDQANI
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQSNTTFIKPELEQISEELTRLVEQLKIT
FT                   EKEVAALQSDLIAKKEELTQLKLAGDQARLAEQRAQMAYQQLQEKQEDSKTLLAALDQS
FT                   QTTHSDESLLAEQARIEEALTAIAKKKNVLTCDIDDIKENKDLIRQKTQNIHQALSQAR
FT                   LQERDLLNEKKFEQANQSRLRTQLKQCQQNILKLESILNNNVSQDSIQRLPQWQKQLQD
FT                   ATEHKSGAQKRLVQLRFEIEDYEARLEETAEKITKESEKNDTFIRRQTKLETHLEQVAN
FT                   RLRAYAKSLSEDFQMTLVDAKEVTNSIDHLESAKEKLHHLQKTIRALGPINSDAITQYE
FT                   EVHERLTFLTSQKTDLTKAKNLLLETINSMDSEVKARFKVTFEAIQKSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGIEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDFLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKI
FT                   VSVKLKEAQEMTN"
FT   gene            complement(482726..483577)
FT                   /locus_tag="spyM18_0599"
FT   CDS_pept        complement(482726..483577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0599"
FT                   /product="putative positive regulator"
FT                   /note="best blastp match gb|AAK33528.1| (AE006511) putative
FT                   positive regulator [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97290"
FT                   /protein_id="AAL97290.1"
FT                   /translation="MKSKLGVTLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISC
FT                   IRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSD
FT                   YTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINY
FT                   NSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLD
FT                   NELNFYEQTVFLYATGYFEFKRQLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVN
FT                   KD"
FT   gene            483798..484724
FT                   /gene="aroD"
FT                   /locus_tag="spyM18_0600"
FT   CDS_pept        483798..484724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="spyM18_0600"
FT                   /product="putative shikimate 5-dehydrogenase"
FT                   /note="best blastp match gb|AAK33529.1| (AE006511) putative
FT                   shikimate 5-dehydrogenase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97291"
FT                   /protein_id="AAL97291.1"
FT                   /translation="MLVLYVSSKLIKRRRMKFMYSALLGNPVEHSISDELFEYLNHNIG
FT                   VLDEYKHKKILVDSVCLEDKIKHLINDPKCIGLNITLPYKREVMRYIDNLDRVAEITGS
FT                   VNNIYKSGNIITGTNTDWKGIYNTLVFFNISHITKCCVLGTGGTARAAIFTLQKLQISP
FT                   TVVYREPISENTRSLIKSFPDLKYITYKELADQQILNDIEIIINTTPVGMINYEESLPI
FT                   NFDHLDNVNYKDKYFMDVVFNPLHTKLHEYFGKKGAKIIDGLWVLIFQGIEAFSLWSDK
FT                   INDGKYFFSKDDVVLIHTFLEGKIKGK"
FT   gene            484721..485557
FT                   /locus_tag="spyM18_0601"
FT   CDS_pept        484721..485557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0601"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33530.1| (AE006511)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97292"
FT                   /protein_id="AAL97292.1"
FT                   /translation="MTFHITVNLDEISDKLDDSLKFLNRLSIKSCELRMINTKNIIQLS
FT                   DAELINLKERLQKYNITPISIASPLFKWNIEENHLESNLDLYGISANVTLNEQWLYVRK
FT                   IIFIAKFLNIKYVRIFGGIGCSVDDFLNNELFLNLLKETEIIFLIENELGTSVSTADDL
FT                   LKIGHFIDEKSIKNLKIWFDIANYYIVEPQVDKVIPKLKKYIYYIHCKNYVNNDLGIHY
FT                   VELGKGIIDYKTIIHEIHEHFIDLIFSLEVHEKEIDKKAEVVRKSYLTLNEYINGG"
FT   gene            485559..486293
FT                   /locus_tag="spyM18_0602"
FT   CDS_pept        485559..486293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33531.1| (AE006511)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97293"
FT                   /protein_id="AAL97293.1"
FT                   /translation="MNLSIFGLKNIPYLKEGDSIEKFIEESIKTSEFFIEDNDVLCIAS
FT                   KVVSVAEGQVMSLNEIQVSDVAKEIHRNIPRKDPRIIEIMLNLVNRDLSRLDIKKNYIG
FT                   CRLENGLKLTSGGIDRKSVDEVFLLPNNPDASAKRISEYLKKSLGKNVAVVITDSDGRE
FT                   DKRGATQVAIGIYGIHPLRKTEVIDSQGETIKFQEETLCDMIAACAGLVMGQRGTGIPA
FT                   VLIKGLDYKWSENTSIKEALNE"
FT   gene            486286..487272
FT                   /locus_tag="spyM18_0603"
FT   CDS_pept        486286..487272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0603"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33532.1| (AE006511)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97294"
FT                   /protein_id="AAL97294.1"
FT                   /translation="MSRNQDCKNILIIGFGKIGKIKAYKWLSRGYEVYVKDLKFSSMKY
FT                   LNTNSDVLDDLSRQYFTIEICTPTNHHLTLLKTVITRYVYSYISIEKPLCNRLEDLEEM
FT                   KSLVESHPHLAKKIFASEQYFFSKILEKLLQVDCFSLDKIKEITVDFSKDRIEDNENGR
FT                   FLDKEILGYGIEIPHIIAVISYLGISLEEFKKGIFVNAIYIKDLEKHDYSIEILSCINQ
FT                   TVIKIISNLGSFAIREGKIEGGDAKTVRRVTIDDKTILFDPHPKLERYKSELVTGTNTF
FT                   QIHDDMMDTYISLLEGNAIPEDCYINNAIEITKLLINLYSECEKIYL"
FT   gene            487282..488481
FT                   /locus_tag="spyM18_0604"
FT   CDS_pept        487282..488481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0604"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /note="best blastp match gb|AAK33533.1| (AE006511) putative
FT                   S-adenosylmethionine synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97295"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66770"
FT                   /protein_id="AAL97295.1"
FT                   /translation="MDLKITNGFYDPSHLSYEVVERKGLGHPDTLADGIAEQIEIDYSL
FT                   YCLDKFGVIPHHNFDKIIIRGGHSVQDFGGSDFIEPIKIIFLGRASKKCFNSSIPLFKI
FT                   QKKAATKYLNRILPNLDVENYVEFETLTSDFTTKTNWFSPEAIEDLPEYLDVPKANDTA
FT                   TMISYWPLTISEELALMIEGYFYKLDKNELPTPRFTKMGGDIKVMVVRNDLEYSIRINF
FT                   PLISKFFNNDIESQLYVDKHVEKIKKYIEQKYKNISFSIDYHYYLTTTGSCIDFGEEGA
FT                   VGRGNKTHGIISSFRPNTMEAPAGKNCTYFVGKVWGFLSDTIAKEIYEAFNTPCQIIMQ
FT                   LNIGSKLYRPTHLFIQTEESVDQERVLEIVNRHLNNGKQNTNLILSTQHFIPKTNVYDG
FT                   "
FT   gene            488474..489433
FT                   /locus_tag="spyM18_0605"
FT   CDS_pept        488474..489433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0605"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33534.1| (AE006511)
FT                   hypothetical gene [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97296"
FT                   /protein_id="AAL97296.1"
FT                   /translation="MDKTVLYFGLVEISFDVPDFIFQKIKEQNNKIRYYSKSINILGSV
FT                   KFINSNQQFIEYDGNGNILVYGRLKYFKEGISLYYIGEYLAECLLIEHSDTLLIHAAAV
FT                   YNPLSGHSILLLGDKGAGKTTVAMRLCIEHGYHLIGNDQVIFGSNSGILLTYAGTSFFK
FT                   IRRTAVLSDNLLFKLFSKFFNRSLQFNKASWDDKISIFPKELGIRTCNFSTEISKIYYI
FT                   KTDKKEKQIYHSIWSDSLASLYLNELLGRHISGQVACFQSDNGKYFSTMPLINYEKNNR
FT                   VREQIVKGIFVKQKLFKITAATPAKIAEAIIENVKKNS"
FT   gene            489488..490477
FT                   /locus_tag="spyM18_0606"
FT   CDS_pept        489488..490477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33535.1| (AE006511)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97297"
FT                   /protein_id="AAL97297.1"
FT                   /translation="MFVIGIPTLNEADNISRLVKQIDEYAVNLGKEIIIINSDSKSTDG
FT                   TPQIFLETKTYNTKVSIVSEAKGKGYNVRNIFEYAINHVPNFSGLILIDGDVVSMKKMW
FT                   LEKMFIAIESGNDLIIPNYARKSFEGNATNHFIYPMLVKFFKRDMPYQCISGDFGFSRG
FT                   LIKDLTLKCNWHKYTLGYGIDIFLTLTAILKSYKIKEIDLQSKIHKKSFEKIEKIFLEV
FT                   SQSFFETINDNSLNQDKLRLNINFESHSRQFIKSSDILSSNDIENLKLRALFLLQEEKQ
FT                   YPHGLSEVEWDGILSNTINNIYRYSSEEHSLYLLPLYLLRVYNYLKYN"
FT   gene            490880..491032
FT                   /locus_tag="spyM18_0607"
FT   CDS_pept        490880..491032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0607"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97298"
FT                   /protein_id="AAL97298.1"
FT                   /translation="MIYYRPGFIFNEFYPNISGWRQELKTKLTSISLISLNFIGVVDEQ
FT                   KRGNI"
FT   gene            491169..492326
FT                   /locus_tag="spyM18_0608"
FT   CDS_pept        491169..492326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0608"
FT                   /product="putative nucleotide sugar dehydrogenase"
FT                   /note="best blastp match gb|AAK33536.1| (AE006511) putative
FT                   nucleotide sugar dehydrogenase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97299"
FT                   /protein_id="AAL97299.1"
FT                   /translation="MKITVVGIGYVGLSIGLLLAKEHDVTFFDIDNKKIDLINKRQSPL
FT                   KEAAINKLLCKAKNINATSSEELAYKDATFIILSLPTNLKVNKLDTSIIEISVSNILKI
FT                   NKKATIVIKSTVPIGFTEYLRNRFHYNDIIFSPEFLREGSTIHDQLYPSRTIVGNESRN
FT                   SQLFLDILTDISVEKDSPSLLVGSSETEAIKLFSNAYLAQKIAFFNELDTFAEMQNLDS
FT                   KKIIEAMGYDQRIGNSHNNPSFGFGGYCLPKDIKQLEYHFKEIPAPIITSISESNLLRK
FT                   IHIAKMILNSSAKTIGIYRINSKKDSDNCRESSTIDVVKLLKSSGKDVIIFEPLINQKK
FT                   FLGCPLINDFNEFIKYSDIIVANRIDDALRKCNSKVFTRDIFQYD"
FT   gene            492411..493619
FT                   /locus_tag="spyM18_0609"
FT   CDS_pept        492411..493619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0609"
FT                   /product="putative efflux protein"
FT                   /note="best blastp match gb|AAK33537.1| (AE006511) putative
FT                   efflux protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97300"
FT                   /protein_id="AAL97300.1"
FT                   /translation="MNNMKKNIQYLVCSKVIYRIGDAMFDFANNTFLAGLNPGSLSLVA
FT                   VYQSLESVIGVLFNLFGGVIADSFKRKKIIITTNILCGTACLVLSFLTKEQWLVYAIVL
FT                   TNVILAFMSAFSSPSYKAFTKEIVKKDSISQLNSLLETTSTVIKVTVPMVAIFLYKLLG
FT                   IHGVLLLDGLSFLIAALLISFILPVNDEVVIKEKVTIREIFNDLKIGCKYVYSHKSIFI
FT                   ITVLSALVNFFLAAYNLLLPYSNQMFGEISTGLYGTFLTAEAIGGFIGAILSGFVNKEL
FT                   SSMRLILFLSLSGLMLMLAPPFYIMFHNAIILALSPALFSLFLSIFNIQFFSLVQKDVD
FT                   NDFLGRVFGIIFTITILFMPIGTGFFSVALNPNNSFNLFIIGSCITILSLVFRILFKKY
FT                   NIR"
FT   gene            complement(493721..493930)
FT                   /locus_tag="spyM18_0610"
FT   CDS_pept        complement(493721..493930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33538.1| (AE006512)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97301"
FT                   /protein_id="AAL97301.1"
FT                   /translation="MRFSYNKLWKLLIDKGWTKTKLRQEAGISSSTIAKLGKGENITTD
FT                   ILLKICIALDCKIEDIVEIVDNNI"
FT   gene            complement(493920..494765)
FT                   /locus_tag="spyM18_0611"
FT   CDS_pept        complement(493920..494765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0611"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33539.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97302"
FT                   /protein_id="AAL97302.1"
FT                   /translation="MDISIEFGLYPTESDLTELQQYFPDTNLKKLYEVEAYHKKLETIL
FT                   DSEFSTERESLIAEIDELESQLTTLNQELQELGNIPNLSSEYLEKYSKLTATINALKEQ
FT                   NEAYLKESGLSKEKSEAGADLKRSTEDILLDLEVKINSKMREVNNILYPDIRKAPQINL
FT                   NAHNSYSFYTPDDDGTGTKFKGMIVFDLVMLYLTNLPALAHDSLLLSNVSYQTTEALLK
FT                   LYDQSRSLNKQVFLAFDKASSYSPDANQLLSENTVLRLSSNGNELYGISWNKGENSDEI
FT                   "
FT   gene            complement(494850..495578)
FT                   /locus_tag="spyM18_0612"
FT   CDS_pept        complement(494850..495578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0612"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33540.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97303"
FT                   /protein_id="AAL97303.1"
FT                   /translation="MLIEMWSPVFKKHGEIREPICFHHGLNVIMGMDLADNSIGKSSSL
FT                   LAIDFIFGGNSYLKSIAVKKLGDHPIYFCFQFEKKFYFSRDTANPDIILVCDKSYSPTG
FT                   ETMDLGIFLNKLKKRYHLDSPELSFRLAMSGFFRIAGKSNQNTDFPLQVYSSQKSSESI
FT                   TTLIQLFNLYDNIARYKERLKDKSDQLTTFRNARKYTFISNLVGGKKQFEANVSEIKRL
FT                   EYDLAHLQDTQQDKIDSDDI"
FT   gene            complement(495569..495793)
FT                   /locus_tag="spyM18_0613"
FT   CDS_pept        complement(495569..495793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0613"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33541.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97304"
FT                   /protein_id="AAL97304.1"
FT                   /translation="MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHAISEELDD
FT                   PTDFLSIMDCLYALNAIEMSNEGEVKLCL"
FT   gene            complement(495793..496887)
FT                   /locus_tag="spyM18_0615"
FT   CDS_pept        complement(495793..496887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0615"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33542.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97305"
FT                   /protein_id="AAL97305.1"
FT                   /translation="MIQLKTQYPSLIIDASFITLAANATVKPQDKTYNTVNILNRFFLI
FT                   WLDVACRGLSHHHVLSHPFKDWMTNMLDFPYHHEFIEFLGRWTHILITLPKRHHGQVDT
FT                   AIPRYLLVTIREKTGIVKLTTVQNTAFTTQSNQLKKQYGQFLLTESNNCCVCPGCDRPL
FT                   ILTSGNLAAENYEVSAIEKDKDAEALNLIVLCPDCFLTYQADSRKKIVTALKNVKKILV
FT                   SAHNSQQAISDMKLDSGIVSVLTSLNKLKCDEYDISYDSKQLTDKISPENNRTLYQLVK
FT                   NPVIDNYLTIQKIIVNLDKQGKIDYEEIQYQTRSMYKKLKAAKHNNLAIFNTISEKLHK
FT                   ATLQDIYFCQMIVSYFIQKCEVLE"
FT   gene            496933..497235
FT                   /locus_tag="spyM18_0616"
FT   CDS_pept        496933..497235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0616"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33543.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97306"
FT                   /protein_id="AAL97306.1"
FT                   /translation="MAKTGTLNLRVDDSVKSAADDILKRLGIPMSTAIDMFLNQIILTG
FT                   GIPFDVSLPEAPQRVNVDYMSQEKFYDKLITSFEDAKTGNRQDVREFLSQLKENA"
FT   gene            497235..497540
FT                   /locus_tag="spyM18_0617"
FT   CDS_pept        497235..497540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0617"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33544.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97307"
FT                   /protein_id="AAL97307.1"
FT                   /translation="MKEYQVIMSDDAKADLLSIYHYVRDELCAPQAADNLLERLSQAML
FT                   SLSIFPERCAIIEDLIGKGYTFRQLIVKKYRIVYHVLEDEVIIVAVVYGSRHMNNW"
FT   gene            497673..497831
FT                   /locus_tag="spyM18_0618"
FT   CDS_pept        497673..497831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0618"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33545.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97308"
FT                   /protein_id="AAL97308.1"
FT                   /translation="MVLSPSDSKLSTDHQSLSSDEQMTTVVEQARLDEIATSVLSRHLD
FT                   AFKELTE"
FT   gene            497936..498388
FT                   /locus_tag="spyM18_0620"
FT   CDS_pept        497936..498388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0620"
FT                   /product="putative phage portal protein"
FT                   /note="best blastp match gb|AAK33546.1| (AE006512) putative
FT                   portal protein - phage associated [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97309"
FT                   /protein_id="AAL97309.1"
FT                   /translation="MGLLDLIGRKRARDKPQNSYEGQDFFYLFGRTTSGENVDEFKAMQ
FT                   TTAVYACVRILAEAVASLPIHIYERTENGKEKKLDHPLYFLLHDEPNPEMSSFIFRETI
FT                   MSHLLIWGNAYVQIIRDKSGMVSLLLKQKASVLIRKLLLIIWQRMP"
FT   gene            498430..498762
FT                   /locus_tag="spyM18_0621"
FT   CDS_pept        498430..498762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0621"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33547.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97310"
FT                   /protein_id="AAL97310.1"
FT                   /translation="MTVSSSAWMTRLISQQILSEYVKSLEVEADKVVIPGQNTPVFSWD
FT                   RDGNLSIDTPLLKVRGESLATQADLTTISLTPGPKGELWQTSVERLDIKVDKHISLTFK
FT                   NGVRID"
FT   gene            499167..499505
FT                   /locus_tag="spyM18_0622"
FT   CDS_pept        499167..499505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0622"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33548.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97311"
FT                   /protein_id="AAL97311.1"
FT                   /translation="MKSPFTVTNTMLNKVVEISKIIGNLELQVQKDLKLRKENRIQSIH
FT                   SSLAIEQNSLTVEQITAIIDGKRVLGNPREIREVKNAYEAYEEILTLTPYDESHFLKMK
FT                   EFQQYIYR"
FT   gene            499529..500206
FT                   /locus_tag="spyM18_0624"
FT   CDS_pept        499529..500206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0624"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33549.1| (AE006512)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97312"
FT                   /protein_id="AAL97312.1"
FT                   /translation="MGLGSNSLPVKISLFDVDTYLADSMQFHLEYILRLFPKSGVHYLM
FT                   PTFRGEAVDHRHLSQFYHSECEMEGDLHYVMNLVDRYIKFLVSEILRECRDSIFAITKD
FT                   VSHLESFIDRKIPIITFEEACTISENEIDSLEYNDEHHFYVLTDVGEKKLMEHFEGVVW
FT                   VKNYPCKSVPFYQRFSTDYLFAYNADLLLGIGETVGCGERCETYEEVVENMNYLQVDAS
FT                   EYS"
FT   misc_feature    500216..500353
FT                   /note="spyM18_0625; probable gene fragment; best blastp
FT                   match gb|AAK33549.1| (AE006512) hypothetical protein
FT                   [Streptococcus pyogenes M1 GAS]"
FT   gene            500331..500942
FT                   /locus_tag="spyM18_0626"
FT   CDS_pept        500331..500942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0626"
FT                   /product="N-terminal fragment of SPy0560"
FT                   /note="best blastp match gb|AAK33550.1| (AE006512)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97313"
FT                   /protein_id="AAL97313.1"
FT                   /translation="MGLIIYHKGGRKMKKNILIVGGGPEITICYDLINNSTEYNFFSVS
FT                   EIPTMYPELFVETIETSFRNFGKTIEQIKELKYSIDAVACWDEALTHIADDISKELGLN
FT                   PISSLDSQSFRFKDRMRMVCEAGGLKMPKYKIINQFSDTNKIINWKYPLIVKPTSFLAS
FT                   IGVKKVYNFSELQQAVSQMLNVKFPVYIASGVYELGNYII"
FT   misc_feature    501046..501264
FT                   /note="spyM18_0628; probable gene fragment; best blastp
FT                   match gb|AAK33550.1| (AE006512) conserved hypothetical
FT                   protein [Streptococcus pyogenes M1 GAS]"
FT   misc_feature    501249..501611
FT                   /note="spyM18_0629; probable gene fragment; best blastp
FT                   match gb|AAK33550.1| (AE006512) conserved hypothetical
FT                   protein [Streptococcus pyogenes M1 GAS]"
FT   gene            501536..502555
FT                   /locus_tag="spyM18_0630"
FT   CDS_pept        501536..502555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0630"
FT                   /product="putative immunity protein"
FT                   /note="best blastp match pir||H82459 microcin immunity
FT                   protein MccF VCA0439 [imported] - Vibrio cholerae (group O1
FT                   strain N16961)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97314"
FT                   /protein_id="AAL97314.1"
FT                   /translation="MFGKQGIRCARKGDERNIKIIVNRVNSERNIKSIGICSPSYPGTF
FT                   HYQKRYKRGVEFLQNKGFTIVEGNLTGKEGYRGEISGGVQDRAEELNQLIPRVDVIMTS
FT                   IGGYNSNSILKYIDYDLFKQKSPIFIGYSDTTALALALYNKTGCITYLSQSVISNFGEF
FT                   EPFNELNYFYFDFMLQSKCETLMVQIPDVWTDEWINWETYERTKKTNKNEWIIFNKGEF
FT                   NGTLIGGNLDTIVGIIGTEYMPKITEDTILLLEDVYTDLGRLYRNFTTLALHGIFDKIG
FT                   GLIISKFETIGENSDVINDIINEFVGHRKIPILLNFDCGHTHPSCLMPIGGKITLSLS"
FT   gene            502568..502768
FT                   /locus_tag="spyM18_0631"
FT   CDS_pept        502568..502768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0631"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97315"
FT                   /protein_id="AAL97315.1"
FT                   /translation="MNNRESKLTGFYDVFEEEVEKINHIHNVFVEESEKFGFQQMKIAM
FT                   VEHRKKYLDATDVHYTKYKNI"
FT   gene            502888..503373
FT                   /locus_tag="spyM18_0632"
FT   CDS_pept        502888..503373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0632"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97316"
FT                   /protein_id="AAL97316.1"
FT                   /translation="MLFRDRIPTYKGYRRQFNQILLGAWGIESAYVDAEIIVATWRGLQ
FT                   RFKGIKVEFIQLSNKNIFDVLEKDLSKKLRFEDISIEAILGKYLCNNDIEIIKCLYEKD
FT                   KINMELLISLISKISNKLVKQEFIKVLVLYEYVKTFYQQIAFTFHYLIYMEQDIIQV"
FT   gene            503370..503786
FT                   /locus_tag="spyM18_0633"
FT   CDS_pept        503370..503786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0633"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97317"
FT                   /protein_id="AAL97317.1"
FT                   /translation="MNYKIFIRTKSGDIFDIADGGRIDDMVSKFNKVNVLGVCMGIGTT
FT                   VLSQEIEYEIEDRIMILVEKIDVKIYKNCLELANKISGYHCSVFEFPYKKIKKFFKHEL
FT                   YSRHHYIIVRLDGSMEYRFSSVALKNKIKSILDS"
FT   gene            complement(504159..504962)
FT                   /gene="tnpA"
FT                   /locus_tag="spyM18_0634"
FT   CDS_pept        complement(504159..504962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="spyM18_0634"
FT                   /product="transposase TnpA fragment"
FT                   /note="best blastp match pir||T09011 probable transposase
FT                   TnpA - Streptococcus pyogenes (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97318"
FT                   /protein_id="AAL97318.1"
FT                   /translation="MCRVLRVNRSTYYKFLKHKPSKRELDNQIYRKQILEIYTKANKRL
FT                   SVKSIKVILQRDYDTKISEGRIYRLMKNMALPKMATVKPKTALKKTQKTYPQNLLNQKF
FT                   YPDKPNQVWSTDFTYISIGYKKYVYLCAILDLYSRKCIAWKLSHHMDVKLACDTLELAL
FT                   NKRKIEGTLLFHSDQGSQFKAREFRKIIDDNTIMHSFSKPGYPYDNAVTEAFFKYLKHR
FT                   QINRKKYQNIKQVQLDCFEYIENFYNNYNPHTANLGLTPNQKEEN"
FT   gene            complement(505010..505285)
FT                   /locus_tag="spyM18_0635"
FT   CDS_pept        complement(505010..505285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0635"
FT                   /product="transposase fragment"
FT                   /note="best blastp match gb|AAK33551.1| (AE006513)
FT                   transposase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97319"
FT                   /protein_id="AAL97319.1"
FT                   /translation="MSAVKRYDEEFKQSLVNLYQTGKTQSELCKDYGVSASALAKWIKQ
FT                   YSQVKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASVIFMQNLK"
FT   gene            505590..506387
FT                   /locus_tag="spyM18_0636"
FT   CDS_pept        505590..506387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33552.1| (AE006513)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97320"
FT                   /protein_id="AAL97320.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYNQEQLAALLPKLAEKGILFAVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYRGEILFADMMTKEQYTEVAKKILANPHYVET
FT                   GMVFSGQKAAYILKGASEEYIQKTKHYYANVKVINGFEDMENDAIFKVSTNFTGHTVLE
FT                   GSDWLNQALPYATAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDY
FT                   QMLEFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYLKGLV"
FT   gene            506391..507215
FT                   /locus_tag="spyM18_0637"
FT   CDS_pept        506391..507215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33553.1| (AE006513)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97321"
FT                   /protein_id="AAL97321.1"
FT                   /translation="MNIRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGR
FT                   PLKAIGNLLEELDLLDHDDYSITFNGGLVQRNTGEVLDKSSLSFDQVCQIQQALEAVGL
FT                   PTDIISGGDVYSIPSKDGRHSQYHLANPLLTFIEVTSVVELPKDITYNKIVTVTDPDFL
FT                   DQQIIKLSPSLFEDFEAFKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEA
FT                   NDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGVAEAVKTFILEEES"
FT   gene            507215..508765
FT                   /locus_tag="spyM18_0638"
FT   CDS_pept        507215..508765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0638"
FT                   /product="putative signal recognition particle (docking
FT                   protein)"
FT                   /note="best blastp match gb|AAK33554.1| (AE006513) putative
FT                   signal recognition particle (docking protein)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97322"
FT                   /protein_id="AAL97322.1"
FT                   /translation="MGLFDRLFGKKETPKVAEEKLEENLLTETTQKEELSEKANEQDKI
FT                   EVVQQEDVSSEGAGSVENGPEAASVNAQVEEETGDNSNHPSEDTNEFATDKTDLKVSEL
FT                   SQSTASEPKDLVDQPVVEQFPTKQAQADASNDSAKEEAVDTSKEQSSSQQVMEDYYRRK
FT                   AALEKSLQEKAAATVPVMPEEVPQENQASTSAEASQNKATYDTIPETDQEKYKRSLKKT
FT                   RTGFSARLNSFFANFRRVDEEFFEELEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVGIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGMEKAVAKGVDILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGLLEGIL"
FT   gene            complement(508819..510186)
FT                   /locus_tag="spyM18_0639"
FT   CDS_pept        complement(508819..510186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0639"
FT                   /product="putative drug resistance protein"
FT                   /note="best blastp match gb|AAK33555.1| (AE006513) putative
FT                   drug resistance protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97323"
FT                   /protein_id="AAL97323.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKNVRERPLFFMATGLFTFGTILAVLTQSFAI
FT                   MLLARIFQGIGTGLVMPQMFNIILERVPMHKVGLFMGFAGLIISLAPAFGPTYGGFMIS
FT                   HFSWQWIFICILPVPLIAGILAYYYLEDSPVSEKVPFDWLAFIALSISLTSALLAITSL
FT                   ENGSVNLYYLGLFILSFVLFLYKNLTAKQPFLDIRILKIPSLTFGLIPFFVFQLINLGI
FT                   NFLTPNFIVMEKIANSSQAGMVLLPGTLLGALLAPAFGKLYDQKGARLSLYLGNSLFSL
FT                   SLIIMTLQTRHFMLLPFTLLYILFTFGRNMGFNNSLATAIRELPAEKNADATAIFQMMQ
FT                   QFAGALGTAMASLIANSQPEFTSGVQSVYLLFTIFALLDFIFFFAMFYHLGKKGLA"
FT   gene            510514..511356
FT                   /locus_tag="spyM18_0640"
FT   CDS_pept        510514..511356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0640"
FT                   /product="putative transcription antiterminator"
FT                   /note="best blastp match gb|AAK33556.1| (AE006513) putative
FT                   transcription antiterminator [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97324"
FT                   /protein_id="AAL97324.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPQEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYSLGVKALELIERNLGVTLAIDEAAFIAMHFVNA
FT                   SLDTPFKEPHRLTEIVSYIEQKIKTDFKTELDDTSIDYYRFMTHIKLFAQRVLSEMSYD
FT                   DDDAELLLVVKTKYPKEYRCVLDISEEIKKRYNYHLNSSELLYLTVHVKRLVKHLKET"
FT   gene            511358..513220
FT                   /locus_tag="spyM18_0641"
FT   CDS_pept        511358..513220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0641"
FT                   /product="beta-glucoside permease IIABC component"
FT                   /note="best blastp match gb|AAK33557.1| (AE006513)
FT                   beta-glucoside permease IIABC component [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97325"
FT                   /protein_id="AAL97325.1"
FT                   /translation="MTYQETAKAILATVGGKTNIQRVTHCVTRLRLVLKNDEKVKDQQV
FT                   KAISNVIGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQTVVFINFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLALFGAPVTPASYGSSVIPILMMVYL
FT                   MQYIEKWGNRLVPSVMKSFLQPTLIILISGFLVLVVVGPLGVIIGQGLSNTMLTIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFTNALIAGAATIVLAFSLTWFMGIDEESPEQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDETFSSKLLGEGFAILPSEGVVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   gene            513239..514663
FT                   /locus_tag="spyM18_0642"
FT   CDS_pept        513239..514663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0642"
FT                   /product="putative beta-glucosidase"
FT                   /note="best blastp match gb|AAK33558.1| (AE006513)
FT                   beta-glucosidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97326"
FT                   /protein_id="AAL97326.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKGKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGFIYVERNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   gene            complement(514762..515577)
FT                   /locus_tag="spyM18_0643"
FT   CDS_pept        complement(514762..515577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33559.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97327"
FT                   /protein_id="AAL97327.1"
FT                   /translation="MIRFLILAGYFELTMYLHLSGKLDQYINVQYSYLAYISMILSFIL
FT                   ALVQLYTWMKNIKVHSHLTGKIARLTSPFILVFPVLIGLLVPTVTLDSTTVSAKGYTFP
FT                   LAAGASKTGVSDDGTTIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVTITTENYME
FT                   VMELIYLYPDEFVDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYGLLTTGNQT
FT                   SYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   gene            complement(515577..516479)
FT                   /locus_tag="spyM18_0644"
FT   CDS_pept        complement(515577..516479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33560.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97328"
FT                   /protein_id="AAL97328.1"
FT                   /translation="MSLFSNLPPSVLQWFAIFMSIIIEALPFVLLGTILSGCIEVFVTP
FT                   ELVQKYLPKQKCLRILFGTFVGFVFPSCECGIIPIINRFLGKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLILRLVGAALVAITLGVMLAFIVDDNILKDNAQPVHFHDYS
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   gene            516613..516810
FT                   /locus_tag="spyM18_0646"
FT   CDS_pept        516613..516810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0646"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33561.1| (AE006514)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97329"
FT                   /protein_id="AAL97329.1"
FT                   /translation="MKQTSYGLLGFVCSVVFSLVASLPSVLTSKGLSKLGIDAKPASIF
FT                   SSSSFFLWVIAISMTFFHSR"
FT   gene            517016..519148
FT                   /locus_tag="spyM18_0648"
FT   CDS_pept        517016..519148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33563.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97330"
FT                   /protein_id="AAL97330.1"
FT                   /translation="MENNNNHNIAEALSVSLHQIEQVLALTVQGNTIPFIARYRKEVTG
FT                   NLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLVDLEELYL
FT                   PYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASSQEALAGAVDILV
FT                   EAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQGYRTLAL
FT                   NRGEKLGILKVSFEHNLEKMQRFFSVRFKETNPYIEEVINQTIKKKIVPAMERRVRSEL
FT                   SDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKLLTTQVIY
FT                   PVAPASQTKIQAAKETLTQLIETYQIDIIAIGNGTASRESEAFVADVLKDFPNTSYVIV
FT                   NESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDV
FT                   SQKKLSENLGFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREENGALTSR
FT                   ADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLGIQDLDDAA
FT                   KATLAAVQVPQMAETLAIGQETLKDIIADLLKPGRDLRDDFEAPILRQDILDLKDLEIG
FT                   QKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKTFVNHPSQVVSVGDLVTVWVSKIDL
FT                   DRHKVNLSLLPPRETH"
FT   gene            519135..519572
FT                   /locus_tag="spyM18_0649"
FT   CDS_pept        519135..519572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33564.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97331"
FT                   /db_xref="GOA:Q8P1Y0"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1Y0"
FT                   /protein_id="AAL97331.1"
FT                   /translation="MKLTNYVQEVSLADFGKPFHHKAYWNKRLKTTGGRFFPKDGHLDF
FT                   NPRMLEENGELIFRKIVRHELCHYHLYFEGRGYHHKDRDFKDLLAQVNGLRYVPTSSKS
FT                   KTNHHYSCQTCGQVYQRKRRINLSKYVCGNCHGKLIEKNQS"
FT   gene            519636..519908
FT                   /locus_tag="spyM18_0651"
FT   CDS_pept        519636..519908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0651"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33565.1| (AE006514)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97332"
FT                   /protein_id="AAL97332.1"
FT                   /translation="METKFYKQRKNRLVAGVIAGLADKYGWDLALARVLAALLIYGTGF
FT                   GVLLYILLAIFLPYKEDLLEERYGRGPRRRKDADVLNEEEDGWFW"
FT   gene            520213..521205
FT                   /gene="ptsK"
FT                   /locus_tag="spyM18_0653"
FT   CDS_pept        520213..521205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="spyM18_0653"
FT                   /product="Hpr kinase/phosphatase"
FT                   /note="best blastp match gb|AAK33566.1| (AE006514) Hpr
FT                   kinase/phosphatase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97333"
FT                   /db_xref="GOA:P68899"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68899"
FT                   /protein_id="AAL97333.1"
FT                   /translation="MSICKGLTVDLCYNIEKGEIMTVTVKMLVQKVKLDVVYATDNLLS
FT                   KEITTSDISRPGLEMTGYFDYYAPERLQLFGMKEWSYLTQMTSHNRYSVLKEMFKKDTP
FT                   AVVVSRNLAIPKEMVQAAKEEGISLLSSRVSTSRLAGEMSYFLDASLAERTSVHGVLMD
FT                   IYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWGEPAEILRHLLE
FT                   IRGVGIIDVMSLYGASAVKDSSQVQLAIYLENFEAGKVFDRLGNGNEEITFSGVRIPRI
FT                   RIPVKTGRNVSVVIEAAAMNHRAKEMGFDATKTFEDRLTQLITKNEVSQ"
FT   gene            521202..521981
FT                   /locus_tag="spyM18_0654"
FT   CDS_pept        521202..521981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0654"
FT                   /product="putative prolipoprotein diacylglycerol
FT                   transferase"
FT                   /note="best blastp match gb|AAK33567.1| (AE006514) putative
FT                   prolipoprotein diacylglycerol transferase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97334"
FT                   /db_xref="GOA:P60964"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60964"
FT                   /protein_id="AAL97334.1"
FT                   /translation="MINPIALKCGPLAIHWYALCILSGLVLAVYLASKEAPKKGISSDA
FT                   IFDFILIAFPLAIVGARIYYVIFEWSYYVKHLDEIIAIWNGGIAIYGGLITGALVLLAY
FT                   CYNKVLNPIHFLDIAAPSVMVAQAIGRWGNFINQEAYGKAVSQLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESLWNLLGFVIIMMWRRKPKSLLDGEIFAFYLIWYGSGRLVIEGMRTDSL
FT                   MFLGIRISQYVSALLIIIGLIFVIKRRRQKGISYYQE"
FT   gene            522003..522410
FT                   /locus_tag="spyM18_0656"
FT   CDS_pept        522003..522410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33568.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97335"
FT                   /protein_id="AAL97335.1"
FT                   /translation="MDLVGISLMIIALAFVALVIFLIIVLKKVSETIDEAKKTISVLTS
FT                   DVNVTLHQTNDILAKANILVEDVNGKVATIDPLFVAIADLSESLSDLNSQARHFGQKAT
FT                   NATGNVSKAGKLALVGKVASKVFGKKGEKHE"
FT   gene            522403..522831
FT                   /locus_tag="spyM18_0657"
FT   CDS_pept        522403..522831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33569.1| (AE006514)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97336"
FT                   /protein_id="AAL97336.1"
FT                   /translation="MNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAYQAYKESP
FT                   DDYHQFAKEKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQKTKETFA
FT                   EVEAKEKQDDVIIDLNEDDIIIDYTEQDEPVSDTLDKH"
FT   gene            complement(522990..523274)
FT                   /locus_tag="spyM18_0658"
FT   CDS_pept        complement(522990..523274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0658"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33570.1| (AE006514)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97337"
FT                   /protein_id="AAL97337.1"
FT                   /translation="MPAPLKKHNSVEQDDSYQESQSKFRDFQEFNGQSAKLKELVFFAR
FT                   IASFSLITVLFAFVLLVMNLAPMFAFLFASIISLGITSLLAKVIKSLLM"
FT   gene            523473..524399
FT                   /locus_tag="spyM18_0659"
FT   CDS_pept        523473..524399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0659"
FT                   /product="putative protease"
FT                   /note="best blastp match gb|AAK33571.1| (AE006514) putative
FT                   protease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97338"
FT                   /protein_id="AAL97338.1"
FT                   /translation="MEKIIITATAESIEQVKALLAAGVDRIYVGEANYGLRLPHNFSYD
FT                   ELRQIAKLVHDAGKELTVACNALMHQDMMDQIKPFLDLMIEIAVDYLVVGDAGVFYVNK
FT                   RDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSAELFTLAENLEFPAEVLV
FT                   YGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDASSHYSIYEDNHGTHIFIN
FT                   NDIDMMSKLGELYAHGLTHWKLDGIYCPGDDFVAITKLFIQAKTLLEAGQFTQEEAEKL
FT                   DQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   gene            524501..525787
FT                   /locus_tag="spyM18_0660"
FT   CDS_pept        524501..525787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0660"
FT                   /product="putative protease"
FT                   /note="best blastp match gb|AAK33572.1| (AE006514) putative
FT                   protease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97339"
FT                   /protein_id="AAL97339.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGEWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGGERRSLKGEI
FT                   PEDYSMSSVDMCMIDHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESPE
FT                   AFYAIKEELIDELWKVAQRELATGFYYGIPTENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRT"
FT   gene            525999..526211
FT                   /locus_tag="spyM18_0661"
FT   CDS_pept        525999..526211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33573.1| (AE006515)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97340"
FT                   /protein_id="AAL97340.1"
FT                   /translation="MAEFTFNIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   gene            complement(526584..528077)
FT                   /gene="lysS"
FT                   /locus_tag="spyM18_0663"
FT   CDS_pept        complement(526584..528077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="spyM18_0663"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /note="best blastp match gb|AAK33574.1| (AE006515) putative
FT                   lysyl-tRNA synthetase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97341"
FT                   /db_xref="GOA:Q8P1X6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1X6"
FT                   /protein_id="AAL97341.1"
FT                   /translation="MSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFDRTANSAELK
FT                   EKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVSEDNY
FT                   EIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRK
FT                   RHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADY
FT                   LDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFWPEMT
FT                   VEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNP
FT                   EDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   gene            528251..529153
FT                   /locus_tag="spyM18_0664"
FT   CDS_pept        528251..529153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33575.1| (AE006515)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97342"
FT                   /protein_id="AAL97342.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEAAGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRDRQLKPGTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDINDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   gene            complement(529261..529884)
FT                   /gene="pgmA"
FT                   /locus_tag="spyM18_0665"
FT   CDS_pept        complement(529261..529884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmA"
FT                   /locus_tag="spyM18_0665"
FT                   /product="putative phosphoglycerate mutase"
FT                   /note="best blastp match gb|AAK33576.1| (AE006515) putative
FT                   phosphoglycerate mutase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97343"
FT                   /protein_id="AAL97343.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEEAKDEIHLLGKELAK
FT                   VAFDAVYTSDLQRAMATAAIILDAFDQQPKLYHTDQLREWRLGKLEGAKITTMAAIYPQ
FT                   QMLAFRENLAQFKPDQFEAESIYQTTQRVCHLIQSFKDKHYQNVLIVGHGANLTATIRS
FT                   LLGFEPALLLAKGGLDNASLTILETKDYLTYDCLIWNDKSFLEV"
FT   gene            complement(530224..530703)
FT                   /locus_tag="spyM18_0666"
FT   CDS_pept        complement(530224..530703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0666"
FT                   /product="putative transcription regulator"
FT                   /note="best blastp match gb|AAK33577.1| (AE006515) putative
FT                   transcription regulator [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97344"
FT                   /protein_id="AAL97344.1"
FT                   /translation="MAKKTKLKKTLVEQILDKANIAHQGLKLNALEGDFPDDLQPSDIY
FT                   KTLALTGDQTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMVPQKDLQKTTGYIHGANNPV
FT                   GIRQKHSYPIFIDQTALEKGQIIVSAGEVGRSIKISSQALADFVGASFADLKKRK"
FT   gene            complement(530794..531357)
FT                   /locus_tag="spyM18_0667"
FT   CDS_pept        complement(530794..531357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33578.1| (AE006515)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97345"
FT                   /protein_id="AAL97345.1"
FT                   /translation="MSPNTNVKYLIEAAIFAALAMALSFIPDFAGWFSPSYGAIALVIF
FT                   SLRRGLKYGMLAGLIWGLLHFVLGKVYYLSMSQVFIEYILAFTSMGLAGSFSDSLIKTL
FT                   RRQQTFFAVFLAIMASLLAVTVRYLWHFLAGIIFWGSYAPKGMSAIWYSFSVNGTAGVL
FT                   TFLITCLALMIALPIHPQLFDPKD"
FT   gene            complement(531626..532474)
FT                   /locus_tag="spyM18_0668"
FT   CDS_pept        complement(531626..532474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0668"
FT                   /product="putative endolysin, phage associated"
FT                   /note="best blastp match gb|AAK33579.1| (AE006515) putative
FT                   endolysin, phage associated [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97346"
FT                   /protein_id="AAL97346.1"
FT                   /translation="MRRKIKPIVVLVFFILLAMVLIIGKRQANHAKQKEVEDAKSHIPI
FT                   ATSNPSKAKTSTSETEDFILNPIVDVSGWQLPEEIDYDTLSRHISGAIVRVYGGSQITA
FT                   HNNAAFTTGIDKSFKTHIKEFQKRNVPVAVYSYALGRSTKEMKEEARAFYKNAAPYNPT
FT                   YYWIDVEEATMKDMNKGVTAFREELKKLGAENVGLYIGTYFMAEQDISTKGFDAVWIPT
FT                   YGSDSGYYEAAPNTTLDYDLHQYTSQGYLSGFNNALDLNQIAVTKDTKKTFEKLFGNSN
FT                   N"
FT   gene            532800..533303
FT                   /locus_tag="spyM18_0669"
FT   CDS_pept        532800..533303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0669"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33580.1| (AE006515)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97347"
FT                   /protein_id="AAL97347.1"
FT                   /translation="MSAKLMSRIAIMSALCVVLRMVFSSLPNVQPVTAFLLSYLLYFGL
FT                   AEAVLVMMLCLFLSAFLLGFGPWVFWQVTCFVLVLLLWRFVLYPLSQQFPKYQLGYQAF
FT                   LAALCGLLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFSVVMMLFRRLIG
FT                   EQKI"
FT   gene            533287..533667
FT                   /locus_tag="spyM18_0670"
FT   CDS_pept        533287..533667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0670"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33581.1| (AE006515)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97348"
FT                   /protein_id="AAL97348.1"
FT                   /translation="MNKRFKTGFLALVAMLLVACSQGTKQTQTPSVPKADHHVRLVVKE
FT                   DTNTIDEKVSFGKGDTVLEILKDNYEVKEKDGFITAIDGIEQDTKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVL"
FT   gene            complement(533624..534127)
FT                   /gene="bsaA"
FT                   /locus_tag="spyM18_0672"
FT   CDS_pept        complement(533624..534127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaA"
FT                   /locus_tag="spyM18_0672"
FT                   /product="putative glutathione peroxidase"
FT                   /note="best blastp match gb|AAK33582.1| (AE006515) putative
FT                   glutathione peroxidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97349"
FT                   /protein_id="AAL97349.1"
FT                   /translation="MPNLYDFTVKAQNGNDLSLAAYKEKVVLIVNTATKCGLTPQYQAL
FT                   QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDAD
FT                   PLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLDKIQC
FT                   YHHL"
FT   gene            complement(534120..535919)
FT                   /gene="pepF"
FT                   /locus_tag="spyM18_0673"
FT   CDS_pept        complement(534120..535919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="spyM18_0673"
FT                   /product="putative oligopeptidase"
FT                   /note="best blastp match gb|AAK33583.1| (AE006515) putative
FT                   oligopeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97350"
FT                   /protein_id="AAL97350.1"
FT                   /translation="MELKKRSEFPENELWDLTALYKDRQDFLLAIEKALQDIDLFKRNY
FT                   EGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMPQTTDFSDESFAQIAQAGDDFMTKAN
FT                   VALSFFDTALANADLDVLDTLEKNPYFSAAIRMAKIQKEHLLSPDVEKALANLREVINA
FT                   PYDIYTKMRASDFDMDDFEVDGKTYKNSFVSYENFYQNHENAEIREKAFRSFSNGLRKH
FT                   QNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAEQEVDRSLFDRQIDLIMTEFGPVAQK
FT                   FLKHVAQVNGLEKMTFADWKLDIDNELNPEVSIDGAYDLVMKSLAPLGQEYTKEIERYQ
FT                   TERWVDFAANANKDSGGYAADPYKVHPYVLMSWTGRMSDVYTLIHEIGHSGQFIFSDNH
FT                   QSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDDPRQKRFALAHRLTDTYFHNFITHLL
FT                   EAAFQRKVYTLIEEGGTFGVDQLNAMMKEVLTDFWGDAVDIDDDAALTWMRQAHYYMGL
FT                   YSYTYSAGLVMSTAGYLNLKNNPDGAKEWLDFLKSGGSRTPLDTAMLIGADIATEKPLR
FT                   DTIQFLSDTVDQIINYTEEMSHA"
FT   gene            536114..538876
FT                   /gene="pepC"
FT                   /locus_tag="spyM18_0675"
FT   CDS_pept        536114..538876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="spyM18_0675"
FT                   /product="putative phosphoenolpyruvate carboxylase"
FT                   /note="best blastp match gb|AAK33584.1| (AE006516) putative
FT                   phosphoenolpyruvate carboxylase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97351"
FT                   /db_xref="GOA:Q8P1W7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1W7"
FT                   /protein_id="AAL97351.1"
FT                   /translation="MPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIESI
FT                   MVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTD
FT                   YLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRD
FT                   AKAGVISLEKWRQELYRYVEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTT
FT                   EYKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKL
FT                   AALYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSCLKQTQIQLTN
FT                   QPAARMSSSVGLNTSACPSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGD
FT                   LREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLVQQ
FT                   LMEEPRTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELA
FT                   IMLKEVGLVDQQRARVQIVPLFETIEDLDNACDIMAAYLSHDIVKSWIATNRNYQEIML
FT                   GYSDSNKDGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITS
FT                   QPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDSNEIDSFR
FT                   EIMDSIVADSNMIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLR
FT                   AIPWVFSWSQNRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMV
FT                   LSKSNMNIAFQYAQLAESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSL
FT                   KSRLPYFNVLNYIQIELIKRWRNNQLDENDEKLIHTTINGIATGLRNSG"
FT   gene            539046..540320
FT                   /gene="ftsW"
FT                   /locus_tag="spyM18_0676"
FT   CDS_pept        539046..540320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="spyM18_0676"
FT                   /product="putative cell division protein"
FT                   /note="best blastp match gb|AAK33585.1| (AE006516) putative
FT                   cell division protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97352"
FT                   /protein_id="AAL97352.1"
FT                   /translation="MKIDKRHLLNYSILLPYLILSVIGLIMVYSTTSVSLIQAHANPFK
FT                   SVINQGVFWIISLVAITFIYKLKLNFLTNTRVLTVVMLGEAFLLIIARFFTTAIKGAHG
FT                   WIVIGPVSFQPAEYLKIIMVWYLALTFAKIQKNISLYDYQALTRRKWWPTQWNDLRDWR
FT                   VYSLLMVLLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVMITGLSTVFLGTIA
FT                   VIGVERVAKIPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGWFGQGLGNSIE
FT                   KRGYLPEAQTDFVFSVVIEELGLIGAGFILALVFFLILRIMNVGIKAKNPFNAMMALGV
FT                   GGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNIDASEKRDDIF
FT                   KEAELSYRKDTRKENSKVVNIKQFQ"
FT   gene            complement(540325..540477)
FT                   /locus_tag="spyM18_0677"
FT   CDS_pept        complement(540325..540477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0677"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33591.1| (AE006517)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97353"
FT                   /protein_id="AAL97353.1"
FT                   /translation="MEFHALFLPQQKAAVWAHVTRKNKKSAEQFKFFEHQTGIVYILKS
FT                   PLRRF"
FT   gene            540674..541870
FT                   /gene="tufA"
FT                   /locus_tag="spyM18_0678"
FT   CDS_pept        540674..541870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="spyM18_0678"
FT                   /product="putative translation elongation factor EF-Tu"
FT                   /note="best blastp match sp|P82559|EFTU_STRPY ELONGATION
FT                   FACTOR TU (EF-TU)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97354"
FT                   /db_xref="GOA:Q8P1W4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1W4"
FT                   /protein_id="AAL97354.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDSKYEDIIMELMSTVDEYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGI
FT                   LLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTT
FT                   DVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA"
FT   gene            542111..542869
FT                   /gene="tpiA"
FT                   /locus_tag="spyM18_0680"
FT   CDS_pept        542111..542869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="spyM18_0680"
FT                   /product="putative triosephosphate isomerase"
FT                   /note="best blastp match sp|P82478|TPIS_STRPY
FT                   TRIOSEPHOSPHATE ISOMERASE (TIM)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97355"
FT                   /db_xref="GOA:Q8P1W3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1W3"
FT                   /protein_id="AAL97355.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKAIFANGLTPIICCGESLETYEAGKAAEFVGAQVSAALAGLSAEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   gene            complement(542968..544203)
FT                   /gene="femA"
FT                   /locus_tag="spyM18_0682"
FT   CDS_pept        complement(542968..544203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femA"
FT                   /locus_tag="spyM18_0682"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein alanine adding enzyme"
FT                   /note="best blastp match gb|AAK33588.1| (AE006516) putative
FT                   peptidoglycan branched peptide synthesis protein, alanine
FT                   adding enzyme [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97356"
FT                   /protein_id="AAL97356.1"
FT                   /translation="MALIEISQEQFDHYCHSLVHHSFIQTSEMASLMAKRGAKPQFLGL
FT                   EKDGELKVAAMVFSQKVAGGWRMELNAGPNTNHPEELEHFYTQLKDYAKQKDVIELILK
FT                   PYDNYQSFDTDGIPISHPNTDLISLLTALGYKHDGLKTGYPEGEPVWHYVKKLEGIDSS
FT                   RLTHSFSKKGKALIKKANTFGIKLRQLKRDELHHFKEITEATSDRRDYLDKSLSYYQDF
FT                   YDSFGDSCEFIVATLNFEDYLNNLKQRQLQLATSINKVKGDLGKNPHSEKKQNRLKELS
FT                   SQFETFQVRISEALHFLEEYGTKDVFLAGSLFIYTEQEAVYLFSGSYPKFNKFYSPALL
FT                   QEHAMLKAIHKGIKQYNFLGITGNFDGSDGVLRFKQNFNGFILQKPGTFRCYPFPIKYH
FT                   FIRLAKKLLNRY"
FT   gene            complement(544190..545416)
FT                   /gene="femB"
FT                   /locus_tag="spyM18_0683"
FT   CDS_pept        complement(544190..545416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femB"
FT                   /locus_tag="spyM18_0683"
FT                   /product="putative peptidoglycan branched peptide synthesis
FT                   protein, serine/alanine adding enzyme"
FT                   /note="best blastp match gb|AAK33589.1| (AE006516) putative
FT                   peptidoglycan branched peptide synthesis protein,
FT                   serine/alanine adding enzyme [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97357"
FT                   /protein_id="AAL97357.1"
FT                   /translation="MYTYKIGISPEEHDQFVLAQPQAGLLQSSKWGKVKDNWKHERISF
FT                   YENGVQVAAAACLIRKLPLGFTMIYIPRGPVMDYANFELLDFVIKTLKTFGKSKRALFV
FT                   KIDPSLVIKQTLEGKESKENDVTLSIIAFLKKLGVEWSGRTKELEDTIQPRIQANIYAK
FT                   DFDFDSLPKKAKQSIRTATNKGVNVTIGGSELLDDFSALMKKTENRKGIILRGKSYYQK
FT                   LLDIYAGQSYITMASLDLPEQKKLLIQQLDKALAEQARLTDKSKPSKVAENQKTIARLQ
FT                   KDLTILSEQLAAGKTRIPLAATLTLIYGETSENLYAGMDDNYRNYQAPLLTWYETAKEA
FT                   FKRGCRWHNLGGVENQQDGGLYHFKARLNPTIEEFAGEFNIPVGLVSSLAILTYNLRKK
FT                   LRSTTNGTN"
FT   gene            complement(545416..546225)
FT                   /locus_tag="spyM18_0684"
FT   CDS_pept        complement(545416..546225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33590.1| (AE006516)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97358"
FT                   /protein_id="AAL97358.1"
FT                   /translation="MSIKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGR
FT                   PIAGVISLLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLG
FT                   VHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLD
FT                   AAIKQIPQHFFDKYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIRKWVLN"
FT   gene            complement(546376..546609)
FT                   /locus_tag="spyM18_0686"
FT   CDS_pept        complement(546376..546609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0686"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33591.1| (AE006517)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97359"
FT                   /protein_id="AAL97359.1"
FT                   /translation="MEFYALFLSLGSQKSRVTSLPVLTSLLPQQKAAVLAHVTRRNKKS
FT                   VVKSAEQFMLFEHQTGFVSILRLKKEYFLQSF"
FT   gene            complement(546681..547721)
FT                   /locus_tag="spyM18_0687"
FT   CDS_pept        complement(546681..547721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33592.1| (AE006517)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97360"
FT                   /protein_id="AAL97360.1"
FT                   /translation="MTAALLHDIGHGAYSHTFEALFHTDHEAFTQEIITNPETEINAIL
FT                   VRHAPDFPDKVASVINHTYPNKQVVQLISSQIDCDRMDYLLRDSYFSAANYGQFDLMRI
FT                   LRVIRPVEDGIVFEHSGMHAVEDYIVSRFQMYMQVYFHPASRAVELILQNLLKRAQHLY
FT                   PEQQAYFQKTAPGLIPFFEKKANLADYIALDDGVMNTYFQVWMASEDHILSDLASRFIN
FT                   RKILKSVTFDQDSRGELERLRQLVESVGFDPDYYTGIHINFDLPYDIYRPELENPRTQI
FT                   EMMQKDGSLAELSQLSPIVKALTGTTYGDRRFYFPKEMLELDDLFAPSKETFMSYISNG
FT                   HFHFSQ"
FT   gene            548064..548450
FT                   /locus_tag="spyM18_0688"
FT   CDS_pept        548064..548450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0688"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33593.1| (AE006517)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97361"
FT                   /protein_id="AAL97361.1"
FT                   /translation="MKLQLTNHIRFGDETEIIQEIHDCEWREKGGYQYLIYQNTDKEKV
FT                   VIKYNETELTMSRFSNPQSIMKFFAGKKVLIALPTPMGVQQFLTDTSHYHLDCSCQKLD
FT                   LHYHLLQAQTEMLFASYHLELSWD"
FT   gene            548680..551361
FT                   /gene="pacL"
FT                   /locus_tag="spyM18_0689"
FT   CDS_pept        548680..551361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="spyM18_0689"
FT                   /product="putative calcium-transporting ATPase"
FT                   /note="best blastp match gb|AAK33594.1| (AE006517) putative
FT                   calcium-transporting ATPase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97362"
FT                   /protein_id="AAL97362.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVTEIDSKELVPGDIVLLEAGDVVPADLRLLE
FT                   ANSLKIEEAALTGESVPVEKDLSTAVSEDAGIGDRVNMGYQNSNVTYGRGIGVITNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGTLQSSSADIAFDNTTLRVMNFANDTKVDPSGKSIGDPTETALVQ
FT                   FGLDHNFDVREAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLKRVTQ
FT                   IEENGQIRPITDADKKTILDTNKSLAKQALRVLMMAYKYSDALPTLETEIVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAKAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTILVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   gene            complement(551445..552440)
FT                   /locus_tag="spyM18_0692"
FT   CDS_pept        complement(551445..552440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0692"
FT                   /product="putative transcriptional regulator"
FT                   /note="best blastp match gb|AAK33595.1| (AE006517) putative
FT                   transcriptional regulator (LacI family) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97363"
FT                   /protein_id="AAL97363.1"
FT                   /translation="MQRKVTIKDIAELAKTSKTTVSFYLNGRFDKMSEETKNRIKSTIE
FT                   ATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNSNYD
FT                   PSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWVKTN
FT                   NYDAVYDTIQQCIDKGYEHFIMITGNPNLLSTRIERASGFIDVLEANHLTHQEMIIDEN
FT                   QTSSEAIAQFLQGSLTKKSLVFVPNCWALPKVFTAMKSLKFNIPEIGLVGFDNIEWTKF
FT                   SSPTLTTIIQPAYEEGEQATKILIDDIEGHSQEAKQQIFDCQVNWQESTF"
FT   gene            complement(552504..554411)
FT                   /locus_tag="spyM18_0693"
FT   CDS_pept        complement(552504..554411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0693"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33596.1| (AE006517)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97364"
FT                   /protein_id="AAL97364.1"
FT                   /translation="MSLAFARFKETVNPDFCKNYLLDYQANSYADQKRIADLLLTNTFL
FT                   FEDNWDMEPCSIPYRLETITWQKAVTDDPEWNFMLNRQTYLQTLILVYLVERDERYLLK
FT                   AKGFILNWIESAIPLDPKGLATRTLDTGIRCFAWVKCLIYLNLFNVLTKQEESLILASL
FT                   EKQLQFLHTNYLDKYSLSNWGILQTTAILLADAYYGSDLDIAAATAFARKELTQQIALQ
FT                   ILEDGSQFEQSTMYHVEVLKSLLELTALVPDYLPQLRPTLLAMSDYLLKMTDPDHKQIP
FT                   LGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLPIQTLPT
FT                   FAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSICLYYKGQPLFCDAGRYTYKE
FT                   EPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHVYFIEGSYQTQ
FT                   FSDKNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLEVKTDHLSDLRLIS
FT                   DCPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPLQTGKRN
FT                   PIETALSWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNEIIRLKH
FT                   "
FT   gene            complement(554497..555318)
FT                   /locus_tag="spyM18_0694"
FT   CDS_pept        complement(554497..555318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0694"
FT                   /product="putative PTS dependent galactosamine IID
FT                   component"
FT                   /note="best blastp match gb|AAK33597.1| (AE006517) putative
FT                   PTS dependent galactosamine IID component [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97365"
FT                   /protein_id="AAL97365.1"
FT                   /translation="MTGSNKLTKKDYLKTALRAFFLQNGFNYSNYQGIGYANVIYPALK
FT                   KHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVMLENDRPEEETRNIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASLASDGLVLGPIFFFLAMNIILTAIKIGSGLYGYKVGT
FT                   SFIDKLSEQMAIVSRMANIVGVTVIAGLAATSVKITVPITFAAGKVDAANAAQKFVTIQ
FT                   GMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVILTVIIGVIGSWLGILA"
FT   gene            complement(555305..556087)
FT                   /locus_tag="spyM18_0695"
FT   CDS_pept        complement(555305..556087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0695"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIC
FT                   component"
FT                   /note="best blastp match gb|AAK33598.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine-IIC component
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97366"
FT                   /protein_id="AAL97366.1"
FT                   /translation="MVINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFIGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   gene            complement(556106..556594)
FT                   /locus_tag="spyM18_0696"
FT   CDS_pept        complement(556106..556594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0696"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-IIB
FT                   component"
FT                   /note="best blastp match gb|AAK33599.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine-IIB component
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97367"
FT                   /protein_id="AAL97367.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKFLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDSKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHQVVFNTKTTPAGNSASDVDILDYI"
FT   gene            complement(556630..557829)
FT                   /locus_tag="spyM18_0697"
FT   CDS_pept        complement(556630..557829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0697"
FT                   /product="putative unsaturated glucuronyl hydrolase"
FT                   /note="best blastp match gb|AAK33600.1| (AE006517) putative
FT                   unsaturated glucuronyl hydrolase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97368"
FT                   /protein_id="AAL97368.1"
FT                   /translation="MTRSLKTIALEPIKQPERFTKEDFLIQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTSEAREAALKAADKLVQRYQDKGGFIQAWG
FT                   VLGKKEDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPVKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFGDGSEQSRDSSATAIAVCGIHEMLKTLPDHDHDKKTYEAAMHSM
FT                   LRALIKDYANKDLNPGAPLLLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   gene            complement(557829..558266)
FT                   /locus_tag="spyM18_0698"
FT   CDS_pept        complement(557829..558266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0698"
FT                   /product="putative PTS dependent N-acetyl-galactosamine-and
FT                   galactosamine IIA component"
FT                   /note="best blastp match gb|AAK33601.1| (AE006517) putative
FT                   PTS dependent N-acetyl-galactosamine- and galactosamine IIA
FT                   component [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97369"
FT                   /protein_id="AAL97369.1"
FT                   /translation="MIAIIVMGHGHFASGIVSSLELIAGQQEKVTAIDFTTEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLPNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVLGLITCSKEGIVDWKTLSQQENGATDDELGGI"
FT   gene            558590..559384
FT                   /locus_tag="spyM18_0699"
FT   CDS_pept        558590..559384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0699"
FT                   /product="putative 5-keto-D-gluconate 5-reductase"
FT                   /note="best blastp match gb|AAK33602.1| (AE006518) putative
FT                   5-keto-D-gluconate 5-reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97370"
FT                   /protein_id="AAL97370.1"
FT                   /translation="MENMFSLQGKITLITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLAAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKVVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGTTEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   gene            559409..560050
FT                   /locus_tag="spyM18_0700"
FT   CDS_pept        559409..560050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0700"
FT                   /product="sugar-phosphate isomerase"
FT                   /note="best blastp match gb|AAK33603.1| (AE006518)
FT                   sugar-phosphate isomerase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97371"
FT                   /protein_id="AAL97371.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFKEYFFANAEPSELVTYLKSVLEQ"
FT   gene            560079..561080
FT                   /gene="kdgK"
FT                   /locus_tag="spyM18_0701"
FT   CDS_pept        560079..561080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="spyM18_0701"
FT                   /product="putative 2-keto-3-deoxygluconate kinase"
FT                   /note="best blastp match gb|AAK33604.1| (AE006518) putative
FT                   2-keto-3-deoxygluconate kinase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97372"
FT                   /protein_id="AAL97372.1"
FT                   /translation="MSKLLLVGEPLIRVSPNQFQPLTNACDAQLFFGGSEVNIARTLGG
FT                   FGLEARLFTALPDNPVGHAFHQFLKQSGVDMTLTTWQGNRVGLYYLENGFGCRASQVYY
FT                   DRCGSSFSALDKDSLDLAAIFEGIRHFHFSGISLALGKKTQDLIEILAREAKKRDICVS
FT                   FDLNFRSSMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFDRNKADTTTIRERL
FT                   AGLYQRYQLQAIYHTERSNDAQGSNRFKAYAYDGQFYESCEVTTPVLQRVGSGDAFVAG
FT                   LLYQLLEGNEKQCNLDLAVATASLKCTVAEDQLYHSVQQVEAVLANQRDVQR"
FT   gene            561085..561720
FT                   /gene="alkH"
FT                   /locus_tag="spyM18_0702"
FT   CDS_pept        561085..561720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkH"
FT                   /locus_tag="spyM18_0702"
FT                   /product="putative 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="best blastp match gb|AAK33605.1| (AE006518) putative
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97373"
FT                   /protein_id="AAL97373.1"
FT                   /translation="MGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGIKTIEVT
FT                   YTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQLIVGPNFNRAVALI
FT                   CHRYSIPYLPGCMTVNEVVTALESGVDMVKIFPGSTVGMSFIRAIKSPLPQVEVMVTGG
FT                   VSSDNLKDWLAAGVDVLGIGGEFNQLASQKQYNLITKKAAHYIKSLRQ"
FT   gene            562016..562666
FT                   /locus_tag="spyM18_0703"
FT   CDS_pept        562016..562666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0703"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33606.1| (AE006518)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97374"
FT                   /protein_id="AAL97374.1"
FT                   /translation="MIKGIIFDMDGVLFDTEPFYLRRREDFFKTKGIPIDHLNSKDFIG
FT                   GNLQELWKELLGKNRDDAIVKAITTDYDAYKQAHKPPYQKLLITEVNSCLGQLKKQGIK
FT                   LAVASNSKRQDVLLALETTQIKDYFEIILAREDVSRGKPYPDIYNKAVQKLGLQKKQLL
FT                   VVEDSQKGIAAAKAANLTVFAITDYRYGIDQSQADHKIDHLGQLCVKIGCFGS"
FT   gene            563361..564485
FT                   /locus_tag="spyM18_0704"
FT   CDS_pept        563361..564485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0704"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33607.1| (AE006518)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97375"
FT                   /protein_id="AAL97375.1"
FT                   /translation="MTIKAEIKALAKEIGISKFGFTTADNFDYLEKSLRASVEEGRNSG
FT                   FEHKVIEDRISPESLLESAKTIISIGVAYPHKLPQQPQKTPYKRGKITPSSWGLDYHYV
FT                   VGEKLDRLSKGIEELCRDFPLQQKAMVDTGALVDTAVAQRAGIGFIGKNGLVISKEYGS
FT                   YMFLGELITNLEIEPDKPVDYDCGDCRRCLDACPTSCLIGDGSMNAKRCLSFQTQDKGM
FT                   MDIEFRKKIKTVIYGCDICQICCPYNKGINNSPATEIDPELAQPELIPFLSLSNGQFKE
FT                   KFGMIAGSWRGKNILQRNAIIALANAHDKTAVVKLIEIIDKNNNPIHTATAIWALGEIV
FT                   KKPNDEMLAFMSHLTLKDEDSQKELELIRRKWQV"
FT   gene            564639..565652
FT                   /gene="prfB"
FT                   /locus_tag="spyM18_0705"
FT   CDS_pept        564639..565652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="spyM18_0705"
FT                   /product="putative peptide chain release factor 2"
FT                   /note="best blastp match gb|AAK33608.1| (AE006518) putative
FT                   peptide chain release factor 2 [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97376"
FT                   /protein_id="AAL97376.1"
FT                   /translation="MEEEIALLENHMTEPDFWNDNIAAQKTSQELNELKGKYDTFHNMQ
FT                   ELSDETELLLEMLDEDDSLKEELEENLMQLDKIMGAYEMTLLLSEPYDHNNAILEIHPG
FT                   SGGTEAQDWGDLLLRMYTRFGNANGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKS
FT                   EMGVHRLVRISPFDSAKRRHTSFASVEVMPELDDTIEVEVRDDDIKMDTFRSGGAGGQN
FT                   VNKVSTGVRLTHIPTGIVVSSTVDRTQYGNRDRAMKMLQAKLYQLEQEKKAQEVDALKG
FT                   DKKEITWGSQIRSYVFTPYTMVKDHRTNFELAQVDKVMDGEINGFIDAYLKWRIED"
FT   gene            565671..566363
FT                   /gene="ftsE"
FT                   /locus_tag="spyM18_0706"
FT   CDS_pept        565671..566363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="spyM18_0706"
FT                   /product="putative cell-division ATP-binding protein"
FT                   /note="best blastp match gb|AAK33609.1| (AE006518) putative
FT                   cell-division ATP-binding protein [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97377"
FT                   /protein_id="AAL97377.1"
FT                   /translation="MALIEMSGVTKKYRRSTTALRDVNVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEQLTTGKLYVGEFNLTKLKARDVPILRRHIGVVFQDYKLLPRKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPSQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEE
FT                   KGDYGYDD"
FT   gene            566356..567285
FT                   /gene="fts"
FT                   /locus_tag="spyM18_0707"
FT   CDS_pept        566356..567285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fts"
FT                   /locus_tag="spyM18_0707"
FT                   /product="putative cell-division protein"
FT                   /note="best blastp match gb|AAK33610.1| (AE006518) putative
FT                   cell-division protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97378"
FT                   /protein_id="AAL97378.1"
FT                   /translation="MIRYFFRHIWESIKNLKRNFWMTFASVSMVAVTLTLVGVFAATLL
FT                   NIQRVASGVENNVHINTYLQVDSTDAAKVIQNTAGEPVNNDNYHSVYDKIAQIKGVKKI
FT                   TFSSKDEQLKKLQETLGDVWNMYDQDTNPLQDIYLIETQTPKQVKAITKKIRTIEGVEA
FT                   ADYGGINSDKLFKFSTLIQTWGLIGTAMLLFVAVFLISNTIRMTIMSRKRDIEIMRLVG
FT                   AKNSYIRGPFFFEGAWVGLLGAVLPSLLIYYGYDLVYKHFAQELQRNNLSMYPLDPYVY
FT                   YLIGALFVIGIMIGSLGSVLSMRRYLKF"
FT   gene            complement(567596..568294)
FT                   /locus_tag="spyM18_0708"
FT   CDS_pept        complement(567596..568294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0708"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33611.1| (AE006518)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97379"
FT                   /protein_id="AAL97379.1"
FT                   /translation="MPFIFRHSFFNKALIFWYTILMKIYKTINHIAGENTYYLVNDQAV
FT                   ILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHIFSLDLVRDAFDHPPVYVSEKEAA
FT                   WLSSPDDNLSGLGRHDDIINVIARPAENFFKLKQPYQLNGFEFTVLPTPGHSLGGVSFV
FT                   FHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQELFTLPNHYRVYPGHGPSTTIC
FT                   HEKNANPFFH"
FT   gene            568462..569226
FT                   /locus_tag="spyM18_0709"
FT   CDS_pept        568462..569226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0709"
FT                   /product="putative acetoin reductase"
FT                   /note="best blastp match gb|AAK04996.1|AE006323_11
FT                   (AE006323) acetoin reductase (EC 1.1.1.5) [Lactococcus
FT                   lactis subsp. lactis]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97380"
FT                   /protein_id="AAL97380.1"
FT                   /translation="MSKVAIVTGAGQGIGFAIAKRLHADGFKIGILDYNEETAQAAVDK
FT                   LSPEDAVAVVADVSKRDQVFDAFQKVVDTFGDLNVVVNNAGVAPTTPLDTITEEQFEKA
FT                   FAINVGGTIWGSQAAQKHFRELGHGGKIINATSQAGCEGNPNLTVYGGTKFAVRGITQT
FT                   LAKDLASEGITVNAYAPGIVKTPMMFDIAHEVGKNAGKDDEWGMEQFAKDITLKRLSEP
FT                   EDVANAVGFLAGDDSNYITGQTIVVDGGMVFH"
FT   gene            569334..571835
FT                   /gene="dinG"
FT                   /locus_tag="spyM18_0710"
FT   CDS_pept        569334..571835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="spyM18_0710"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="best blastp match gb|AAK33612.1| (AE006519) putative
FT                   ATP-dependent DNA helicase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97381"
FT                   /protein_id="AAL97381.1"
FT                   /translation="MFCFIDIACYNRLTMTQKKLRKYAVVDLEATGAGPNASIIQVGIV
FT                   IIQGNKIMDSYETDVNPHESLDEHIVHLTGITDKQLAKAPDFGQVAHHIYQLIEDCIFV
FT                   AHNVKFDANLLAEALFLEGYELTIPRVDTVELAQLFFPRFEKYNLSHLSRQLNIDLAEA
FT                   HTAIADARATAILFLRLLQKIESLPIECLESLLVYSDSLLFETAMVIQEGLAKAKPYDP
FT                   NKYIKIRQILLPKGSKALKPYQISKSFPINMALLGLEERPKQTQFAQLIDEDYHQGVAS
FT                   FIEAQTGIGKTYGYLLPLLAKEDQNQIIVSVPTKLLQDQLMAGEVAAIQEQFHIACHSL
FT                   KGPANYLKLDSFADSLDQNDQNRLVNRYKMQLLVWLLETKTGDLDEIKQKQRFAAYFEQ
FT                   LKHDGDIKQSSEFYDYDFWRVSYEKAKTARLLITNHAYFLHRVQDDKDFARNKVLVFDE
FT                   AQKLMLKLDQLSRHQLNLTVFLQTIQAKLSNPLPLLEKRLLESLSFELGQVSSDYYQNK
FT                   EHQLAHDWSRIAGYAKELTGADYQELQAFFATSDGDYWLSSEKQEEKRVTYLNSASKAF
FT                   IHFQQLLPETVKTYFVSATLTISSEVTLADLLGFEEYLYHVIEKDKKQDQLVLVDQEAP
FT                   IVTEVSDQIYVEAIAKRIESLKQEGYPILVLFNSKKHLLLVSDYLDQWQVSHLAQEKNG
FT                   TAYNIKKRFDQGEQTILLGLGSFWEGVDFIQADRMITLIARLPFDNPEDFFVKKMSHYL
FT                   LEKGKNPFRDYFLPMTILRLKQAIGRTMRRQDQKSVVIILDRRLLTKSYGQVILEGLGQ
FT                   EFLISQQNFHDCLVETDCFLI"
FT   gene            572170..573363
FT                   /gene="aspC"
FT                   /locus_tag="spyM18_0711"
FT   CDS_pept        572170..573363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="spyM18_0711"
FT                   /product="putative aspartate aminotransferase"
FT                   /note="best blastp match gb|AAK33613.1| (AE006519) putative
FT                   aspartate aminotransferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97382"
FT                   /protein_id="AAL97382.1"
FT                   /translation="MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFT
FT                   PKHIQDKAIESIQNGTASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERART
FT                   SKTKVVLINSPSNPTGMIYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAI
FT                   EAFCGSQSSLEEMRLAFEERLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFS
FT                   DVTSFANAILEEVGLAVVSGAGFGAPENVRLSYATDIETLKEAIRRLHVFMESNEIN"
FT   gene            573384..574730
FT                   /gene="asnS"
FT                   /locus_tag="spyM18_0712"
FT   CDS_pept        573384..574730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="spyM18_0712"
FT                   /product="putative asparaginyl-tRNA synthetase"
FT                   /note="best blastp match gb|AAK33614.1| (AE006519) putative
FT                   asparaginyl-tRNA synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97383"
FT                   /db_xref="GOA:P67577"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67577"
FT                   /protein_id="AAL97383.1"
FT                   /translation="MSKKLISIVDVKDYVGQEVTIGAWVANKSGKGKIAFVQLRDGSAF
FT                   FQGVAFKPNFIEKYGEESGLEKFDVIKRLNQETSVYVTGIVKEDERSKFGYELDITDLE
FT                   IIGESHEYPITPKEHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKF
FT                   DSPILSENAAEDSTELFETDYFGKPAFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVLDRAPQALDILERDVEALKRY
FT                   ITEPFKRVSYDDAITLLQEHEADEDTDYEHLEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   DFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRIRP"
FT   gene            575144..576034
FT                   /locus_tag="spyM18_0713"
FT   CDS_pept        575144..576034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0713"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33615.1| (AE006519)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97384"
FT                   /db_xref="GOA:Q8P1T8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1T8"
FT                   /protein_id="AAL97384.1"
FT                   /translation="MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFWILFLDATDGELVSRY
FT                   KETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGS
FT                   NQASFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVELREKTGLDEDVFNYVMSHPE
FT                   SEVFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHCLAESLATDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   gene            576031..577008
FT                   /locus_tag="spyM18_0714"
FT   CDS_pept        576031..577008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0714"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33616.1| (AE006519)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97385"
FT                   /db_xref="GOA:Q8P1T7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1T7"
FT                   /protein_id="AAL97385.1"
FT                   /translation="MKNPKMTVIGGGTGISIILKSLRNEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLAPPGDLRNVLLAMSDMPKFYERVFQYRFNESDGALAGHPLGNLIIAGISEMQG
FT                   STYNAIQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYQGMIDHVYVTN
FT                   TYNDQKPQASRKVVEAILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEVVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGRDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCRAAKRVISSYFLRLENGGAFHDGNLVVEELMNLVRIVKQ"
FT   gene            577005..577916
FT                   /locus_tag="spyM18_0715"
FT   CDS_pept        577005..577916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33617.1| (AE006519)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97386"
FT                   /db_xref="GOA:Q8P1T6"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1T6"
FT                   /protein_id="AAL97386.1"
FT                   /translation="MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITT
FT                   ENAKIARYIYSFIEDAYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFF
FT                   GLETGIEPQVLSDDNAGRSYLKGAFLTAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYLQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANN
FT                   AETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   misc_feature    578053..619123
FT                   /note="phi speC"
FT   misc_feature    578053..578074
FT                   /note="phi SpeC attL"
FT   gene            complement(578093..579508)
FT                   /gene="int"
FT                   /locus_tag="spyM18_0716"
FT   CDS_pept        complement(578093..579508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="spyM18_0716"
FT                   /product="putative integrase; bacteriophage 370.1"
FT                   /note="best blastp match gb|AAK33618.1| (AE006519) putative
FT                   integrase; bacteriophage 370.1 [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97387"
FT                   /protein_id="AAL97387.1"
FT                   /translation="MRKVAIYSRVSTINQAEEGYSIQGQIEALTKYCEAMEWKIYKNYS
FT                   DAGFSGGKLERPAITELIEDGKNNKFDTILVYKLDRLSRNVKDTLYLVKDVFTANNIHF
FT                   VSLKENIDTSSAMGNLFLTLLSAIAEFEREQIKERMQFGVMNRAKSGKTTAWKTPPYGY
FT                   RYNKDEKTLSVNELEAANVRQMFDMIISGCSIMSITNYARDNFVGNTWTHVKVKRILEN
FT                   ETYKGLVKYREQTFSGDHQAIIDEKTYNKAQIALAHRTDTKTNTRPFQGKYMLSHIAKC
FT                   GYCGAPLKVCTGRAKNDGTRRQTYVCVNKTESLARRSVNNYNNQKICNTGRYEKKHIEK
FT                   YVIDVLYKLQHDKEYLKKIKKDDNIIDITPLKKEIEIIDKKINRLNDLYINDLIDLPKL
FT                   KKDIEELNHLKDDYNKAIKLNYLDKKNEDSLGMLMDNIDIRKSSYDVQSRIVKQLIDRV
FT                   EVTMDNIDIIFKF"
FT   gene            complement(579631..579936)
FT                   /locus_tag="spyM18_0717"
FT   CDS_pept        complement(579631..579936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0717"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97388"
FT                   /protein_id="AAL97388.1"
FT                   /translation="MNLENTKLRTKCPSCGKSIILTFHTRRCPKCFLDFKEDYVKRIFY
FT                   DYESNVANSTFTKVGEKMTSAGEGMEKTGNTIQQIGCIIMLIPIVYILFQLISAFN"
FT   gene            complement(579946..580710)
FT                   /locus_tag="spyM18_0718"
FT   CDS_pept        complement(579946..580710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0718"
FT                   /product="putative repressor protein"
FT                   /note="best blastp match gb|AAK34059.1| (AE006560) putative
FT                   repressor protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97389"
FT                   /protein_id="AAL97389.1"
FT                   /translation="MNDKELALYIGSKIKELRKNKGLTQKELAILVNMGDTTIANYEKG
FT                   FRTPKKNTLFKLANALSVTIDDLFPPIKKSDKTSHELKIPTSPLVKKITTTVVELNVPR
FT                   KQKVLDFATEQLKEQKNKITSIEKKLYEYKVYEKLSAGTGYGYFGDGNYDTVFYDEELD
FT                   YDFASWVFGDSMEPTYLNGEVVLIKQTGFDYEGGIYAVEWDGQTYIKKVYREKDGLRLV
FT                   SLNKKYNDKFAPFSEGPRIIGEIVGNFMPKEY"
FT   gene            581070..581228
FT                   /locus_tag="spyM18_0719"
FT   CDS_pept        581070..581228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0719"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33854.1| (AE006542)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97390"
FT                   /protein_id="AAL97390.1"
FT                   /translation="MNWKKLMFGDLEYTFASRDGKEKTSIEFEGGVLPALLVLCGITWL
FT                   IAWFITK"
FT   gene            complement(581327..581968)
FT                   /locus_tag="spyM18_0721"
FT   CDS_pept        complement(581327..581968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0721"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97391"
FT                   /protein_id="AAL97391.1"
FT                   /translation="MNFFNFLLCVFKFTSEYLIKNWIALIALFLSYSNYRRNNLQVELI
FT                   AAPVSDWILSVILDNGESIYNPNGTLRANIKIINPSNVDVSYFDLIVFDKNRKYQHYYQ
FT                   KQNNIINDLTGREAIAAVQPDGNTILIEVPEADCGVLKAHSMTRMDLIIQTSEITDRLF
FT                   VAFKVAKKKKLFKANKAGYVNSPYQSFSASFPVELSKKPHYEDILKDLHE"
FT   gene            582020..582208
FT                   /locus_tag="spyM18_0722"
FT   CDS_pept        582020..582208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0722"
FT                   /product="putative cro protein"
FT                   /note="best blastp match ref|NP_108683.1| cro2009
FT                   [Bacteriophage Tuc2009]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97392"
FT                   /protein_id="AAL97392.1"
FT                   /translation="MQILLYKLRKEKGISQEEMSKVINKSSNTYRDKELGKRDFTQSEM
FT                   FKIASFFNKDLGEIFTP"
FT   gene            582257..583018
FT                   /locus_tag="spyM18_0723"
FT   CDS_pept        582257..583018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0723"
FT                   /product="putative antirepressor"
FT                   /note="best blastp match ref|NP_061599.1| antirepressor
FT                   [Staphylococcus aureus prophage phiPV83]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97393"
FT                   /protein_id="AAL97393.1"
FT                   /translation="MQEIFNFKGQEVRTVTIDDEPYFVGKDVAEILGYAKARNAIASHV
FT                   DDEDKKDAPIQGTLGGTQTMTIINESGLYSLILSSKLPQAKEFKRWVTSEVLPTIRKHG
FT                   MYATDELLDNPDFAIATLQKLKEEREAKKLLEAQIEADRPKVLFADAVSASHTSILVGE
FT                   LAKLLKQNGVNIGATRLFTWLRKHGYLIKRNGRDWNMPTQKSVELGLIRVKETSITHSD
FT                   GHITVSKTPLVTGKGQQYFINKFLNQEYLPV"
FT   gene            583428..583565
FT                   /locus_tag="spyM18_0724"
FT   CDS_pept        583428..583565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0724"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33622.1| (AE006520)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97394"
FT                   /protein_id="AAL97394.1"
FT                   /translation="MKRQKEQWTPKVRCFRKDGSQCEPENITVPISFAGYYQILLEVGA
FT                   "
FT   gene            583567..583752
FT                   /locus_tag="spyM18_0725"
FT   CDS_pept        583567..583752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0725"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33863.1| (AE006543)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97395"
FT                   /protein_id="AAL97395.1"
FT                   /translation="MNKLELFLLVTTVVLAVIAKVQHEVIKEHNSPENKRRIFREVAME
FT                   NSKGWGEKRSRGEVVS"
FT   gene            584235..584621
FT                   /locus_tag="spyM18_0726"
FT   CDS_pept        584235..584621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0726"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33864.1| (AE006543)
FT                   conserved hypothetical protein - phage associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97396"
FT                   /protein_id="AAL97396.1"
FT                   /translation="MDEKKLFENFQLTFGRMISPFEIEDIQKWIHEDNMPIEVVNLALR
FT                   EAVENNKISWKYINKILVDWYKSGDTTVEKVRDRLQRFDDSKKQRSVTTSNVPSWSNPD
FT                   YKEPDLKEFALGSMDGIEDGSGDF"
FT   gene            584602..584835
FT                   /locus_tag="spyM18_0727"
FT   CDS_pept        584602..584835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0727"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33865.1| (AE006543)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97397"
FT                   /protein_id="AAL97397.1"
FT                   /translation="MDQEIFNFFNKQIKKDFGKTASKETFAKFASYCAEGIEKNGVKPI
FT                   FNWINLYAFGTDITTAEADRLRIERYKQENVL"
FT   gene            584832..584972
FT                   /locus_tag="spyM18_0728"
FT   CDS_pept        584832..584972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0728"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97398"
FT                   /protein_id="AAL97398.1"
FT                   /translation="MTKQHRETLIWYRASHQERERLLDFGLVDKARYVTLLRQLRKKYA
FT                   I"
FT   gene            584981..585187
FT                   /locus_tag="spyM18_0729"
FT   CDS_pept        584981..585187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0729"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34280.1| (AE006582)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97399"
FT                   /protein_id="AAL97399.1"
FT                   /translation="MTPEQAEKAKIRAKQELETFSIYLDQAIDELGGVLTSREVFLAAG
FT                   ITYLGAGQTDIHAAVEGLCEQIQ"
FT   gene            585243..585575
FT                   /locus_tag="spyM18_0730"
FT   CDS_pept        585243..585575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0730"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34279.1| (AE006582)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97400"
FT                   /protein_id="AAL97400.1"
FT                   /translation="MNIKEKIVVLRNTEDGSFLKSFKNKKDVLAYNVELTDSIQLASFL
FT                   PEEAYNIQKEKIDNLAETLGCDVVVIEASYDLKFIDGEDVPELTKEQKVKSMVNGMFDE
FT                   ILRGSI"
FT   gene            585575..586564
FT                   /locus_tag="spyM18_0731"
FT   CDS_pept        585575..586564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0731"
FT                   /product="putative recombinase"
FT                   /note="best blastp match gb|AAK34278.1| (AE006582) putative
FT                   recombinase - phage associated [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97401"
FT                   /protein_id="AAL97401.1"
FT                   /translation="MTNQLAQNNHNSFFKSPAVKNRIEQVVGARAEQFTTSLLSIISNN
FT                   NLLAKATSESIMGAAMKAAVLNLPIEPSLGFAYVVPYNRNYKDGNRWITVNEAQFQIGY
FT                   RGLIQLAQRSGQVRNIEHGIIYEEEFLGYDKIRGQLKLTGDYVDSGVVKGYFASLELIS
FT                   GFYKMIFWPKEKVYEHAKKYSKTFDKKTGDFKPGTPWATEFDPMAIKTLLKELLSKYAP
FT                   LSVEMQDALEADNADSTIVIPKDVTPQETNSLDDLIGTQNEKKDAPSNLKDVIKDLHSE
FT                   PEKTLTDENKTVLEDTSYPADEIPDFDQETGEIKASEGNLFDNLGDLI"
FT   gene            586561..586761
FT                   /locus_tag="spyM18_0732"
FT   CDS_pept        586561..586761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0732"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34277.1| (AE006582)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97402"
FT                   /protein_id="AAL97402.1"
FT                   /translation="MIKLVKIEGYYINPEYVVGVWERSALNFDDLDEKVVVIQFVGDRE
FT                   REEFVFCDTPIDEVIKRLLDD"
FT   gene            586754..587551
FT                   /locus_tag="spyM18_0733"
FT   CDS_pept        586754..587551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0733"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34276.1| (AE006582)
FT                   hypothetical protein phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97403"
FT                   /protein_id="AAL97403.1"
FT                   /translation="MTSLDLLGKDYYSRESAIRYWSISQYKRFKECEARALAELQGNWT
FT                   DTRDNTALLVGNYVHSYFESKKAHEEFKAQNGSEMISTRGATKGQLKKDYLVAEQMIDA
FT                   LKSDSNFMAIYQGEKEAAITGFLGEIEFKGKIDCLNVERGYFVDIKTTKGQIDDTIWNG
FT                   EERVRWFEAYGYILQMAAYKNMLEAKYNKPFKPIIYAVTKETPSDTRAIAIENVDAMQN
FT                   ELDDLAQNIKRLDDVKKGIKKPKPCGHCEYCRANQLTQRVMIF"
FT   gene            587728..588069
FT                   /locus_tag="spyM18_0734"
FT   CDS_pept        587728..588069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0734"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34275.1| (AE006582)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97404"
FT                   /protein_id="AAL97404.1"
FT                   /translation="MEQIKITGTGTALILDRVNRIFAISGSLTMQWDFISDFKKIDDEP
FT                   SLDEDGELFETAYDLVLEAKPKTKINLTSSYFAKEHKKDTDEIIKVFSFIEDNKRNIFE
FT                   TLGIRGVLE"
FT   gene            588066..588578
FT                   /locus_tag="spyM18_0735"
FT   CDS_pept        588066..588578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0735"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33872.1| (AE006543)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97405"
FT                   /protein_id="AAL97405.1"
FT                   /translation="MSNLVLSLDISTSGTGWALFKGSDLFQSGVLKHNSDSYFERGRYM
FT                   ASQLRLIQSRALKKYDCRFSTIAVEKNSVMGPNQQSMLKIGIVTGIILGRLIADNVVFI
FT                   NVSTWRKHWKFSYKDRSKKAMKAQSKEKALEYCGKTVKDDEADAILIGSYYVNQGYLDE
FT                   LETHDYY"
FT   gene            588565..588762
FT                   /locus_tag="spyM18_0736"
FT   CDS_pept        588565..588762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0736"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97406"
FT                   /protein_id="AAL97406.1"
FT                   /translation="MTTTKKHVVRVYNKGITATYAIYDKKLFKEHEFATKNEAMRFIRQ
FT                   LELANDKRATEYYLREVERC"
FT   gene            588756..589040
FT                   /locus_tag="spyM18_0737"
FT   CDS_pept        588756..589040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0737"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97407"
FT                   /protein_id="AAL97407.1"
FT                   /translation="MLTEDTFKKIEELEAACQDTTDNIKKPSHYQGRHGMEAIDVVKNF
FT                   SACPEHEEGFYWGNAVKYLLRYHAKNGVEDLKKARQNLDWLIKKLEEVE"
FT   gene            589037..589306
FT                   /locus_tag="spyM18_0738"
FT   CDS_pept        589037..589306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0738"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97408"
FT                   /protein_id="AAL97408.1"
FT                   /translation="MKKPNRYPYSKSKFNGCIYQLHAASFKDEQYVEDLKSCGIHYQIT
FT                   KIGYFPDIFIKIDNLEQLQILIDKTGHDLILSKDQIWIYDDYME"
FT   gene            589316..589729
FT                   /locus_tag="spyM18_0739"
FT   CDS_pept        589316..589729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0739"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33873.1| (AE006543)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97409"
FT                   /protein_id="AAL97409.1"
FT                   /translation="MIPKFRAFNKKIQKMYSIDGFKSSERKIYRCSLADDEFRSGRLET
FT                   FHFVEDNLDDYILRQSTGLFDKNGVEIFEGDVVKLQYTITSDLEFFKVNQFRGGSWRID
FT                   NRRRGSDLWLRNEDCEVIGNIYQNSDLIESVEE"
FT   gene            589726..590010
FT                   /locus_tag="spyM18_0740"
FT   CDS_pept        589726..590010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0740"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34273.1| (AE006582)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97410"
FT                   /protein_id="AAL97410.1"
FT                   /translation="MTTDELLQNLRDDLNKIINVLKNDWKALLFLAIAIFGMMVTVSYF
FT                   SYRDARQYYESQITGLRTQLSRTQKQLKRASEQNQRQTKRIAEMTGNGG"
FT   gene            590014..590496
FT                   /locus_tag="spyM18_0741"
FT   CDS_pept        590014..590496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0741"
FT                   /product="putative methyltransferase"
FT                   /note="best blastp match emb|CAC28355.1| (AJ004687) DNA N-4
FT                   cytosine methyltransferase M.NgoMXV [Neisseria
FT                   gonorrhoeae]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97411"
FT                   /protein_id="AAL97411.1"
FT                   /translation="MTDIKILDACCGSRLFWFDKNEPHTTFMDVRQEKFEMHGKKINVN
FT                   PDVIGDFRDMPFESNSFNLVVFDPPHLKYVGQNSIMKAQYGQLDKENWKEDISKGFEEC
FT                   MRVLKVGGTLVFKWSDCQVNVREVLSAIPFKPLFGQQRGTTHWMTFVKFELTGNGG"
FT   gene            590462..591250
FT                   /locus_tag="spyM18_0742"
FT   CDS_pept        590462..591250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0742"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match ref|NP_038314.1| ORF13
FT                   [Streptococcus thermophilus bacteriophage 7201]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97412"
FT                   /protein_id="AAL97412.1"
FT                   /translation="MLNLSLLEMGDSDVKCELYNDHFENAKRYNIPRAQLIIADIPYNL
FT                   GNNAYASDPRWYENGSNKNGESKLAGKSFFDTDNDFKINNFFDFCSRLLRKEPKEKGKA
FT                   PAMIVFHAWQQRELVIACGKKHGFNNAYPLYFTKKSSPQVLKANMKIVGAVEEATVLYR
FT                   DKLPKFNNGGAMILNHAPWEKDSSYPVIHPTQKPIPVLKRLIEIFTDPDDVVIDPVAGS
FT                   GSTIRAAIEMNRNAYGFEIKKDFYKRAKEEMLSTFQTSLF"
FT   gene            591298..592023
FT                   /locus_tag="spyM18_0743"
FT   CDS_pept        591298..592023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0743"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33874.1| (AE006543)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]."
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97413"
FT                   /protein_id="AAL97413.1"
FT                   /translation="MNTNEAKIGDKVWVEGIINSSFSNGGVHVNHAGVDAFYDLERTKI
FT                   KPDGYAGQSPKYLKNIIAKMRELPEHDRAVWIKGIFKEFGIENDISYYLGHKQGVLQAK
FT                   DSLKPEVPQYVADYIEKCKKRGDTLYLALKVEKSVKQSVYKWLWDGSGDESFIKFAKAW
FT                   IYGYTIEKEKLYTVEIPNPNREGRGHAKFVLERQGNKVFLVKRKSKDCYYNKNSNHLTE
FT                   SEIRKDFEWAWQFAKEVTE"
FT   gene            592466..592903
FT                   /locus_tag="spyM18_0744"
FT   CDS_pept        592466..592903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0744"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97414"
FT                   /protein_id="AAL97414.1"
FT                   /translation="MGNIPTTKANNFLEELKTIPHLIETLERDANLMSRSLVKSPQWSD
FT                   MKVSGGVKQSQEDKNIKMLHMVGYYSDQIEQLKDRRQEMANLIVQSMGICESHVLLTTY
FT                   LDCDGDYERARERLNIGNRNKYFMFVRRGKESLELILKNTN"
FT   gene            593486..594415
FT                   /locus_tag="spyM18_0745"
FT   CDS_pept        593486..594415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0745"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97415"
FT                   /protein_id="AAL97415.1"
FT                   /translation="MLKLDEKKIRKGKPVGLPYQGSKKKISKKIVEIIKQNFDADKPIY
FT                   DVFGGGGAITAECVLNGLEVHYNDLDNDITDMFQRVISQDREWIKTLIISRDEFNKIRQ
FT                   KEPKSVDDNLKLLVNSFGNELSSYLYGADWSDTKYDLAVEIINKHDVFSGYKQTETYKK
FT                   ADKPYDEGELEKNKKLTQLEQLQQLGRLQQLEQLQQLGRLQQLGRLEQLEPTNYSYEAF
FT                   SDIEDAIFYLDPPYENTTQKSYKGDFNSQAFYDWAFGMSKNNIVLISSYDISDERFECV
FT                   YEFKTARSTMQGGGAGKRTEKLFMAVIT"
FT   gene            complement(594542..594919)
FT                   /locus_tag="spyM18_0746"
FT   CDS_pept        complement(594542..594919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0746"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match pir||T13557 hypothetical protein
FT                   17 - Bacillus phage phi-105"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97416"
FT                   /protein_id="AAL97416.1"
FT                   /translation="MLIYPATFTQDTDYIMVTFPDVPEAITQGEDFQEAYEMAVEVLGF
FT                   ALEDYTDYPKACAVSDLKEQYPDSDIALIGIDMVAYMKKYHSKKVRKNVTIPEWLNDAA
FT                   EDKNLNFSQVLTEALELKLQA"
FT   gene            complement(594971..595156)
FT                   /locus_tag="spyM18_0747"
FT   CDS_pept        complement(594971..595156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0747"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97417"
FT                   /protein_id="AAL97417.1"
FT                   /translation="MPMTPKQMIKLLKKNGFYEVSQNGSHKKFRDNNGHQTIVPMHNKD
FT                   LGKGLEDTILKQAGLK"
FT   gene            595392..595730
FT                   /locus_tag="spyM18_0748"
FT   CDS_pept        595392..595730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0748"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match ref|NP_061626.1| phi PVL ORF 63
FT                   homologue [Staphylococcus aureus prophage phiPV83]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97418"
FT                   /protein_id="AAL97418.1"
FT                   /translation="MRPQKLTIAGGRRTTVDYDDRSAEYRDYNRNRWKYDKQAKQFYNS
FT                   RIWRETSKQVLLQNDYICAMCGGEATMTDHIVSVKQDWNKRLDWNNLQASCKACNDSKA
FT                   IRERRKNN"
FT   gene            595901..596368
FT                   /locus_tag="spyM18_0749"
FT   CDS_pept        595901..596368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0749"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63681.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97419"
FT                   /protein_id="AAL97419.1"
FT                   /translation="MGRNLKLVETTKKHLTKEEKIVRETAQNKASDGLKKLQKTPPEHF
FT                   NNVAKYEYRRIIEDLQNLPLRNLDRGLLELYCTWYAIYKETSRKLDEVGYFTNDPDKGI
FT                   IPSPLILTLEKATANIRSSASQLGLTVDSRMKMFIPKEEEKPKSIFDKFGG"
FT   gene            596371..596601
FT                   /locus_tag="spyM18_0750"
FT   CDS_pept        596371..596601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0750"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97420"
FT                   /protein_id="AAL97420.1"
FT                   /translation="MERVKEFSVKLLENGKFPIVEINGEKINGITKLIVKYDSDDAQNN
FT                   PLDNGFLVEYISEEGGRYYMQTIGQSFRIGL"
FT   gene            596611..598359
FT                   /locus_tag="spyM18_0751"
FT   CDS_pept        596611..598359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0751"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63682.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97421"
FT                   /protein_id="AAL97421.1"
FT                   /translation="MEYDYSAISDIYKDDAFYYAKMVVDEQIKSSKKVFRACLRHLNDL
FT                   KKIDGDNFKFIYLPEKAADPINFIEILPDVKTGKPYPLAMFQKFIIGNLYGWRKKTDHS
FT                   LRRFRKAMISVARKNGKTILIAGILLYEFLFGHNPSMSRQLFCTANDRTQAKIAWDMAK
FT                   KQLSSLRAKDADVRKATKIVRDELKNLHDESYIRALSRDTGAVDGFEPYVGVLDEFAAS
FT                   KTNEMLELLESGQGQLDNPFILIISTAGMDLNVPMHTIEYPYITKILDGEITDEGYFGY
FT                   VAEQDNEEEIKDESNWIKSNPILEVEALHDKLMDYLRTRRRVSLETGEINKVLIKNFNM
FT                   WRQSSEESYIDKTTWELARIDKPDTNKRRVWLGVDVGRVSDLFAITPVVMMDDFWYIDS
FT                   FSFVATKYGLTAKEKRDGVSYSNLECQGYCEITTLESGVIDDERVLEKIEEMVYSNDWE
FT                   INGICFDPYQFGTLLTMIEKRHPEWPLIEVSQTTMVLNMPTKQFRDDLKKGKIKHSGNP
FT                   LLTMAINNAYIKTDNNGMRIDKNKNSNKIDPLDAALDGYAVCYLEPFDGSGYWTNEKII
FT                   GGESLF"
FT   gene            598356..598526
FT                   /locus_tag="spyM18_0752"
FT   CDS_pept        598356..598526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0752"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97422"
FT                   /protein_id="AAL97422.1"
FT                   /translation="MIDFILKNIHTLILLAGLGLLMYGLFLFGDKVGFIASGLILIVLA
FT                   IYVDSVGGKRE"
FT   gene            598519..598743
FT                   /locus_tag="spyM18_0753"
FT   CDS_pept        598519..598743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0753"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33644.1| (AE006521)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97423"
FT                   /protein_id="AAL97423.1"
FT                   /translation="MNKRIKKKRKLETAIVLLIKEVAELRSIVSANAKATNNELAAVKS
FT                   AILDNQVAIKSIGDEVGHIKQNYKRKWRK"
FT   gene            598777..599997
FT                   /locus_tag="spyM18_0754"
FT   CDS_pept        598777..599997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0754"
FT                   /product="OrfH-like protein"
FT                   /note="best blastp match emb|CAB63683.1| (AJ251790) ORFH
FT                   [Lactobacillus casei bacteriophage A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97424"
FT                   /protein_id="AAL97424.1"
FT                   /translation="MSFFRPLGSSKVSYDDYISSVLAGDVSQKYLGVSALKNSDILTAT
FT                   SIIAGDIARFPLVKKDVNGDIIHDEDINYLLNVKSTKNASARTWKFAMAVNAILTGNSF
FT                   SRILRDPKTNQALQFQFYRPSETTVEETDSHEIIYTFTDTLTAKQVKCFAHDVVHWKFF
FT                   SHDTILGRSPLLSLGDEIDLQTGGINTLIKFFKDGFSSGILTMKGAQLSGDARQRARQE
FT                   FEKMREGSVGGSPLVFDSTMEYTPLEIDTNVLQLITSNNFSTAQIAKALRVPSYKLGVN
FT                   SPNQSVAQLMEDYVTNDLPFYFDAITSELGLKTLNDKDRRLYRIEFDTRSVTGRNVDEI
FT                   VKLVNNQILTPNQGLIELGKQKSTDPNMDRYQSSLNYVFLDKKEEYQDKVGIKGKGGEV
FT                   NAKEDKS"
FT   gene            599975..600640
FT                   /locus_tag="spyM18_0755"
FT   CDS_pept        599975..600640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0755"
FT                   /product="putative ClpP protease"
FT                   /note="best blastp match ref|NP_050150.1| ClpP-like
FT                   protease; hypothetical protein [Lactobacillus bacteriophage
FT                   phi adh]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0755"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97425"
FT                   /protein_id="AAL97425.1"
FT                   /translation="MPKRINLKGPLIANNSQEVYDYYGMEATSAKSIINQLPEDSSDII
FT                   LEVNSNGGLVTVGSEVYTALRNYKGKVTAEITGMAASAASVAVMGADKVVMSPTAQMMV
FT                   HKALFNWVAGNSDDLDKASNALKSSDKAIVNAYVAKTGLSEDEIMNLMRNETFMSAQDA
FT                   VEKGFADEVMSFEAVASIDNQMLPQAVIDDYYANRSKRKQEISNMLLEIEKEEILQGL"
FT   gene            600665..601852
FT                   /locus_tag="spyM18_0756"
FT   CDS_pept        600665..601852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0756"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63685.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97426"
FT                   /protein_id="AAL97426.1"
FT                   /translation="MFEEKIKEIKATIASLNQAIATKTAEVKNALESDDLETARSIKAE
FT                   VEQAKADLVEAENDLKLYEASIEKGGAENTGGKEVPQETKTYRESVNEFIRSKGTVTNE
FT                   ALRFEGKDEVLIPLNQTTPIDPKTDGVKKTDVKPVSSEEILYTPAREVKTVVDLKQFTS
FT                   IHPAKKASGKWPVLQCATEKMVSVEELEKNPKLAKPKFKDVEWKVETYRGAIPLSQESI
FT                   DDADVDLVGIVAETIGQMKVNTTNDAIAKVLKTFEPKADVKTLDEIKKILNVDLDPAYN
FT                   VSFIVSQSFYQSMDTLKDENGRYLLQDSITSVTGKVFLGKPVFVLADEVLGKNKAFVGD
FT                   FKRGVLFADRKDLGLRWVDNDIYGQYLQAVLRFGVAKVDDKAGYYVTFTPEQLPS"
FT   gene            601866..601994
FT                   /locus_tag="spyM18_0757"
FT   CDS_pept        601866..601994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0757"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97427"
FT                   /protein_id="AAL97427.1"
FT                   /translation="MAKPTSKSTVEEIKRYLTSKGIDFSGKTLKSDLLALAGVEEV"
FT   gene            601997..602299
FT                   /locus_tag="spyM18_0758"
FT   CDS_pept        601997..602299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0758"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97428"
FT                   /protein_id="AAL97428.1"
FT                   /translation="MAVSKELLDSVKLYCKIDFDFEDDIIKEMIESAQEQICFAIEEGS
FT                   TAGTFKESAKFALAVKKQVKEEYDHRGLSADSFRYPLANGVLNIIHQLRLRGDDS"
FT   gene            602296..602643
FT                   /locus_tag="spyM18_0759"
FT   CDS_pept        602296..602643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0759"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97429"
FT                   /protein_id="AAL97429.1"
FT                   /translation="MITRKMNVRITIFSQSGGQNEDGEVVSAIRKDLYTCWAEVLKTQL
FT                   RDFNYQSKFQNASNLPTNKDTKVFLIRYNPELSIDNTMFVEFDKRIYKIDKIESDESGK
FT                   DMIMISGVSMS"
FT   gene            602640..603017
FT                   /locus_tag="spyM18_0760"
FT   CDS_pept        602640..603017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0760"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63687.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97430"
FT                   /protein_id="AAL97430.1"
FT                   /translation="MTKGLDEILANLTKLEVKASKTAKAAVTKVAKEFEKTLKSNTPVY
FT                   EIETDERLQEDTVISGFKGSNVGIVSKEIGYGKATGWRAHYPNDGTIYQRGQDFKERTI
FT                   NQMTPRGRQIYAEKVKEGLGL"
FT   gene            603014..603439
FT                   /locus_tag="spyM18_0761"
FT   CDS_pept        603014..603439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0761"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0761"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97431"
FT                   /protein_id="AAL97431.1"
FT                   /translation="MIAETAAYKLLSNDKTLNELLDRLRGGTFKNGFKQGIFTYDIPDN
FT                   PVNLRKVELAPFMRINTTLDGPFDYADDEILCNEQRITINFWCKTASEADQINKCIDNI
FT                   LKQGGFERYTANEKPRYKDRDIDLLMNVRKYRYFDFY"
FT   gene            603455..604063
FT                   /locus_tag="spyM18_0762"
FT   CDS_pept        603455..604063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0762"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63689.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0762"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97432"
FT                   /protein_id="AAL97432.1"
FT                   /translation="MGKVKFGLRDFYYGVLDGNDKVTKAESIKHLPGMKSAKLDITNEL
FT                   VTVPADDGPYVVLSGGISETKLEIELLDLTSDARKDFFGITVEKGVEKYNKNLTPNDIV
FT                   CLFRTSDENGKAIWIALLKGKFNLPGMEAQTKEGAPDPKPDTTTGNFVARGPKEEVLLV
FT                   GREGNSGFNLNEFLKCVFAGCGDAEIKKIPIAEQASTVM"
FT   gene            604116..604442
FT                   /locus_tag="spyM18_0763"
FT   CDS_pept        604116..604442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0763"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0763"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97433"
FT                   /protein_id="AAL97433.1"
FT                   /translation="MYEITLKKGGVDKEFKKDFINVEDNLLAVEHQVRQSAVFSDEKRR
FT                   LDSKAHRKLNESYLQMFVDMYAGQFTVDDLKQSDMTVLNTLNDLYIAALGGEQEEDESE
FT                   KKEQ"
FT   gene            604472..604639
FT                   /locus_tag="spyM18_0764"
FT   CDS_pept        604472..604639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0764"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0764"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97434"
FT                   /protein_id="AAL97434.1"
FT                   /translation="MWIQSLLKNGYTILDIKKMRLSDIELMVQALEIETVEKEEVIETT
FT                   LDKAFPFLFG"
FT   gene            604652..608575
FT                   /locus_tag="spyM18_0765"
FT   CDS_pept        604652..608575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0765"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match emb|CAB63691.1| (AJ251790)
FT                   hypothetical protein [Lactobacillus casei bacteriophage
FT                   A2]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0765"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97435"
FT                   /protein_id="AAL97435.1"
FT                   /translation="MGNIGDLVATATLDISPFMSNTRNLKTYMKGLDNSLKAVEKSFQG
FT                   HGGRIKGLKAVYAETGSALKGYQELLKTQSQKYSDLKKEIGDVNNATAEQKQKLIGAKS
FT                   AMLETAAQVAELQNRLRALATETSVFTRFGKAAERIGGKMKSFGDSVAGVGAAFTRGVT
FT                   APIVAGAGYAIKAAVDYESAFAGVKKTVDETATVSYAKLSQGIRQMAKELPASAVEIAH
FT                   VAEAAGQLGVKTGDILSFSRTMIDLGESTNLSAEEAATSIAKIANITGLASSEYSRFGS
FT                   AVVALGNNFATTERDIVAMTNRIAASGKLAGLTNQEMLALATAMSSVGIEAEAGGTAMT
FT                   QSLSAIERAVASGGDNLNKFAQIANMSSADFARAWKEKPIVALQEFIKGLGQLDKKGES
FT                   ATKVLDELGLSGIRQSNMLKSLGLASETLGKALGISNKAWKENTALTDEANKRYETTES
FT                   KLKMLKNEVNDVAIEFGGPLVDALRNGLEAGKPIIQMAADLAKQFNSLDKEQQQQIIKW
FT                   GLIAAAAGPALSILGKGIGVIGGTIQAIGKMSKGIGALSGWLRTFKAGAVAASVGAEAA
FT                   TASMGSLTGAVALLSNPVTWGVLLGGAAVIGIGLIADSMYKAQKRTEEWGTAVSATEAT
FT                   ALSNFKKKVDETNTSLQMFEAGAGSVKKVTEAFDDLVGSIEKLAQSKLDKNINLAKKLG
FT                   LSEETINALKSKTESVVNNVKSMNTQIKAIMEKHNGDMSQLSSAEKELVLRNQREMIIA
FT                   QLDLMKFSASEKKALTAALNNELDALNARQLEKVSENTVKMLDKENSAYKTKKAELKEI
FT                   LKQFGSDTSKLSAEELAARQEVLNRLTELNMQHNLKTKALNDQYLAIQRERVQRLKESG
FT                   KSQEEIHRGISQMASDMAQKLGISYDDAYRKMAYYTEKSGETLKVLSRNTANATAEVAA
FT                   ANAQWDSLFTSDNPQQSLNELLSTAEGWNSFEIMVKNADVEPTGRAALAEMLVAGGQWQ
FT                   NMTLEQKKLVVDGQQAMIEIFDSKELLAQWQVLTPEEKVLLAKNLTQEPTMSAQQALDS
FT                   VKQTVPADVNATDKTAGDTQSAQSKIDNVKQKAPADVKASDKTGPDVASANRAVNSPKQ
FT                   NSPAVIRAQDNASGVAENVIWSLARIPRSVTTTITTFVRKIFGHEKGTDFHPGGLAVVN
FT                   DQKGALYRELVTLPTGESFIPTGRNVILPLPRGSKVLKASRTKQLFPHYANGIGFDDTR
FT                   IASLTTRLKSVQDKGTVVVNADPQLAELIKLLKDRDDRNVTNNYTLNATNSSSSEDMFS
FT                   QENMRRLVRELAYYTKGEEGRLA"
FT   gene            608575..609318
FT                   /locus_tag="spyM18_0766"
FT   CDS_pept        608575..609318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0766"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33655.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0766"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97436"
FT                   /protein_id="AAL97436.1"
FT                   /translation="MRYIEFNGTKSNDLGLLLERERSIKSTNNDVDLIEVAGRDGVLIK
FT                   DNERLKAVEQDFPFSLVGDVTANQQKISEWLHVKGWHDLALSWDKDYIYRASVVNLFEI
FT                   DEILKQFGRLKINFLIHPIKYLKTGKQEVSLVNGSTLQNPGNVQAKPILKIKGIGNGVL
FT                   TINGFKTGLENVQGELVIDMERHLVYKDVLSAWDNIVRTERHRFCMSLRKPSLGLLVSV
FT                   RLRMLMRLKPLVSAMVITHCTSNIR"
FT   gene            609349..611325
FT                   /locus_tag="spyM18_0769"
FT   CDS_pept        609349..611325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0769"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33656.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0769"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97437"
FT                   /protein_id="AAL97437.1"
FT                   /translation="MKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIAL
FT                   KPFVNGASVGAESALEIWKENLVGDDTFDVKSDILTLGSFNWEIDKIGNARGALGGVAG
FT                   SILDVYGGEYEFDNRTIILRKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRY
FT                   TPQPKPQEEAPGKPHVGEHKQPEEQLVTLPEFILDGQYLSLYAQRRIQMVDLSSHFNDD
FT                   KNKKEPTIEEIRKLAQKYLKDNNVGAPKVSIEVDYIDLSQTLDYQDFRVMEEVELCDIV
FT                   PLYYPKFGITTESEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVSERINALENNQ
FT                   KVITNNQKQFELNLPKYLNDINGKRVWYEKPDDNIEHKIGDYWFEKNGKYQRTWIWDGH
FT                   QWVKVLDTEDLNPNQRAFDEAMAEIEKAKKAQEEINQRTDKELEEFRATLKNLALPEEA
FT                   IKKITEAIKVDDIPSIKQSFDDLKNKVSETSETSRLNAEILGNNGKTRYNKNLLVGDPN
FT                   RTKTYDEDYIEVEANDGGFKRGETYTISFSQTCELLQKVAITLTQANNKGVKLVLTPTK
FT                   AKTDAQTFEVTKDKQSIEVYPLSYTGVLTGDWYKPKQIDLNASDTQELALEMAYKEVVD
FT                   GKDAAITGIWSDSPQIILDGGKK"
FT   gene            611322..612332
FT                   /gene="hylP"
FT                   /locus_tag="spyM18_0770"
FT   CDS_pept        611322..612332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylP"
FT                   /locus_tag="spyM18_0770"
FT                   /product="hyaluronidase-phage associated"
FT                   /note="best blastp match gb|AAK33900.1| (AE006545)
FT                   hyaluronidase - phage associated [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0770"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97438"
FT                   /protein_id="AAL97438.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWTRSDVILLESEIGFETDTGYAKFGDG
FT                   KNQFSKLKYLNKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESKIELDKKLNLKG
FT                   GVMTGQLQFKPNKSGIKPSSSVGGAINIDMSKSEGAGVVVYSNNDTSDGPLMSLRTGKE
FT                   TFNQSALFVDYSGKTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQIRGVEKALGTLK
FT                   ITHENPNVEANYDENAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLGDD
FT                   KFYVKHDGGFYAKKTSQIDGNLKLKNPTADDHAATKAYVDSEVKKLKALLMDKQV"
FT   gene            612345..614231
FT                   /locus_tag="spyM18_0771"
FT   CDS_pept        612345..614231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0771"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33658.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0771"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97439"
FT                   /protein_id="AAL97439.1"
FT                   /translation="MSRDPTLTLDESNLVIGKDGRVHYTFTAEDDNPKVRLASKCLGTA
FT                   HFNQLMIERGDQATSYVAPVVVEGTGNPTGLFKDLKEISLELTDTANSQLWSKIKLTNR
FT                   GMLQEYYDGKIKTEIVNSARGVATRISEDTDKKLALINDTIDGIRREYRDADRRLSSSY
FT                   QSGINGLKAQLANDKIGLQAEIQATAQGLSQKYDNELRQLSAKITTTSSGTTEAYESKL
FT                   AGLRAEFTRSNQGMRIELESQISGLRAVQQSTTSQISQEIRDRTGAVSRVQQDLESYQR
FT                   RLQDAEDNYSSLTHTVRGLQSDVGSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGD
FT                   SIKLAIQKAGGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTFTTKIAEAI
FT                   KIRADQIIAGTIDAARIRVINLNASSIVGLDANFIKAKIGYAITDLLEGKVIKARNGAM
FT                   LIDLSSAKMDFNSNATINFNSRDNALVRRDDTHTAFVHFSNATPKGYTGSALYASIGIT
FT                   SSGDGVNSASSGRFAGMRCFRHATGYNHTAAVDQTEIYGDSVLIADDFSINRGFKFRPD
FT                   KMTKVLDMNDLYAAVVALGRCWKHLANVGWNTVHGNFTNAVTNELNNHINKI"
FT   gene            complement(614218..614742)
FT                   /locus_tag="spyM18_0773"
FT   CDS_pept        complement(614218..614742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0773"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0773"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97440"
FT                   /protein_id="AAL97440.1"
FT                   /translation="MCACDCSCAVKLWVFSCHFPISHGYSPLLSSNCSKMLSIRMISDD
FT                   VNSSSHSSKKFKKSINRLEYSPPLITISSSASSLSRSLSSSSLAGSASLMFLCSSMTNL
FT                   SSLSLAAYISIKSVSSFAYSLILSTTLASSLARPRLARILVILILSSTRYSVLSSLFFN
FT                   VKSIVSPIKFC"
FT   gene            614674..615291
FT                   /locus_tag="spyM18_0774"
FT   CDS_pept        614674..615291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0774"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33660.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0774"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97441"
FT                   /protein_id="AAL97441.1"
FT                   /translation="MRNWKVTGKYPQFDSTGAVASTHIIITAEDGSVISQLVKQDLIST
FT                   NDTEIIKATLEEFKKSEYVEIAMGEAVQKVDDLEKISQETAKTAKTAQTAAGLAKVSAE
FT                   RTQKMINLQTIHMLMSGGKIDSDIYKGMLELIEPAKKGEYQAYDVFTVVDSTKEEDGEA
FT                   GEGNLVFVHVNEAFEYDKQTLEELESEAKVTVIKYADLVKQD"
FT   gene            615301..615576
FT                   /locus_tag="spyM18_0775"
FT   CDS_pept        615301..615576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0775"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK33661.1| (AE006522)
FT                   hypothetical protein, phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0775"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97442"
FT                   /protein_id="AAL97442.1"
FT                   /translation="MATELIFGVGGFILAIVTTYNIFNAKSIKHATDITLLQSEVEHLK
FT                   IVTRQNARRLEEHAEQNKTLITMTEQIKNLTDDVKDLKDMMRGEIK"
FT   gene            615573..615800
FT                   /locus_tag="spyM18_0776"
FT   CDS_pept        615573..615800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0776"
FT                   /product="putative holin"
FT                   /note="best blastp match gb|AAK33662.1| (AE006522) putative
FT                   holin, phage associated [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0776"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97443"
FT                   /protein_id="AAL97443.1"
FT                   /translation="MINLKLRLQNKVTLMAILGAIFLLAQQLGIKLPSNIADIANTAVT
FT                   LLVLLGVVTDPTTKGLSDSEQALTYHEPKK"
FT   gene            615916..617121
FT                   /locus_tag="spyM18_0777"
FT   CDS_pept        615916..617121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0777"
FT                   /product="hypothetical phage protein"
FT                   /note="best blastp match gb|AAK34243.1| (AE006580)
FT                   hypothetical protein - phage associated [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0777"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97444"
FT                   /protein_id="AAL97444.1"
FT                   /translation="MTFLDKIKQGCLDGWAKYKILPSLTAAQAILESGWGKHAPHNALF
FT                   GIKADASWTGKSFNTKTQEEYQAGVITDIVDRFRAYDSWDESIADHGQFLVDNPRYQSV
FT                   IGEADYKKACHAIKDAGYATASGYAELLIQIIEENNLQKWDKEAIVRKEKQMINSQCRE
FT                   VIEFFINLANAGMGVDKDSFAGWQCADVPCYAAKHWFDVDLWGNAIDLLDSAAAVGWEV
FT                   HRMPTDANPLTGAFFVQSVPYHQFGHTGIVIEDSDGYTMRTVEQNIDGNPDALYVGAPA
FT                   RFNTRDFTGVIGWFYPPYQGDTVTQPVSTEPQTSETIVETAKTGTFTLDVAEINIRRWP
FT                   SLASEVVGSYKQGDTVSFDNEGYANGYYWISYVGGSGMRNYLGIGQTDKDGNRISLWGK
FT                   LN"
FT   gene            complement(617189..617896)
FT                   /gene="speC"
FT                   /locus_tag="spyM18_0778"
FT   CDS_pept        complement(617189..617896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="spyM18_0778"
FT                   /product="exotoxin C precursor"
FT                   /note="best blastp match pir||A30509 exotoxin C precursor -
FT                   Streptococcus pyogenes"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0778"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97445"
FT                   /db_xref="GOA:Q8NKX2"
FT                   /db_xref="InterPro:IPR006123"
FT                   /db_xref="InterPro:IPR006126"
FT                   /db_xref="InterPro:IPR006173"
FT                   /db_xref="InterPro:IPR006177"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="InterPro:IPR013307"
FT                   /db_xref="InterPro:IPR016091"
FT                   /db_xref="PDB:1AN8"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1KTK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NKX2"
FT                   /protein_id="AAL97445.1"
FT                   /translation="MKKINIIKIVFIITVILISTISPIIKSDSKKDISNVKSDLLYAYT
FT                   ITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYI
FT                   LNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKI
FT                   RKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIIN
FT                   MKNFSHFDIYLEK"
FT   gene            complement(618007..618765)
FT                   /gene="MF2"
FT                   /locus_tag="spyM18_0779"
FT   CDS_pept        complement(618007..618765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MF2"
FT                   /locus_tag="spyM18_0779"
FT                   /product="MF2"
FT                   /note="best blastp match gb|AAK33665.1| (AE006523) putative
FT                   DNase (similar to mitogenic factor), phage associated
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0779"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97446"
FT                   /protein_id="AAL97446.1"
FT                   /translation="MKLSKQKASLLTAVLLLLSLSITTITVDAARVRTYPNVSHANTHY
FT                   KNTVSSKLLPFTANYQLQLGELDNLNRATFSHIQLQDRHETKDVRTKINYDPVGWHNYQ
FT                   FPYGDGSKSSWVMNRGHLVGYQFCGLNDEPRNLVAMTAWLNTGAYSGANDSNPEGMLYY
FT                   ENRLDSWLALHPDFWLDYKVTPIYSGNEVVPRQIELQYVGIDSSGELLTIRLNSNKESI
FT                   DENGVTTVILENSAPNINLDYLNGTATPKN"
FT   gene            619077..620495
FT                   /locus_tag="spyM18_0780"
FT   CDS_pept        619077..620495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0780"
FT                   /product="putative dipeptidase"
FT                   /note="best blastp match gb|AAK33666.1| (AE006523) putative
FT                   dipeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0780"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97447"
FT                   /db_xref="GOA:Q8P1N3"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1N3"
FT                   /protein_id="AAL97447.1"
FT                   /translation="MDKKIQRFSCTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIV
FT                   VKPEDQPRHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVTMSATETI
FT                   TTNSRVLGADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSD
FT                   EHDIWWLETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLCSADLKDFIDTYH
FT                   LDLTYSHEHFNPRYAFGSQRDKDRHYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYR
FT                   KITVEDVKYVLSSHYQDTGYDPYGSEGTPVSKKVFRPIGINRTSQTAILHIRPNKPQEI
FT                   AAIQWIAYGSMPFNTMVPFFTQVKTIPDYFANTYENVSTDNFYWTNRLIAALADPHYNH
FT                   HETDLDNYLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILF
FT                   DASNLMTNRFSLSD"
FT   misc_feature    619102..619123
FT                   /locus_tag="spyM18_0780"
FT                   /note="phi SpeC attR"
FT   gene            620647..622194
FT                   /locus_tag="spyM18_0781"
FT   CDS_pept        620647..622194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0781"
FT                   /product="putative adhesion protein"
FT                   /note="best blastp match gb|AAK33667.1| (AE006523) putative
FT                   adhesion protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0781"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97448"
FT                   /db_xref="GOA:Q8P1N2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1N2"
FT                   /protein_id="AAL97448.1"
FT                   /translation="MKKKILLMMSLISVFFAWQLTQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGVIGNDGDVSMLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWVSDVKKSLTS
FT                   KKVTIVKGTGNMLLVAGAGHDHHHEDADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASSKVAKTLAKEAG
FT                   VKAAVLSPLEGLTKKEMKAGQDYFTVMRKNLETLRLTTDVAGKEILPEKDTTKTVYNGY
FT                   FKDKEVKDRQLSDWSGSWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQIKINGKKKTMTFVRNGEKKTFTYTYAGKEILTYPKGNRGVRFMFEAKEPNAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   gene            622345..623067
FT                   /locus_tag="spyM18_0783"
FT   CDS_pept        622345..623067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0783"
FT                   /product="putative transcriptional regulator"
FT                   /note="best blastp match gb|AAK33668.1| (AE006523) putative
FT                   transcriptional regulator regulator (GntR family)
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0783"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97449"
FT                   /protein_id="AAL97449.1"
FT                   /translation="MPKEQPLYLQIVDDLEVKIKKSMTANDKLLSERELSDLYGVSRIT
FT                   IRLALKELELRGLIYKKQGKGTYVSGIKEPATDLSSTYSFTEQMKKMGKMPKTEILSFE
FT                   QYQVTPYLSGLLEIDVDTDVFELERLRIADDMPLMFERSYIPAQPFQGLSIADLKRKAL
FT                   YDIFAKDYQETIRLAEEEFYASIALDYEAGLLGIKKGDPVLHIIRKTYDDKNILIELTF
FT                   SIARADQFRYRVQHHPNG"
FT   gene            623087..624286
FT                   /gene="agaS"
FT                   /locus_tag="spyM18_0784"
FT   CDS_pept        623087..624286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="spyM18_0784"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /note="best blastp match gb|AAK33669.1| (AE006523) putative
FT                   tagatose-6-phosphate aldose/ketose isomerase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0784"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97450"
FT                   /protein_id="AAL97450.1"
FT                   /translation="MFTKSQEALEALGAAITTKEIKQQPALWQETMTSFDITKEALVSF
FT                   LKAVYESANGNRVRVIFTGAGTSEYVGNTICPYLNKVGNRQRYFFDSIASTDLVAAPEY
FT                   YLAEEETVLLVSFARSGNSPESVAAVNLINQLVPNSYHLIITCAKDGELAKKAQQDDHS
FT                   FLYLMPEAANDAGFAMTGSFTCMMLAALLIFDDATDLSQKQSYVADMVFAGQAILDQEE
FT                   RLQELADLGFERLVYLGSASLANLTQEAQLKMLELTAGQVATVYESSMGFRHGPKSFIN
FT                   DRTLVIGFVNNDAYVRQYDLDMLEEIQADGIALKILALLQGGDINFSEDQFRLDTRHLL
FT                   PEAYLAFPMILVAQTLALLTAVALGNSPDTPSATGTVNRVVKGVMIHPYPTSSRQCNKA
FT                   "
FT   gene            complement(624383..624643)
FT                   /gene="rl31"
FT                   /locus_tag="spyM18_0785"
FT   CDS_pept        complement(624383..624643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl31"
FT                   /locus_tag="spyM18_0785"
FT                   /product="50S ribosomal protein L31"
FT                   /note="best blastp match gb|AAK33670.1| (AE006523) 50S
FT                   ribosomal protein L31 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0785"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97451"
FT                   /db_xref="GOA:P66204"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66204"
FT                   /protein_id="AAL97451.1"
FT                   /translation="MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLI
FT                   RVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLKDANAAK"
FT   gene            complement(624758..625699)
FT                   /locus_tag="spyM18_0787"
FT   CDS_pept        complement(624758..625699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0787"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33671.1| (AE006523)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0787"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97452"
FT                   /protein_id="AAL97452.1"
FT                   /translation="MITTFETILDKIKAHQTIIIHRHQNPDPDALGSQAGLKEIIAQNF
FT                   PDKKVLMTGFDEPSLAWISQMDQVTDKDYKEALVIITDTANRPRIDDERYTLGQCLIKI
FT                   DHHPNDDVYGDFYYVDTSASSASEIIADFAFSQNLTLSDKAAKLLYTGIVGDTGRFLYA
FT                   STTSKTLSIASQLRHFEFDFAAISRQMDSFPLKIAKLQSYVFEHLTIDESGAAYVLVSQ
FT                   ETLKHFDVTLAESSAIVCAPGKIDNVQAWAIFVELTDGNYRVRMRSKEKIINGIAKRHG
FT                   GGGHPLASGANSASLEENQAIFRELIAVCQEI"
FT   gene            626093..626542
FT                   /gene="flaV"
FT                   /locus_tag="spyM18_0788"
FT   CDS_pept        626093..626542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaV"
FT                   /locus_tag="spyM18_0788"
FT                   /product="putative flavodoxin"
FT                   /note="best blastp match gb|AAK33672.1| (AE006524) putative
FT                   flavodoxin [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0788"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97453"
FT                   /protein_id="AAL97453.1"
FT                   /translation="MALAKIVYASMTGNTEEIADIVANKLQELGHDVDIDECTTVDASE
FT                   FENADIAVVATYTYGDGDLPDEIVDFYEDLQDLDLEGKIYGVVGSGDTFYDYFCKSVDD
FT                   FSEQFALTGAIKGAEPVKVDLAAEDEDIDRLEAFAEQLSQAVNNL"
FT   gene            626718..627002
FT                   /gene="cm"
FT                   /locus_tag="spyM18_0789"
FT   CDS_pept        626718..627002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cm"
FT                   /locus_tag="spyM18_0789"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33673.1| (AE006524)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0789"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97454"
FT                   /protein_id="AAL97454.1"
FT                   /translation="MRLEEIRQEINGIDHHLVALLEKRMALVEQVTAYKLANHLPVLDQ
FT                   ARENQILDRVSYLVKDQAFEPAIHETFKTIMSLSRQYQTQHLTGGDTND"
FT   gene            626995..628257
FT                   /locus_tag="spyM18_0790"
FT   CDS_pept        626995..628257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0790"
FT                   /product="putative transmembrane protein"
FT                   /note="best blastp match gb|AAK33674.1| (AE006524) putative
FT                   transposase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0790"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97455"
FT                   /protein_id="AAL97455.1"
FT                   /translation="MIKSIATLPKPSLKEALGLIGLALPIGVVVGVVDVIFGKGLLFLS
FT                   EYRDHHLFLLLPFLALAGLVIVFLYDKLGKEVRQGMGLVFQVGHGQKDQIPPILIPLIL
FT                   FSTWVTHLFGASAGREGVAVQIGATISHYCRRFVTSQEAARHLLIMGMAAGFAGLFQTP
FT                   IAAVVFALEVLLVGTLRYCALLPSLVAACVASWTSHSLGLEKFTIVLEETLTITPLTLV
FT                   KLIGLGLIFGLVGNSFACLLGWFKPYLSQKLPNPYLRIAFIGVLLSICLMIGHVGRYSG
FT                   LGTHLIAAAFSGQTILTYDWLLKMIVTVISLSAGFQGGEVTPLFTIGASLGIILAPYLG
FT                   LPVLLVAALGYATVFGSATNTFWAPIFIGIEVFGPENALAYFVTSAAAYMVSHRHSIYS
FT                   YQKVVMINLKDMTVNQMDLKK"
FT   gene            628372..628719
FT                   /gene="rpl19"
FT                   /locus_tag="spyM18_0791"
FT   CDS_pept        628372..628719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl19"
FT                   /locus_tag="spyM18_0791"
FT                   /product="50S ribosomal protein L19"
FT                   /note="best blastp match sp|P58169|RL19_STRPY 50S RIBOSOMAL
FT                   PROTEIN L19"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0791"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97456"
FT                   /db_xref="GOA:P66086"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66086"
FT                   /protein_id="AAL97456.1"
FT                   /translation="MNPLIQSLTEGQLRSDIPNFRPGDTVRVHAKVVEGTRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGIGVERTFPIHTPRVDKIEVIRHGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   gene            complement(630182..630556)
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0792"
FT   CDS_pept        complement(630182..630556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0792"
FT                   /product="putative transposase fragment-IS1239"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0792"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97457"
FT                   /protein_id="AAL97457.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYY"
FT   gene            630738..631298
FT                   /locus_tag="spyM18_0794"
FT   CDS_pept        630738..631298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0794"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33676.1| (AE006524)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0794"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97458"
FT                   /protein_id="AAL97458.1"
FT                   /translation="MNYQDYIWDLGGTLLDNYELSTQAFVQTLAFFSLPGDHDAVYQKL
FT                   KESTAIAVATFAPNEPEFLHVYRLREADKLAQPIWCLGAKEILEKIATSGSRNFLISHR
FT                   DCQVNQLLEQAGLLIYFTEVVTASNGFARKPNPESLFYLKEKYDIDSGLVIGDRLIDKQ
FT                   AGQAAGFNTLLVDGRKNLLEIVT"
FT   gene            631299..633251
FT                   /gene="gryB"
FT                   /locus_tag="spyM18_0795"
FT   CDS_pept        631299..633251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gryB"
FT                   /locus_tag="spyM18_0795"
FT                   /product="putative DNA gyrase, subunit B"
FT                   /note="best blastp match gb|AAK33677.1| (AE006524) putative
FT                   DNA gyrase, subunit B [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0795"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97459"
FT                   /db_xref="GOA:Q8P1M4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1M4"
FT                   /protein_id="AAL97459.1"
FT                   /translation="MIEENKHFEKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGL
FT                   HHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVF
FT                   TVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADL
FT                   EIIGTTDVTGTTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGME
FT                   QEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELEGIAVEVAMQYTTSYQETVMSFA
FT                   NNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPN
FT                   PQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRA
FT                   REVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIR
FT                   GKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIR
FT                   TLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSI
FT                   GRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPR
FT                   RDFIEENAVYSTLDI"
FT   gene            633619..635343
FT                   /locus_tag="spyM18_0796"
FT   CDS_pept        633619..635343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0796"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33678.1| (AE006524)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0796"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97460"
FT                   /db_xref="GOA:Q8P1M3"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1M3"
FT                   /protein_id="AAL97460.1"
FT                   /translation="MSSGIILLIVAIVLLVIIAYLVGVIIRKRNDSLITSLEERKQALF
FT                   ALPVNDEIEEVKSLHLIGQSQTSFREWNQKWVDLTVNSFADIENHIFEAENLNDTFNFI
FT                   RAKHEINSVESQLNLVEEDIASIREALNILKEQEEKNSARVTHALDLYEKLQASISENE
FT                   DNFGSTMPEIDKQMKNIETEFSQFVALNSSGDPVEASEVLDRAEEHTIALGQITEQIPA
FT                   IVAKLEDDFPDQLDDLETGYRRLLEENYHFPEKNIEARFQEIRESIRANSSELVTLDLD
FT                   RAREENTHIQERIDSLYEVFEREIAAYKVAAKNSKMLPRYLAHVKRNNEQLKNEIARLS
FT                   RKYILSETESLTVKAFEKDIKEIEDSTLAVAEQFGLQEKPFSELQVTFERSIKTLTNVE
FT                   SGQMDVFAAVKDIEKIESQARHNLDVYVTQLHMIKRYMEKRHLPGIPQDFLSAFFTTSS
FT                   QLEALMDELSRGRINIEAVSRLSEVATVAIANLEDLTYQVVQNATLTEQLLQYSNRYRS
FT                   FEAGVQSSFEHALRLFEVENDYQASFDEISYALETVEPGVTDRFVNSYEKTREHIRF"
FT   gene            complement(635475..635933)
FT                   /locus_tag="spyM18_0797"
FT   CDS_pept        complement(635475..635933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0797"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33679.1| (AE006524)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0797"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97461"
FT                   /protein_id="AAL97461.1"
FT                   /translation="MTNLEDKLLKGAWGERRLNPEQQRYYLGTYAERVVLSALLDEAQT
FT                   KTVKDYLKRELPSLQLVYQPLHLKISSKLAPQLQILYMKLAKENHLPVTIITETHMTSP
FT                   FAFILHTDHAINLKETRLEVILKQTKNDQLSKQPPEKTKSFWKRFLKK"
FT   gene            636160..637467
FT                   /gene="eno"
FT                   /locus_tag="spyM18_0798"
FT   CDS_pept        636160..637467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="spyM18_0798"
FT                   /product="putative enolase"
FT                   /note="best blastp match sp|P82479|ENO_STRPY ENOLASE
FT                   (2-PHOSPHOGLYCERATE DEHYDRATASE) (2-PHOSPHO-D-GLYCERATE
FT                   HYDRO-LYASE)"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0798"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97462"
FT                   /db_xref="GOA:P69951"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69951"
FT                   /protein_id="AAL97462.1"
FT                   /translation="MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYLGLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKG
FT                   KLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIMPVGAPTFKEGLRWGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETI
FT                   LKAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEE
FT                   LVNKYPIITIEDGMDENDWDGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANS
FT                   ILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSL
FT                   SRTDRIAKYNQLLRIEDQLGEVAQYKGIKSFYNLKK"
FT   gene            638235..638396
FT                   /gene="sagA"
FT                   /locus_tag="spyM18_0799"
FT   CDS_pept        638235..638396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagA"
FT                   /locus_tag="spyM18_0799"
FT                   /product="streptolysin S associated protein"
FT                   /note="blest blastp match AAK33684 (AE006526) streptolysin
FT                   S associated protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0799"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97463"
FT                   /protein_id="AAL97463.1"
FT                   /translation="MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGG
FT                   SGSYTPGK"
FT   gene            638618..639568
FT                   /gene="sagB"
FT                   /locus_tag="spyM18_0800"
FT   CDS_pept        638618..639568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagB"
FT                   /locus_tag="spyM18_0800"
FT                   /product="SagB"
FT                   /note="best blastp match gb|AAC25178.1| (AF067649) SagB
FT                   [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0800"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97464"
FT                   /protein_id="AAL97464.1"
FT                   /translation="MSFFTKEKQPKENCPPITVEKARQLFEFNTNHLSLSDYHHQTVLK
FT                   TSKQLVAQHLMPNATDNLSQHFLMNYKANNNYLGFQASIVDFFTDSAVANFSSSYVYES
FT                   QEKIIRLPKPIKISTALSTCIIKRRSHRQFSDRQMPLQDLSNILYYACGVSSQASIRDG
FT                   ASDKITLRNCASGGGLYPIHLVFYARNISKLIDGFYEYLPYQHALRCYRHSSEENVRDF
FT                   AEYGAINAENCNIIIIYVYHYIKNTRKYGNQATAYAFIESGEIAQNIQLTATALTYGSI
FT                   DIGGYNKEYLQELLDLDGLGEHVIHMTLVGTKESQ"
FT   gene            639565..640623
FT                   /gene="sagC"
FT                   /locus_tag="spyM18_0801"
FT   CDS_pept        639565..640623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagC"
FT                   /locus_tag="spyM18_0801"
FT                   /product="SagC"
FT                   /note="best blastp match gb|AAK33686.1| (AE006526)
FT                   streptolysin S associated ORF [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0801"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97465"
FT                   /protein_id="AAL97465.1"
FT                   /translation="MKYQLNSNVRVVTFQDTFCFRKGIWDFNEAILDLTQEPQNLKIVY
FT                   QEIVSQLVKGVAIDTETYENTLEPETFANLMEVISGLYYNDMLMLEDDYNLEENVMKIL
FT                   MGNFRFMAQAGHMVSNDPVLFISDSTYVNESAELLAEQLHLQLQVASDDLKMLIQQTDV
FT                   SSRLDALEHRRNMNCLSDALCDYQSIIICQERLNIMMLRHLNEVSVAMKKQLVIGFVDG
FT                   PFLHACTLNPPHSADFDSLERRVLARLQDSTLYQHFANQILPATQDVSQAYLPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSIYLPTLEIQVQDILKMSNSQTQGALAKLKYEDQQI
FT                   STREIVKKLLDE"
FT   gene            640643..642001
FT                   /locus_tag="spyM18_0802"
FT   CDS_pept        640643..642001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0802"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33687.1| (AE006526)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0802"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97466"
FT                   /protein_id="AAL97466.1"
FT                   /translation="MLYYYPSFNHIFDELKSLSGNRTGILNQSQVPVCNHPHDVYLKSI
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSYYEEALIKYLGESIERYATVIAGDLLSDRIVY
FT                   ASYNELKLLHKVMPLEYLQVFTQEQIALSCDLQMMMCDKMVTENDVLGWVKCPMFFEDA
FT                   EMYVPAQMLCVGYKTNETVGERRIIPGFSTGTASHKTLEAAMCNSLIEYIQIDSMMLSW
FT                   YTKKSCPKIIVDDPDIEMILEEARLGKDSLYDIIPIDMTVGEDNPLYTFGIILKNKYDE
FT                   GPYLLFGVQAGLDPKHALLRGIMEASAISYSYYYNLLYQKASLANIECEEPLFLDLDSN
FT                   VFYYAHPKDQDHKWKAFEPLISGEVLLSDLEDHSGKDKKEDLKTLLAYAKKVSPNAVFL
FT                   DITPPEALEKGWYVTRVLMPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   gene            641976..642647
FT                   /locus_tag="spyM18_0803"
FT   CDS_pept        641976..642647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0803"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33688.1| (AE006526)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0803"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97467"
FT                   /protein_id="AAL97467.1"
FT                   /translation="MPLSIQCLNLCFLLVTFCPSIPMQAIFGKEDSGYAFNLIGFLRAT
FT                   LIYDILALVSIYVLSPQITLSLESIDSKTFFMGLVFCVLIVLIELVFLHGLRCWQKKQW
FT                   LPATFSFVGTTNDWSKIGYPLLLALFEEMIYRFLWFNILAFQWHLPTIIVLIVTSFCYA
FT                   LNHLLMGKSIFYAKLVTGIIYGSIYMLTSQLWLVVIMHVGGNLLVECLSHLQTKKKKEV
FT                   T"
FT   gene            642647..643327
FT                   /locus_tag="spyM18_0804"
FT   CDS_pept        642647..643327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0804"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33689.1| (AE006526)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0804"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97468"
FT                   /protein_id="AAL97468.1"
FT                   /translation="MLLVLLSFLGLTTLWLTSYRRRCLARWHLQWLMALSYQDFLDVLL
FT                   SLFQFVVIIFVLFFYSATINLGEVLTFLTQTSWHWQILCYLVLYLMAIIEMTLLVLILI
FT                   FDVLLQKDSRLLFKKITWLPFRQDKPVLSILLLGIVILVDSLFYLGLLILLGEQSLTSL
FT                   ATLILGYGIVKACRYSGWLNVLLAFCLFTIVGLWAVTATLLYGWLVGAMILTVTYLMIS
FT                   CKEY"
FT   gene            643350..644273
FT                   /locus_tag="spyM18_0805"
FT   CDS_pept        643350..644273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0805"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33690.1|(AE006526) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0805"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97469"
FT                   /protein_id="AAL97469.1"
FT                   /translation="MSFVQLTNVVKSYKNGKKAVNDVSLSIEAGNIYGLLGPNGAGKST
FT                   LINLILGLIPLSSGKITVLGQSQKTIRKISSQIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGAQLKKQVLKSLEFVGLHSQAKQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNKEGATVIYTTHYMEEVEALCDYIFIMDHGQVIEEGPKFELE
FT                   KRYVANLANQIIVTLTDSRHLELADKPDWSLIEDGEKLMLKIDNSDMTSVVHQLKQANI
FT                   TFSEIRHNHLNLEEIFLHLTGKKLRD"
FT   gene            644282..645409
FT                   /gene="sagH"
FT                   /locus_tag="spyM18_0806"
FT   CDS_pept        644282..645409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sagH"
FT                   /locus_tag="spyM18_0806"
FT                   /product="SagH"
FT                   /note="best blastp match gb|AAK33691.1| (AE006526) ABC
FT                   transporter (ATP-binding protein) - streptolysin S
FT                   associated ORF [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0806"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97470"
FT                   /protein_id="AAL97470.1"
FT                   /translation="MVLFHLIKKESLQIFRNRTALLMMVIFPILMIVILSFAFKSSFNT
FT                   ATTVPKLTIRYQLEGEKTDYQKNFLAFLKVLNQKLHLEAKPSNSLEKDRQRVSEGALTA
FT                   VLEVKKNQTIKVITNNINQQNADLINMLVKNYVDNAKTYDSIAALYPQQLNHIRKRSVD
FT                   YVKVSSIQTSKGMTSADYYAISMFTMITFYSMMSAMNLVLSDRQQRITNRIRLTGVSPS
FT                   LLVFGKLIGAMLATTVQLSLLYIFTRFVLRVNWGTNEWMLIGITASLVYLSVAIGIGLG
FT                   ISIKNEAFLTVASNTIIPIFAFLGGSYVPLTTLHSSIINQLSNISPIKWVNDSLFYLIF
FT                   GGQYNPIPVTLIVNISIGTIFIILALIGMRKQVTT"
FT   gene            645406..646524
FT                   /locus_tag="spyM18_0807"
FT   CDS_pept        645406..646524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0807"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33692.1| (AE006526) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0807"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97471"
FT                   /protein_id="AAL97471.1"
FT                   /translation="MICFIKTLFVKIKRKKTSYVTFFLMPILTTLLALSLSFSNNNQAK
FT                   IGILDKDNSQISKQFIAQLKQNKKYDIFTKIKKEHIDHYLQDKSLEAVLTIDKGFSDKV
FT                   LQGKSQKLNIRSIANSEITEWVKAQTNYLLENYNIIGDVALGNEDTFNRILQKNQQLNY
FT                   DVKQVTLTDRSRSKAVSSTTTGFLLILMLGSTSVIYSGILADKSSQLYHRLMLSNLSRF
FT                   RYMLSYVCVGFVAFTIQIVIMLSLLKVFNISFFVPTSLLLIIFFLFSLLAIGFGLLIGA
FT                   ITQNSQQSSQLANLIVMPTSMLAGCLWPLSITPSYMQAIGKLLPQNWVLSAIAIFQSGG
FT                   TLSQAWPYLLAVMGTALALIIFSSLLLKPTRL"
FT   gene            647096..649828
FT                   /locus_tag="spyM18_0808"
FT   CDS_pept        647096..649828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0808"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33693.1| (AE006526)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0808"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97472"
FT                   /protein_id="AAL97472.1"
FT                   /translation="MINKKCIIPVSLLTLAITLTSVEEVTSRQNLTYANEIVTQRPKRE
FT                   SVISDKSNFPVISPYLASVDFGERKTPLPTPDKGVKVTTEQSIAQVRKGPEERTYTVTG
FT                   KITSVINGWGGYGFYIQDSEGIGLYVYPQKDLGYSKGDIVQLTGTLTRFKGDLQLQQVT
FT                   AHKKLELSFPTSVKEAVISELETTTPSTLVKLSHVTVGELSTDQYNNTSFLIRDDSGKS
FT                   IVVHIDHRTGVKGADVVTKISQGDLINLTAILSIVDGQLQLRPFSLEQLEVVKKVTSSN
FT                   SDASSRNIVKIGEIQGASHTSPLLKKAVTVEQVVVTYLDDSTHFYVQDLNGDGDLATSD
FT                   GIRVFAKNAKVQVGDVLTISGEVEEFFGRGYEERKQTDLTITQIVAKAVTKTGTAQVPS
FT                   PLVLGKDRIAPANIIDNDGLRVFDPEEDAIDYWESMEGMLVAVDDAKILGPMKNKEIYV
FT                   LPGSSTRPLNNSGGVLLPANSYNTDVIPVLFKKGKQIIKAGDSYKGRLAGPVSYSYGNY
FT                   KVFVDDSKNLPSLMDGHLKPEKTNLQKDLSKLSIASYNIENFSANPSSTKDEKVKRIAE
FT                   SFIHDLNAPDIIGLIEVQDNNGPTDDGTTDATQSAQRLIDAIKKLGGPAYRYVDIAPEN
FT                   NVDGGQPGGNIRTGFLYQPERVSLSDKPKGGARDALTWVNGELNLSVGRIDPTNAAWKD
FT                   VRKSLAAEFIFQGRKVVVVANHLNSKRGDNALYGRVQPVTFKSEQRRHVLANMLAQFAK
FT                   EGAKHQANIVMLGDFNDFEFTKTIQLIEEGDMVNLVSRHDISDRYSYFHQGNNQTLDNI
FT                   LVSRHLLDHYEFDMVHVNSPFMEAHGRASDHDPLLLQLSFSKENDKAESSKQSVKAKKT
FT                   SKGKLLPKAGDSLVYVITLLGTASLLVPILLLIKGKKES"
FT   gene            650106..650606
FT                   /locus_tag="spyM18_0809"
FT   CDS_pept        650106..650606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0809"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33694.1| (AE006527)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0809"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97473"
FT                   /protein_id="AAL97473.1"
FT                   /translation="MTKLTVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMN
FT                   FLAFYHRKYIIAVTLGCMIANFYSFGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNG
FT                   IFNKAFVYFSFFFATSMFTVAIELYFFGAPFLLTWFTTALGELISLLIGSLIIDKLSQR
FT                   ISF"
FT   gene            650800..652758
FT                   /gene="lig"
FT                   /locus_tag="spyM18_0810"
FT   CDS_pept        650800..652758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="spyM18_0810"
FT                   /product="putative DNA ligase"
FT                   /note="best blastp match gb|AAK33695.1| (AE006527) putative
FT                   DNA ligase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0810"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97474"
FT                   /db_xref="GOA:Q8P1L1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1L1"
FT                   /protein_id="AAL97474.1"
FT                   /translation="MKKRIKELTDLLNRYRYDYYTKDAPSVSDSDYDKLYRELVTLEQS
FT                   YPEYVLQDSPTQQVGGTILKGFEKYRHQYPLFSLQDAFSREELDAFDKRVKAEFPNATY
FT                   LAELKIDGLSISLSYENGFLQVGATRGDGNIGENITENIKKIKDIPHQLSEPLTITVRG
FT                   EAYMSRQSFKAINEARQENGETEFANPRNAAAGTLRQLDTSVVAKRQLATFLYQEASPT
FT                   ARNQQNEVLAELADLGFSVNPYYQLTSSMDEIWDFIKTIEAKRDQLAYDIDGVVIKVNS
FT                   LAMQEELGFTVKAPRWAIAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLTPVQLAGTT
FT                   VSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLNVVMSKRNQQEVMLIPKLCPSCG
FT                   SELVHFEDEVALRCINPLCPSLIQRSLEHFASRDAMNITGLGPAIVEKLFLAGFVHDVA
FT                   DIYQLTKEDFMQLDGIKEKSADKLLAAIEASKSNSAEKLLFGLGIRHIGSKVSRLILEV
FT                   YGDISALLTAKEEEIARIDGLGSTIAQSLTQYFEQKTAAILVDELKTAGVNMHYSGQKV
FT                   NSDAALFGLTVVLTGKLNQLNRNEAKDKLEALGAKVTGSVSKKTDLVIAGSDAGSKLEK
FT                   AKSLGIRIEDEDWLRKL"
FT   gene            652772..653794
FT                   /locus_tag="spyM18_0811"
FT   CDS_pept        652772..653794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0811"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33696.1| (AE006527)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0811"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97475"
FT                   /protein_id="AAL97475.1"
FT                   /translation="MKKQLRARLIYNPTSGQELMRKSVPEVLDILEGFGYETSAFQTTA
FT                   QKNSALNEARRAAKAGFDLLIAAGGDGTINEVVNGIAPLKKRPKMAIIPTGTTNDFARA
FT                   LKVPRGNPSQAAKLIGKNQTIQMDIGRAKKDTYFINIAAAGSLTELTYSVPSQLKTMFG
FT                   YLAYLAKGVELLPRVSNVPVKITHDKGVFEGQVSMIFAAITNSVGGFEMIAPDAKLDDG
FT                   MFTLILIKTANLFEIVHLLRLILDGGKHITDRRVEYIKTSKIVIEPQCGKRMMINLDGE
FT                   YGGDAPITLENLKNHITFFADTDLISDDALVLDQDELEIEEIAKKFAHEVEDLEQELEE
FT                   "
FT   gene            654185..654382
FT                   /gene="atpL7"
FT                   /locus_tag="spyM18_0812"
FT   CDS_pept        654185..654382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpL7"
FT                   /locus_tag="spyM18_0812"
FT                   /product="H+-transporting ATP synthase chain C"
FT                   /note="best blastp match gb|AAK33697.1| (AE006527)
FT                   H+-transporting ATP synthase chain C [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0812"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97476"
FT                   /protein_id="AAL97476.1"
FT                   /translation="MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMIL
FT                   GVAFIEGTFFVTLVMAFILK"
FT   gene            654417..655133
FT                   /gene="atpB"
FT                   /locus_tag="spyM18_0813"
FT   CDS_pept        654417..655133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="spyM18_0813"
FT                   /product="putative proton-translocating ATPase a subunit"
FT                   /note="best blastp match gb|AAK33698.1| (AE006527) putative
FT                   proton-translocating ATPase a subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0813"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97477"
FT                   /db_xref="GOA:Q7CND5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CND5"
FT                   /protein_id="AAL97477.1"
FT                   /translation="MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLK
FT                   PEGKQTALEYLISFVDGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNG
FT                   YNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTN
FT                   FLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFT
FT                   KLTATYLGKKVNESEE"
FT   gene            655151..655645
FT                   /gene="atpF"
FT                   /locus_tag="spyM18_0814"
FT   CDS_pept        655151..655645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="spyM18_0814"
FT                   /product="putative proton-translocating ATPase, subunit b"
FT                   /note="best blastp match gb|AAK33699.1| (AE006527) putative
FT                   proton-translocating ATPase, subunit b [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0814"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97478"
FT                   /db_xref="GOA:Q8P1K8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K8"
FT                   /protein_id="AAL97478.1"
FT                   /translation="MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQI
FT                   SRDIDQAEQSRLSAQQLETKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAK
FT                   RLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE
FT                   A"
FT   gene            655645..656181
FT                   /gene="atpH"
FT                   /locus_tag="spyM18_0815"
FT   CDS_pept        655645..656181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="spyM18_0815"
FT                   /product="putative proton-translocating ATPase, delta
FT                   subunit"
FT                   /note="best blastp match gb|AAK33700.1| (AE006527) putative
FT                   proton-translocating ATPase, delta subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0815"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97479"
FT                   /db_xref="GOA:Q8P1K7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K7"
FT                   /protein_id="AAL97479.1"
FT                   /translation="MTKKEQALIEQYAKSLVEVASEHHSLDALQADVLAILETFVTTNL
FT                   DQSLSSLAVPHAEKIKLLTLLKGNNSVYMNNFLNLILQNEREAYLYQMLQTVLNEIAIV
FT                   SNQYDVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVID
FT                   TSIRRQLQAFKMNLK"
FT   gene            656197..657705
FT                   /gene="atpA"
FT                   /locus_tag="spyM18_0816"
FT   CDS_pept        656197..657705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="spyM18_0816"
FT                   /product="putative proton-translocating ATPase, alpha
FT                   subunit"
FT                   /note="best blastp match gb|AAK33701.1| (AE006527) putative
FT                   proton-translocating ATPase, alpha subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0816"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97480"
FT                   /db_xref="GOA:Q8P1K6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K6"
FT                   /protein_id="AAL97480.1"
FT                   /translation="MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLD
FT                   NAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALI
FT                   GRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTI
FT                   VVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDG
FT                   QIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFG
FT                   SDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEE
FT                   ALYDYFDVHYNDLFETIRTTKDLPEEAALDAAIKAFKEYSNFKS"
FT   gene            657721..658596
FT                   /gene="atpG"
FT                   /locus_tag="spyM18_0817"
FT   CDS_pept        657721..658596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="spyM18_0817"
FT                   /product="putative proton-translocating ATPase, gamma
FT                   subunit"
FT                   /note="best blastp match gb|AAK33702.1| (AE006527) putative
FT                   proton-translocating ATPase, gamma subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0817"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97481"
FT                   /db_xref="GOA:Q7CND4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CND4"
FT                   /protein_id="AAL97481.1"
FT                   /translation="MAGSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQI
FT                   YASKIRQITTDLLKSELTIGSDNPMLVSRPVKKTGYIVITSDKGLVGGYNSKILKSVMD
FT                   MITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQPSFEQVRQIISQSVDMFV
FT                   NEIFDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTGFELEPNRHDILDQL
FT                   LPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEIT
FT                   EIVAGANALE"
FT   gene            658758..660164
FT                   /gene="atpD"
FT                   /locus_tag="spyM18_0818"
FT   CDS_pept        658758..660164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="spyM18_0818"
FT                   /product="putative proton-translocating ATPase, beta
FT                   subunit"
FT                   /note="best blastp match gb|AAK33703.1| (AE006527) putative
FT                   proton-translocating ATPase, beta subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0818"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97482"
FT                   /db_xref="GOA:Q8P1K5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K5"
FT                   /protein_id="AAL97482.1"
FT                   /translation="MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVL
FT                   EVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEE
FT                   PFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTV
FT                   LIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGAR
FT                   MRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATE
FT                   MGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPA
FT                   VDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGR
FT                   ARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDHLPEDAFRSVGPIED
FT                   VIKKAEKMGF"
FT   gene            660177..660593
FT                   /gene="atpE"
FT                   /locus_tag="spyM18_0819"
FT   CDS_pept        660177..660593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="spyM18_0819"
FT                   /product="putative proton-translocating ATPase, epsiron
FT                   subunit"
FT                   /note="best blastp match gb|AAK33704.1| (AE006527) putative
FT                   proton-translocating ATPase, epsiron subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0819"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97483"
FT                   /db_xref="GOA:P63670"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63670"
FT                   /protein_id="AAL97483.1"
FT                   /translation="MTQMTVQVVTPDGIKYDHHAKCISVTTPDGEMGILPNHINLIAPL
FT                   QVHEMKIRRGGEDEKVDWIAINGGIIEIKDNVVTVVADSAERDRDIDVSRAERAKLRAE
FT                   REIAQAETTHNIDEVRRAKVALRRALNRINVSKK"
FT   gene            660859..661116
FT                   /locus_tag="spyM18_0820"
FT   CDS_pept        660859..661116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0820"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33705.1| (AE006528)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0820"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97484"
FT                   /protein_id="AAL97484.1"
FT                   /translation="MVCYNNPMELLMKIIAFSCHLFFIGLSYQLLISVIDWTKFSHYHP
FT                   ENLGRLRLFVFLLATALGYLVSHCMLELIQISQTLFFEFR"
FT   gene            661181..662452
FT                   /gene="murA"
FT                   /locus_tag="spyM18_0821"
FT   CDS_pept        661181..662452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="spyM18_0821"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="best blastp match gb|AAK33706.1| (AE006528) putative
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0821"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97485"
FT                   /db_xref="GOA:P65459"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65459"
FT                   /protein_id="AAL97485.1"
FT                   /translation="MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRN
FT                   VPILSDVFTMNNVVRGLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGP
FT                   ILARNGHAKVSMPGGCTIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMD
FT                   FPSVGATQNLMMAATLADGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGV
FT                   THLRGVEHDVVQDRIEAGTFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEE
FT                   YGIRVQANTPKLKPVTVKTLPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLE
FT                   EMRRMGLQSEILRETAMIHGGRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHL
FT                   DRGYYQFHEKLAKLGATISRSSEV"
FT   gene            662456..662644
FT                   /gene="epuA"
FT                   /locus_tag="spyM18_0822"
FT   CDS_pept        662456..662644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epuA"
FT                   /locus_tag="spyM18_0822"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33707.1| (AE006528)
FT                   conserved competence associated hypothetical protein
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0822"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97486"
FT                   /protein_id="AAL97486.1"
FT                   /translation="MTNGLKYVLEQMLLLLVIAALACLFLAIGLMIGYSFMGDGQSPWH
FT                   ILSMDKWAELVNKFTGK"
FT   misc_feature    662895..663257
FT                   /note="spyM18_0824; probable gene fragment; best blastp
FT                   match sp|Q03158|NUCE_STRPN DNA-ENTRY NUCLEASE
FT                   (COMPETENCE-SPECIFIC NUCLEASE)"
FT   misc_feature    663241..663543
FT                   /note="spyM18_0826; probable gene fragment; best blastp
FT                   match gb|AAK33708.1| (AE006528) putative competence
FT                   associated membrane nuclease [Streptococcus pyogenes M1
FT                   GAS]"
FT   gene            663748..664869
FT                   /gene="pheS"
FT                   /locus_tag="spyM18_0827"
FT   CDS_pept        663748..664869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="spyM18_0827"
FT                   /product="putative phenylalanyl-tRNA synthetase (alpha
FT                   subunit)"
FT                   /note="best blastp match gb|AAK33709.1| (AE006528) putative
FT                   phenylalanyl-tRNA synthetase (alpha subunit) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0827"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97487"
FT                   /db_xref="GOA:Q8P1K1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K1"
FT                   /protein_id="AAL97487.1"
FT                   /translation="MVPRVNAPLIKWRSGTLFSSLKEGKTMDLQAQLEELKTKTLETLQ
FT                   SLTGNHTKELQDLRVAVLGKKGSLTELLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEE
FT                   QAKIVEAAKIQAQLDAESIDVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFE
FT                   VEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDQHDFSKGPLKMV
FT                   SPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMRDLKGTLEMIIKKMFGEERSIRLRPS
FT                   YFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFA
FT                   FGLGQERIAMLRYGINDIRGFYQGDQRFSEQFN"
FT   gene            665079..667484
FT                   /gene="pheT"
FT                   /locus_tag="spyM18_0828"
FT   CDS_pept        665079..667484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="spyM18_0828"
FT                   /product="phenylalanyl-tRNA synthetase (beta subunit)"
FT                   /note="best blastp match gb|AAK33710.1| (AE006528)
FT                   phenylalanyl-tRNA synthetase (beta subunit) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0828"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97488"
FT                   /db_xref="GOA:Q8P1K0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1K0"
FT                   /protein_id="AAL97488.1"
FT                   /translation="MLVSYKWLKELVDIDVTPAALAEKMSTTGIEVEGIEVPAEGLSKL
FT                   VVGHVLSCEDVPETHLHLCQVDTGDETPRQIVCGAPNVKAGIKVIVAVPGARIADNYKI
FT                   KKGKIRGMESLGMICSLQELGLSDSIIPKEFSDGIQILPEEAVPGDAIFKYLDLDDHII
FT                   ELSITPNRADALSMRGVAHEVAAIYGKSVSFPQKNLQESDKATSEAIEVAIASDKVLTY
FT                   ASRVVENVKVKPSPQWLQNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDYDKFEDHK
FT                   IVARAARQGESLVTLDGEKRDLTTEDLVITVADKPVALAGVMGGQATEIDGNSQTVVLE
FT                   AAVFDGKSIRKTSGRLNLRSESSSRFEKGVNYATVLEALDFAAAMLQELAEGQVLSGHV
FT                   QAGQLPTEPVEVSTSLDYVNVRLGTELTFADIQRIFDQLGFGLTGDETRFTVAVPRRRW
FT                   DISIPADLVEEIARIYGYDKLPTTLPEAGGTAAELTPTQALRRKVRGLAEGLGLTEIIS
FT                   YALTTPEKAIEFAVAPSHLTELMWPMSVERSALRQNMVSGMLDTVAYNVARKQSNLALY
FT                   EIGKIFEQEVNPKEDLPNEVNHFAFAICGLVAQKDFQTQAQAVDFYHAKGILDTLFANL
FT                   NLKVQYVPTKDLANMHPGRTALILLDEQVIGFVGQVHPGTAKAYSIPETYVAELDMAAL
FT                   EAALPSDQTFAEITKFPAMTRDIALLLDREVSHQAIVTAIESAGVKRLTSIKLFDVYEG
FT                   ATIQAGKKSMAYSLTFQNPNDNLTDEEVAKYMEKITKSLTEQVGAEVR"
FT   gene            667596..667973
FT                   /locus_tag="spyM18_0829"
FT   CDS_pept        667596..667973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0829"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33711.1| (AE006528)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0829"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97489"
FT                   /protein_id="AAL97489.1"
FT                   /translation="MYQTKITGNRLYHTVSKGYGDSVTLFRKTDQGETPMSLLVIALSS
FT                   CVTMCVQGFYHRQFQQDTLAVSAEASYEEEVFELLVRIDDVLDDKKKADLLAYIGAYCR
FT                   VKQLLKPEVTVTITLEGLSHV"
FT   gene            667966..668352
FT                   /locus_tag="spyM18_0830"
FT   CDS_pept        667966..668352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0830"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33712.1| (AE006528)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0830"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97490"
FT                   /protein_id="AAL97490.1"
FT                   /translation="MSDASLKTYQKQWAYQKYWVMAHSQQNYNALRELFKGNQWSEEKV
FT                   LTFHCLIEEAQAIPPTVKSLRTAYQHVWGYFKKVASQEEKDHFKDLDAQLETKSEEMLC
FT                   FLQEMTAHYQPSYLLSCRLITKGP"
FT   gene            668274..668399
FT                   /locus_tag="spyM18_0831"
FT   CDS_pept        668274..668399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0831"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0831"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97491"
FT                   /protein_id="AAL97491.1"
FT                   /translation="MLFTRDDGSLSALLFAILPFDYQRSLNAKQKSRDFWEVMLS"
FT   gene            668425..669501
FT                   /locus_tag="spyM18_0832"
FT   CDS_pept        668425..669501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0832"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33713.1| (AE006528)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0832"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97492"
FT                   /protein_id="AAL97492.1"
FT                   /translation="MFLALNEMKQSKLRYGLITGLLCLVAYLMFFLSGLAFGLMQENRS
FT                   AVDLWKADSVLLAKDADATLTLSQVSRAQENQITADKVAPLAQLNTVAWSVKNPKDADK
FT                   VKVSLFGIDSNSFIRPNIVKGRLFKTNKEVVLDQSLAKEEAFAIGKDFYTSSSSQALTI
FT                   VGYTQNARFSVAPVVYMNLEAFETLKYGEPLPKDKQVVNAFITKGSLIDYPKKDFQKLD
FT                   IKTFITKLPGYSAQLLTFGFMISFLVIISAIIIGIFMYILTIQKAPIFGIMKAQGISNK
FT                   TITTAVLMQTFFLSFLGSGLGLLGTWLTSLLLPTVVPFQSNWFLYLAIFVSMICFALLG
FT                   TLFSVFNIIRIDPLKAIG"
FT   gene            669511..670179
FT                   /locus_tag="spyM18_0833"
FT   CDS_pept        669511..670179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0833"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33714.1| (AE006528) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0833"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97493"
FT                   /protein_id="AAL97493.1"
FT                   /translation="MSVLTFKQVTKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGSG
FT                   KSTFLTIAGGLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQQ
FT                   QLELVDHLTGSKEKAKANQLFDDLGITGLKHQLPQELSGGERQRAAIARALYHDPALIL
FT                   ADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLEYCDKVYRMQDGELRQER
FT                   "
FT   gene            complement(670283..671197)
FT                   /locus_tag="spyM18_0834"
FT   CDS_pept        complement(670283..671197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0834"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33715.1| (AE006528)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0834"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97494"
FT                   /protein_id="AAL97494.1"
FT                   /translation="MKTDDLRESQQVEDRRGQSSGSFGGGLGGGLLLQLLFSRGGWKTK
FT                   LVILLLLLVMGGGGLSGVLGGKPSSTNNNAYQSSQVTRTNGDKASQEQVSFVSKVFAST
FT                   EDYWTKTFREKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQKVYLDISFYNEL
FT                   STKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASARQGKSKAKANQLNVKLELQADY
FT                   YAGAWANYVQGQGLLEKGDIEEAMAAAHAVGDDTLQEETYGRTVPDSFTHGTSKQRQRW
FT                   FDRGYQYGDFEHGDTFSIPYSKL"
FT   gene            671348..674563
FT                   /gene="rexB"
FT                   /locus_tag="spyM18_0835"
FT   CDS_pept        671348..674563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexB"
FT                   /locus_tag="spyM18_0835"
FT                   /product="putative ATP-dependent exonuclease, subunit B"
FT                   /note="best blastp match gb|AAK33716.1| (AE006529) putative
FT                   ATP-dependent exonuclease, subunit B [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0835"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97495"
FT                   /db_xref="GOA:Q8P1J3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1J3"
FT                   /protein_id="AAL97495.1"
FT                   /translation="MKLIYTEMSYSMTEILVNEARKAADQGYRVFYIAPNSLSFEKERE
FT                   VLTLLPERGTFSIIVTRFVQMSRYFTVESSPSKQHLDDTTLAMIFYRALMQLKPEDLPS
FT                   YGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDHPQKQEDLIKIIELAETIMIQQDY
FT                   NQDSPLQSFARAIKLGLLNNQLSKTVVVIDGFSRFSAEEDYLLSLLNNNCQEVIIGSYV
FT                   SQKAYQKSFIKGNIYEASLHFLQDLAQKYHIKPVFATSNQVFKPAFSRLTQLFEATHDF
FT                   SQVDWQLQKNDLDHFSLWQCHHQKEEIEHVAKSIRQKLYEGYRYKDILVLLGDMDAYQL
FT                   QIGPIFDKFEIPYYLGKAEPMAAHPLVQFIESLERSQRYNWRREDILNMLKSGLFGCFD
FT                   DSDIDRFEEYTQFADIKGFTKFSKPFTINSSRQYPLDFLNEMRQDIVLPLQELFKSQKQ
FT                   LGASLVDKLILFLKKIRLAENMQGLAQSQLEVEKNEEVWKRFTDILTSFHHIFGQEKLR
FT                   LSDCLALIKTGMKSAQYRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHH
FT                   SGLLSDQERARINEIRNYRHFDIASAENSKKNHQTALSLFNAATKELVLSVPTVINETF
FT                   DDLSPYLKELINFGLPLLDKGKNYLSYDNSDIGNYKALLSQIIAINRQDLIEMSDQDKM
FT                   FWTVVLRYLRKQLRKQQLELPTSDYRLSTKPLSKEVIEVCFPKGIPLKLSATALTVFYN
FT                   NQYNYFLKYVLNLNKTESIHPDSRIHGQYLHRVFERLMKDHTQEPFDNKLKQAIYHTNQ
FT                   ESFFQQVYQDNAEAEYSLAILEDIVRSTAPILQLNQNIKVIDQEKNFHLDMGNEILVHG
FT                   IIDRIDQLSDGSLGVVDYKSSANQFDIGTFYNGLSPQLVTYLAALKQIAPHDINQLFGA
FT                   MYLHLQDPKLDLVTFKQIDNTLVESIYKALTYKGIFSEVEKEHLSTGAYQTKNALYSND
FT                   ELETLLNYNKYLYLKAVKHIKKGHFLINPYTSDGKTVQGDQLKAITRFEADLDMAQARR
FT                   LVTLPAKEKKECFLTLMRKESHL"
FT   gene            674524..678192
FT                   /gene="rexA"
FT                   /locus_tag="spyM18_0836"
FT   CDS_pept        674524..678192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="spyM18_0836"
FT                   /product="putative ATP-dependent exonuclease, subunit A"
FT                   /note="best blastp match gb|AAK33717.1| (AE006529) putative
FT                   ATP-dependent exonuclease, subunit A [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0836"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97496"
FT                   /db_xref="GOA:Q8P1J2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1J2"
FT                   /protein_id="AAL97496.1"
FT                   /translation="MLFNINEKGEPLVISFAPFLSPEAIKYLQENERCSDQSQKRTAQQ
FT                   IEAIYTSGQNILVSASAGSGKTFVMVERILDKILRGVSIDRLFISTFTVKAATELRERI
FT                   ENKLYSQIAQTTDFQMKVYLTEQLQSLCQADIGTMDAFAQKVVSRYGYSIGISSQFRIM
FT                   QDKAEQDVLKQEVFSKLFSEFMNQKEAPVFRALVKNFSGNCKDTSAFRELVYTCYSFSQ
FT                   STENPKIWLQENFLSAAKTYQRLEDIPDHDIELLLLAMQDTANQLRDVTDMEDYGQLTK
FT                   AGSRSAKYTKHLTIIEKLSDWVRDFKCLYGKAGLDRLIRDVTGLIPSGNDVTVSKVKYP
FT                   VFKTLHQKLKQFRHLETILMYQKDCFPLLEQLQDFVLAFSEAYLAVKIQESAFEFSDIA
FT                   HFAIKILEENTDIRQSYQQHYHEVMVDEYQDNNHMQERLLTLLSNGHNRFMVGDIKQSI
FT                   YRFRQADPQIFNQKFRDYQKKTEQGKVILLKENFRSQSEVLNVSNAVFSHLMDESVGDA
FT                   LYDEQHQLIAGSHAQTVPYLDRRAQLLLYNSDKDDGNAPSDSEGISFSEVTIVAKEIIK
FT                   LHNDKGVPFEDITLLVSSRTRNDIISHTFNQYGIPIVTDGGQQNYLKSVEVMVMLDTLR
FT                   TINNPRNDYALVALLRSPMFAFDEDDLARIALQKDNELDKDCLYDKIQRAVIGRGAHPE
FT                   LIHDTLLGKLNIFLKTLKSWRRYAKLGSLYDLIWKIFNDRFYFDFVASQAKAEQAQANL
FT                   YALALRANQFEKSGYKGLYRFIKMIDKVLETQNDLADVEVAAPKQAVNLMTIHKSKGLQ
FT                   FPYVFILNCDKRFSMTDIHKSFILNRQHGIGIKYLADIKGLLGETTLNSVKVSMETLPY
FT                   QLNKQELRLATLSEQMRLLYVAMTRAEKKVYFIGKASKSKSQDITDPKKLGKLLSLALR
FT                   EQLLTFQDWLLAIADIFSTEDLYFDVRFIEDSDLTQESVGRLQTPQLLNPDDLKDNRQS
FT                   ETIARALDMLEAVSQLNANYEAAIHLPTVRTPSQLKVTYEPLLEPIGVDIIEKSSRSLS
FT                   DFTLPHFSKKAKVEASHIGSALHQLMQVLPLSKPINQQTLLDALRGIDSNEEVKTALDL
FT                   KKIESFFCDTSLGQFFQTYQKHLYREAPFAILKLDPISQEEYVLRGIIDAYFLFDDHIV
FT                   LVDYKTDKYKQPIELKKRYQQQLELYAEALTQTYKLPVTKRYLVLMGGGKPEIVEV"
FT   gene            678308..679144
FT                   /locus_tag="spyM18_0837"
FT   CDS_pept        678308..679144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0837"
FT                   /product="putative ABC transporter (substrate-binding
FT                   protein)"
FT                   /note="best blastp match gb|AAK33718.1| (AE006529) putative
FT                   ABC transporter (substrate-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0837"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97497"
FT                   /protein_id="AAL97497.1"
FT                   /translation="MTKRNKYTMNFKKIRFGFLLCLLLYPLAACNKSEQLNHYERIKKT
FT                   RKLVVAVSPDYAPFEFKALVNGKDTIVGADVQLAQAIADELDVDLELSPMSFDNVLSSL
FT                   QTGKADLAISGISHTKERAKVYDFSIPYYQAENAIVMRASDAKVTKNISDLSGKKVAAQ
FT                   KGSIEEGLVKIQLPKANLISLTAMGEAINELKAGQVYAVTLETPVAAGFLAQHKDLALA
FT                   PFSLKTSDGDAKAVALPKNSGDLTKAVNKVIAKLDEQERYKSFIAETIALTKNTMK"
FT   gene            679285..679461
FT                   /gene="rpsU"
FT                   /locus_tag="spyM18_0838"
FT   CDS_pept        679285..679461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="spyM18_0838"
FT                   /product="30S ribosomal protein S21"
FT                   /note="best blastp match gb|AAK33719.1| (AE006529) 30S
FT                   ribosomal protein S21 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0838"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97498"
FT                   /db_xref="GOA:P66528"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66528"
FT                   /protein_id="AAL97498.1"
FT                   /translation="MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKR
FT                   KRKSEAARKRKKF"
FT   gene            complement(679589..679951)
FT                   /gene="mscL"
FT                   /locus_tag="spyM18_0839"
FT   CDS_pept        complement(679589..679951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="spyM18_0839"
FT                   /product="putative large conductance mechanosensitive
FT                   channel"
FT                   /note="best blastp match gb|AAK33720.1| (AE006529) putative
FT                   large conductance mechanosensitive channel [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0839"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97499"
FT                   /protein_id="AAL97499.1"
FT                   /translation="MVKELKAFLFRGNIIELAVAVIIGGAFGAIVTSFVNDIITPLILN
FT                   PALKAANVENITQLSWNGVKYGSFLGAVINFLIIGTSLFFVVKAAEKAMPKKEKEAAAP
FT                   TQEELLTEIRDLLAQK"
FT   gene            680081..681895
FT                   /gene="dnaE"
FT                   /locus_tag="spyM18_0840"
FT   CDS_pept        680081..681895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="spyM18_0840"
FT                   /product="putative DNA primase"
FT                   /note="best blastp match gb|AAK33721.1| (AE006529) putative
FT                   DNA primase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0840"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97500"
FT                   /protein_id="AAL97500.1"
FT                   /translation="MGFLWGGDDLAIDKEMISQVKNSVNIVDVIGEVVKLSRSGRHYLG
FT                   LCPFHKEKTPSFNVVEDRQFFHCFGCGKSGDVFKFIEEYRQVPFLESVQIIADKTGMSL
FT                   NIPPSQAVLASQHKHPNHALMTLHEDAAKFYHAVLMTTTIGQEARKYLYQRGLDDQLIE
FT                   HFNIGLAPDESDYLYQALSKKYEEGQLVASGLFHLSDQSNTIYDAFRNRIMFPLSDDRG
FT                   HIIAFSGRIWTAADTEKRQAKYKNSRGTVLFNKSYELYHLDKARPVIAKTHEVFLMEGF
FT                   MDVIAAYRSGYENAVASMGTALTQEHVNHLKQVTKKVVLIYDGDDAGQHAIAKSLELLK
FT                   GFVVEIVRIPNKMDPDEFVQRHSPEAFADLLKQSRISSVEFFIDYLKPTNVDNLQSQIV
FT                   YVEKMAPLIAQSPSITAQHSYINKIADLLPNFDYFQVEQSVNALRIQDRQKRQGQIAQA
FT                   VSNLVTLPMPKSLTAIAKTESHLMHRLLHHDYLLNEFRHRDDFYFDTSTLELLYQRLKQ
FT                   QGHITSYDLSEMSEEVNRAYYNVLEENLPKEVALGEIDDILSKRAKLLAERDLHKQGKK
FT                   VRESSNKGDHQAALEVLEHFIAQKRKME"
FT   gene            681904..683013
FT                   /gene="rpoD"
FT                   /locus_tag="spyM18_0841"
FT   CDS_pept        681904..683013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="spyM18_0841"
FT                   /product="putative RNA polymerase sigma 42 protein"
FT                   /note="best blastp match gb|AAK33722.1| (AE006529) putative
FT                   RNA polymerase sigma 42 protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0841"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97501"
FT                   /protein_id="AAL97501.1"
FT                   /translation="MTKQKEITTFNVQVAEFIRYHKKEGTAIDDDVTEKLVIPFALDAD
FT                   QIDDLLERLTDGGISITDKEGNPSSKYIVEEPKPEELTDEELIGSNSAKVNDPVRMYLK
FT                   EIGVVPLLTSEEEKELAVAVAKGDLMAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQE
FT                   GNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVRE
FT                   QRNLLQELGQDPTPEQIAERMEMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIED
FT                   EVIENPVDYTTRVVLREQLDEVLDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTR
FT                   ERIRQIEAKALRKLRHPSRSKQLRDFIED"
FT   gene            683250..683588
FT                   /locus_tag="spyM18_0842"
FT   CDS_pept        683250..683588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0842"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33723.1| (AE006530)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0842"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97502"
FT                   /protein_id="AAL97502.1"
FT                   /translation="MSDTPKYTQDQVIAIKNRILEALETVIDPELGIDVVNLGLIYEIR
FT                   FNDNGYTEIDMTLTTMGCPLADLLTDYIHDALQDVPEVTKTEVKLVWYPAWTVDKMSRY
FT                   ARIALGIR"
FT   gene            683726..684580
FT                   /locus_tag="spyM18_0843"
FT   CDS_pept        683726..684580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0843"
FT                   /product="putative dTDP-4-keto-L-rhamnose reductase"
FT                   /note="best blastp match gb|AAK33724.1| (AE006530) putative
FT                   dTDP-4-keto-L-rhamnose reductase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0843"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97503"
FT                   /protein_id="AAL97503.1"
FT                   /translation="MILITGSNGQLGTELRYLLDERSVDYVAVDVAEMDITNEDKVEAV
FT                   FAQVKPTLVYHCAAYTAVDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYV
FT                   FDGNKPVGQEWVETDRPDPKTEYGRTKRLGELAVEGYAEHFYIIRTAWVFGNYGKNFVF
FT                   TMEQLAENHSRLTVVNDQHGRPTWTRTLAEFMCYLTENQKAFGYYHLSNDAKEDTTWYD
FT                   FAKEILKDKAVEVVPVDSSAFPAKAKRPLNSTMNLDKAKATGFVIPTWQEALKAFYQQG
FT                   LKK"
FT   gene            684699..685853
FT                   /locus_tag="spyM18_0845"
FT   CDS_pept        684699..685853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0845"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33725.1| (AE006530)
FT                   conserved hypothetical protein - possibly involved in cell
FT                   wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0845"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97504"
FT                   /protein_id="AAL97504.1"
FT                   /translation="MQDVFIIGSRGLPAKYGGFETFVEELISHQSSKNIRYHVACLSDT
FT                   KHKVHFDYKGADCFYLNPPKLGPARVIAYDMMAITYALSYSDQHQIQNPIFYVLGNTVG
FT                   AFIAPFVKQIHNRGGRFFINPDGLEWKRSKWSRPVQAYLKFSEKQMTRQADLVISDNIG
FT                   IDRYLKQVYPWSKTCFIAYGTQTQPSRLTTADSKVRAYFQTFDISEKDYYLILGRFVPE
FT                   NNYETAIKEFMASSTKRDLVIICNHEGNAYFKQLLAETECDKDPRIKFVGTLYDKELLA
FT                   YIREQAYAYIHGHEVGGTNPGLLEALAHTNLNLVLGVDFNQSVAKSAALYWTKQKGQLA
FT                   ELIDQVDAGFDSDRLGKEAKAIIQEHYTWEKIVGEYEALFLNEH"
FT   gene            685843..686775
FT                   /locus_tag="spyM18_0846"
FT   CDS_pept        685843..686775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0846"
FT                   /product="putative rhamnosyltransferase"
FT                   /note="best blastp match gb|AAK33726.1| (AE006530) putative
FT                   rhamnosyltransferase - possibly involved in cell wall
FT                   localization and side chain formation of rhamnose-glucose
FT                   polysaccharide [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0846"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97505"
FT                   /protein_id="AAL97505.1"
FT                   /translation="MNINILLSTYNGERFLAEQIQSIQRQTVNDWTLLIRDDGSTDGTQ
FT                   DIIRTFVKEDKRIQWINEGQTENLGVIKNFYTLLKHQKADVYFFSDQDDIWLDNKLEVT
FT                   LLEAQKHEMTAPLLVYTDLKVVTQHLAICHDSMIKTQSGHANTSLLQELTENTVTGGTM
FT                   MITHALAEEWTTCDGLLMHDWYLALLASATGKLVYLDIPTELYRQHDANVLGARTWSKR
FT                   MKNWLNPHHLVNKYWWLITSSQKQAQLLLDLPLKPNDHELVTAYVSLLDMPFTKRLATL
FT                   KRYGFRKNRIFHTFIFRSLVVTLFGYRRK"
FT   gene            686820..687581
FT                   /locus_tag="spyM18_0848"
FT   CDS_pept        686820..687581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0848"
FT                   /product="putative ABC-transporter (permease protein)"
FT                   /note="best blastp match gb|AAK33727.1| (AE006530) putative
FT                   ABC-transporter (permease protein) - possibly involved in
FT                   cell wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0848"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97506"
FT                   /protein_id="AAL97506.1"
FT                   /translation="MVKTDFKLRYQGSAIGYLWSILKPLMMFTIMYLVFIRFLRLGGNV
FT                   PHFPVALLLANVIWSFFSEATSMGMVSIVSRGDLLRKLNFSKHIIVFSAVLGALINFLI
FT                   NLVVVLIFALINGVTISGYAYLSLFLFIELVVLVLGIALLLSNVFVYYRDLAQVWEVLL
FT                   QAGMYATPIIYPITFVLDSHPLAAKLLMLNPVAQMIQDFRYLLIDRANVTIWQMSTNWF
FT                   YIVIPYLVPFVILFIGIFVFKKNADRFAEII"
FT   gene            687581..688786
FT                   /locus_tag="spyM18_0849"
FT   CDS_pept        687581..688786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0849"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33728.1| (AE006530) ABC
FT                   transporter (ATP-binding protein) - possibly involved in
FT                   cell wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0849"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97507"
FT                   /protein_id="AAL97507.1"
FT                   /translation="MINREIAVKVQHVSKTFKLPTEATKSFRTTLVNRLRGIKGFTEQH
FT                   VLKDINFDVYKGDFFGIVGRNGSGKSTLLKIISQIYVPEKGQVTVDGKMVSFIELGVGF
FT                   NPELTGRENVYMNGAMLGFTKDEVDDMYNDIVDFAELHHFMNQKLKNYSSGMQVRLAFS
FT                   VAIKAQGDVLILDEVLAVGDEAFQRKCNDYFMERKDSGKTTILVTHDMGAVKKYCNRAV
FT                   LIEDGLVKAYGEPFDVANQYSVDNTETAEDAMNAEKISVSDIAKDLKVSLISNPRITPN
FT                   DTITFEVSYEVLKDDFTYIAFSLTDIDRNIWVYNDNSLDYPTQGIGRKCISYQCQLSQL
FT                   NDIKLKLEVTVRDKNGQMLLFSTAEQSPQIVIQRNDIDQDDLSALDSASGLYQRNGKWV
FT                   FH"
FT   gene            688811..689818
FT                   /locus_tag="spyM18_0852"
FT   CDS_pept        688811..689818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0852"
FT                   /product="putative glycosyltransferase"
FT                   /note="best blastp match gb|AAK33729.1| (AE006530) putative
FT                   glycosyltransferase - possibly involved in cell wall
FT                   localization and side chain formation of rhamnose-glucose
FT                   polysaccharide [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0852"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97508"
FT                   /protein_id="AAL97508.1"
FT                   /translation="MYKVSIICTNYNKAPWISDALDSFLSQVTDFEVEIIVIDDASTDD
FT                   SREILKSYQKKSSGKIKLLFNETNIGITKTWIKACLYAKGKYIARCDGDDYWTDSFKLQ
FT                   KQVDVLEASKRSRWCNTDFDFVNSQGDLLYANAFSSGHTPLTDTYEKVLALKGMTMAST
FT                   WLVDADLMRQVNQKINVDTPDDTFDIQLELFQLTQLTYIKDSTTVYRMTTDSDSRPTDT
FT                   PKMIHRIQKLLDTQLNYLKKYNQVDTKEVSKLLLQQDAKQEIRIHELSCFIQELQQTIV
FT                   DKTKQQETREVELQNVIEEQKNQLSELRQQYHAIINSRQWKYTSKLIAFIRRKK"
FT   gene            689815..691560
FT                   /locus_tag="spyM18_0853"
FT   CDS_pept        689815..691560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0853"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33730.1| (AE006530)
FT                   conserved hypothetical protein - possibly involved in cell
FT                   wall localization and side chain formation of
FT                   rhamnose-glucose polysaccharide [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0853"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97509"
FT                   /protein_id="AAL97509.1"
FT                   /translation="MNRILLYVHFNKYNKISAHVYYQLEQMRSLFSKIVFISNSKVSHE
FT                   DLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLITMGFDKLEEFDSLTIMNDTCFGPIWEM
FT                   APYFENFEEKKAVDFWGITNNRGTKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYE
FT                   NVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSFMPHPDFSYYNPTAILKHHVPFI
FT                   KVKAIDANQHIAPYLLNLIRETTNYPIDLIVSHMSQISLPDAKYLLSQKYLNCQRLAKQ
FT                   TCQKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADI
FT                   RVTGNRGRDIYPMLLLKDKLSQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKPADS
FT                   ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDT
FT                   FVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLVYIAWGNSYDFR
FT                   IVKNPYELTPFIDNKLLNLREDEGAHTYVNFNQMGGIKGALKYIIVGPAKAMKYIFLRL
FT                   MEKLK"
FT   gene            691557..694031
FT                   /locus_tag="spyM18_0855"
FT   CDS_pept        691557..694031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0855"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33731.1| (AE006530)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0855"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97510"
FT                   /protein_id="AAL97510.1"
FT                   /translation="MIKDTFLKTNWLNISHHIILLVFSFYFSFYSLAKELVSSTAQPVN
FT                   YYTHLLNVSFVGYIISLIGLSYYLSRQVSRQLFLKTSFIVISYLIVSYWVQITQHLNVK
FT                   RFDIWSLTKNQFYQFQALPSLLIILVMATLIKILVAYFAIEKDRFGLLGYQGNTFSVAL
FT                   ILAVVPISDIHLLKLISSRFSELVRAGNSQIALLKISGLLIVLLVIFATIIYVVLNALK
FT                   HLKSNKPSFSVAATTSLFLALVFNYTFQYGVKGDEALLGYYVFPGATLFQIVAITLVAL
FT                   LAYVITNRYWPTTFFLLILGTIISVVNDLKESMRSEPLLVTDFVWLQELGLVTSFVKKS
FT                   VIVEMVVGLAICIVVAWYLHGRVLAGKLFMSPVKRASAVLGLFIVSCSMLIPLSYEKEG
FT                   KILSGLPIISVLNNDNDINWLGFSTNARYKSLAYVWTRQVTKKIMEKPTNYSQETIASI
FT                   AQKYQKLAEDINKDRKNNIADQTVIYLLSESLSDPDRVSNVTVSHDVLPNIKAIKNSTT
FT                   AGLMQSDSYGGGTANMEFQTLTSLPFYNFSSSVSVLYSEVFPKMAKPHTISEFYQGKNR
FT                   IAMHPASANNFNRKTVYSNLGFSKFLALSGSKDKFKNIENVGLLTSDKTVYNNILSLIN
FT                   PSESQFFSVITMQNHIPWSSDYPEEIVAEGKNFTEEENHNLTSYARLLSFTDKETRAFL
FT                   EKLTQINKPITVVFYGDHLPGLYPDSAFNKHIENKYLTDYFIWSNGTNEKKNHPLINSS
FT                   DFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEVKAIQNDLKNIQYDVTIGKGY
FT                   LLKHKTFFKISR"
FT   gene            694210..694905
FT                   /locus_tag="spyM18_0856"
FT   CDS_pept        694210..694905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0856"
FT                   /product="putative glycosyl transferase"
FT                   /note="best blastp match gb|AAK33732.1| (AE006531) putative
FT                   glycosyl transferase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0856"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97511"
FT                   /protein_id="AAL97511.1"
FT                   /translation="MKKLIIIPAYNESSNIVNTIRTIESDAPDFDYIIIDDCSTDNTLA
FT                   ICQKQGFNVISLPINLGIGGAVQTGYRYAQRCGYDVAVQVDGDGQHNPCYLEKMVEVLV
FT                   QSSVNMVIGSRFITKEGFQSSFARRIGIKYFTWLIALLTGKKITDATSGLRLIDRSLIE
FT                   RFANYYPDDYPEPETVVDVLVSHFKVKEIPVVMNERQGGVSSISLTKSVYYMIKVTLAI
FT                   LVVRLKGNR"
FT   gene            694907..695248
FT                   /locus_tag="spyM18_0858"
FT   CDS_pept        694907..695248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0858"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33733.1| (AE006531)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0858"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97512"
FT                   /protein_id="AAL97512.1"
FT                   /translation="MTVTASLFISFIVLTFVFFLINLIKKDKLAIKYSLLWFILALLIL
FT                   LFTWLPNILNKMSHFLGIHSPTNMLFFLGFCLSLAIIFSLTNNISLQNDKVKRLTQEVA
FT                   LMKKEKTND"
FT   gene            695241..696527
FT                   /locus_tag="spyM18_0859"
FT   CDS_pept        695241..696527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0859"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33734.1| (AE006531)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0859"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97513"
FT                   /protein_id="AAL97513.1"
FT                   /translation="MINPSKQNQTIFLWNMLGSLSTAVISVILLMVVTRLLTSADSDIY
FT                   AFAYSFANMMVVVGLFQVRNYQATDINEKYSFSQYLVARLMTCLLMLAITVIYLTLTKT
FT                   DSYKSTIVFLVCFYRSTDAFSDLYQGMFQQHERLDIAGKSLAYRNTLIFMVYTAIILYS
FT                   KNLTLALVAVCIVSLVFIMYYDIGHSKKFQKLMFSELLSNISFQNSLKLLKESFPLFLN
FT                   GFLIIYIYTQPKYAIELMTTLGEVALGSQTIFNILFMPAFVMNLLILFFRPHITQMAIA
FT                   LIRGQIKEFNKIQVQLFAYLGVFSLIVLVGSGLFGIPFLSILYGTNLTDYWVDFMLIML
FT                   GGSIGSFATVIDNILTAMRKQQLLLIPYTGGFLISLLITNLFVMKYHILGAALSFLITM
FT                   LVWLGLSIMIYLFIMNRFKKGRVNATIYD"
FT   gene            696508..698004
FT                   /locus_tag="spyM18_0860"
FT   CDS_pept        696508..698004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0860"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33735.1| (AE006531)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0860"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97514"
FT                   /protein_id="AAL97514.1"
FT                   /translation="MQQSMTKVKYLWKENNNYIYSTFLTLFLTVILYANSLNLPLKFIS
FT                   LLFVVSTLLIVFLPKKLEVATIIFILAFGTISAIISPINDIPDEYVHYSRTVYISEGDI
FT                   NLTNNNKKLRISKDVDKLIKQSGKTFITSNLKATKHSTREYSYPYIKGTNAYYSFSYIP
FT                   QALGILVGNALDLPILLTYYFGRLCNLISYAMLAFIAIKLSGSFKQVIAVVTLLPMNIY
FT                   LAASFNQDGFAIGLVLVTIGLFINLLSSKDKSNYNTKFFLYLVLCGLLVLSKFTYFLLV
FT                   CLPLFIPNEKFGKNTKLVILKKLGGLLLIFLFAAMWFRLYGQVKTPYVADFLKEVNVSQ
FT                   QVKNMLESPIVYSSIIIRHMVINLINMNNIFQFGALSYGITNLFPLYVCFFFFVYISNA
FT                   SKITINIVEKMGIIFVISAIIGATVLAMYLTWTPVGSSTVLGVQSRYLIGIIPLVLLLF
FT                   SSQQQKFKQIEDILSDKLAIHVSLLFILAMLMSTIFRYYH"
FT   gene            698098..699321
FT                   /gene="pepT"
FT                   /locus_tag="spyM18_0861"
FT   CDS_pept        698098..699321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="spyM18_0861"
FT                   /product="putative tripeptidase"
FT                   /note="best blastp match gb|AAK33736.1| (AE006531) putative
FT                   tripeptidase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0861"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97515"
FT                   /db_xref="GOA:Q8P1H9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1H9"
FT                   /protein_id="AAL97515.1"
FT                   /translation="MKYDNLLDRFIKYVKVNTRSDPDSETTPSTESQEAFALTILKPEM
FT                   EAIGLQDVHYNPVNGYLIGTLPANNPTLTRKIGFIAHMDTADFNADNVNPQIIDNYQGG
FT                   DITLGSSNYKLDPKAFPNLNNYIGQTLITTDGTTLLGADDKSGIAEIMTAIEFLTSQPQ
FT                   IEHCDIKVAFGPDEEIGVGADKFEVADFEVDFAYTMDGGPLGELQYETFSAAALEVTFL
FT                   GRNVHPGTAKDQMINALQLAIDFHEKLPAKERPEYTDGYQGFYHLTGLTGTVEEARASY
FT                   IIRDFEEASFEARKVKVENIAQSMNAQLGTKRVLVELNDQYYNMKKVIEKDMTAIELAK
FT                   EVMEELTIKPVIEPIRGGTDGSKISFMGIPTPNIFAGGENMHGRFEFVSLQTMERAVDV
FT                   IIGLVCKA"
FT   gene            699362..699850
FT                   /locus_tag="spyM18_0862"
FT   CDS_pept        699362..699850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0862"
FT                   /product="putative pore-forming peptide"
FT                   /note="best blastp match gb|AAK33737.1| (AE006531) putative
FT                   pore-forming peptide [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0862"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97516"
FT                   /protein_id="AAL97516.1"
FT                   /translation="MIKLFGKIRYHWQPELSWSIIYWSIAFAPIFVGLSLLYERTEIPS
FT                   RVFILFAIFAVLVGIGLHRYFIIENNGILRIVSFKLFGPRKLLISTITKIEVTKSTLCL
FT                   HVEDKSYLFYMRKWPKKYFLDALAVNPYFQGEVILSDNFIKLDYFEVYQHDKKALTRG"
FT   gene            complement(699837..700034)
FT                   /locus_tag="spyM18_0863"
FT   CDS_pept        complement(699837..700034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0863"
FT                   /product="putative ferredoxin"
FT                   /note="best blastp match gb|AAK33738.1| (AE006531)
FT                   ferredoxin [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0863"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97517"
FT                   /protein_id="AAL97517.1"
FT                   /translation="MKVSIIPEKCIACGLCQTYSSLFDYHDNGIVTFSSSSETSQSICP
FT                   SDKDAILAVKSCPTKALTLE"
FT   gene            700083..700559
FT                   /locus_tag="spyM18_0864"
FT   CDS_pept        700083..700559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0864"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33739.1| (AE006531)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0864"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97518"
FT                   /protein_id="AAL97518.1"
FT                   /translation="MAKEPWEEKIVDDTIGTRTRKSRNAFISTPWLTALLSVFFVIIVA
FT                   ILFIFFYTSNSGSNRQAETNGFYGASTHKKTRKASNAKKTSSSSTTTDTTPSSEETLAS
FT                   SEGTGETLTVLAGEGAASIAARAGISVEQLQALNPEHMTQGYWYANPGDQVTIK"
FT   gene            700574..701254
FT                   /gene="cmk"
FT                   /locus_tag="spyM18_0865"
FT   CDS_pept        700574..701254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="spyM18_0865"
FT                   /product="putative cytidylate kinase"
FT                   /note="best blastp match gb|AAK33740.1| (AE006531) putative
FT                   cytidylate kinase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0865"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97519"
FT                   /db_xref="GOA:Q8P1H8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1H8"
FT                   /protein_id="AAL97519.1"
FT                   /translation="MKAIKIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYIA
FT                   LTHGYTDKEVALILEELEKNPISFKKAKGGSQLVFLGDEDVTLAIRQNDVTNNVSWVSA
FT                   LPEIREELVHQQRRIAQAGGIIMDGRDIGTVVLPDAELKIFLVASVEERAERRYKENLE
FT                   KGIESDFETLKEEIAARDYKDSHRKVSPLKAAEDALIFDTTGVSIDGVVQFIQEKAEKI
FT                   VDMS"
FT   gene            701416..701946
FT                   /gene="infC"
FT                   /locus_tag="spyM18_0866"
FT   CDS_pept        701416..701946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="spyM18_0866"
FT                   /product="translation initiation factor IF-3"
FT                   /note="best blastp match sp|P58081|IF3_STRPY TRANSLATION
FT                   INITIATION FACTOR IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0866"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97520"
FT                   /db_xref="GOA:P65148"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65148"
FT                   /protein_id="AAL97520.1"
FT                   /translation="MKIIAKKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQSLADAS
FT                   NVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFE
FT                   TKLRNGRKFLEKGNKVKVSIRFKGRMITHKEIGAKVLADFAEATQDIAIIEQRAKMDGR
FT                   QMFMQLAPISDKK"
FT   gene            701988..702185
FT                   /gene="rpl35"
FT                   /locus_tag="spyM18_0867"
FT   CDS_pept        701988..702185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl35"
FT                   /locus_tag="spyM18_0867"
FT                   /product="50S ribosomal protein L35"
FT                   /note="best blastp match gb|AAK33742.1| (AE006531) 50S
FT                   ribosomal protein L35 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0867"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97521"
FT                   /db_xref="GOA:Q8P1H7"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1H7"
FT                   /protein_id="AAL97521.1"
FT                   /translation="MPKQKTHRASAKRFKRTGSGGLKRFRAFTSHRFHGKTKKQRRHLR
FT                   KADLVSSGDFKRIKAMVTGL"
FT   gene            702244..702603
FT                   /gene="rl20"
FT                   /locus_tag="spyM18_0868"
FT   CDS_pept        702244..702603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rl20"
FT                   /locus_tag="spyM18_0868"
FT                   /product="50S ribosomal protein L20"
FT                   /note="best blastp match gb|AAK33743.1| (AE006531) 50S
FT                   ribosomal protein L20 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0868"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97522"
FT                   /db_xref="GOA:P66116"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66116"
FT                   /protein_id="AAL97522.1"
FT                   /translation="MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYY
FT                   AYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVADAA
FT                   AFTALADAAKAKLGK"
FT   gene            complement(702894..705065)
FT                   /locus_tag="spyM18_0869"
FT   CDS_pept        complement(702894..705065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0869"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33744.1| (AE006531)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0869"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97523"
FT                   /protein_id="AAL97523.1"
FT                   /translation="MKKFKTLITGFINTRLGFIITLLFCYWIKTLWAYHTDFSLDLGNI
FT                   YQVFLTIINPIPLAFLLLGVALYVKNTRAFYICSWVVYIILNILLISNSIYYREFSDFI
FT                   TVSAMLASSKVSAGLGDSALNLLRIWDIIYILDFIILISLSITKKIKNDQRPFNKRAAS
FT                   AITALSSLLLSINLFLAEIDRPELLTRGFSNTYIVRALGLPAFTLYSGNQTYQAQKERN
FT                   GATAEELIDVKTYVKGHYAAPDPQYFGIGKGKNIIVLHLESFQQFLIDYKLKEGDKEYE
FT                   VTPFINSLYHSNATLAFPNFFHQVKAGKTSDAETMMENSLFGLNSGSFMVNYGGENTQF
FT                   ATPSILAQKGGYTSAVFHGNVGTFWNRNNAYKQWGYNYFFDSSYFSKQNSKNSFQYGLN
FT                   DKYMFKDSIKYLEQMQQPFYTKFITVSNHYPYTSLKGESSEEGFPLAKTDDETINGYFA
FT                   TANYLDAALKSFFDYLKATGLYENSIFVLYGDHYGISNSRNSSLAPLLGKDSETWSEYD
FT                   NAMLQRVPYMIHIPGYTNGSIKETFGGEIDALPTLLHILGIDTSQFVQLGQDLLSPQNS
FT                   QIVAQRTSGTYMTPEYTNYSGRLYNTQTGLEITNPDEMTIAKTKEIRSAVAQQLAASDA
FT                   IQTGDLLRFDTQNGLKAIDPNQFIYTKQLKQLKDISAKLGSESTSLYSKNGHKSTQKLF
FT                   KAPSYLELNPVEADAATSELKEDNTKNRE"
FT   gene            705212..706375
FT                   /locus_tag="spyM18_0870"
FT   CDS_pept        705212..706375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0870"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33745.1| (AE006532)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0870"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97524"
FT                   /protein_id="AAL97524.1"
FT                   /translation="MNKLYIDSFVEKKLTAGVQLLDEKDFSNIKEKNQLVQLVTKSNRP
FT                   IGTAYISKQNKGIGWYLGPEKIDLSISYFVSLFSVAKAKRQDFAQSDETNAYRLFNQEG
FT                   DGFGGVTIDLYKDFAVFSWYNAFVYDKKEMIMEAFQQVFPEVKGAYEKCRFKGPDTETA
FT                   HLYGELAQETFSILENGIAYQVFLNEGLMTGIFLDQHDVRRALVDGLAMGKSLLNLFSY
FT                   TAAFSVAAAMGGAIETTSVDLAKRSRELSLAHFEHNQLNLASHHFVVMDVFEYFKYAKR
FT                   KKLIFDVIVIDPPSFARNKKQTFSVSRDYHKLITEALDILSPKGTIIASTNAANMTVSQ
FT                   FKKQIIKGFGSRRPESMTLQQLPSDFTINKADERSNYLKVFTIKVRE"
FT   gene            706372..707058
FT                   /gene="aroD"
FT                   /locus_tag="spyM18_0871"
FT   CDS_pept        706372..707058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="spyM18_0871"
FT                   /product="putative 3-dehydroquinate dehydratase"
FT                   /note="best blastp match gb|AAK33746.1| (AE006532) putative
FT                   3-dehydroquinate dehydratase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0871"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97525"
FT                   /db_xref="GOA:P63592"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63592"
FT                   /protein_id="AAL97525.1"
FT                   /translation="MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVA
FT                   PAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVF
FT                   QEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRG
FT                   FKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVL
FT                   EMDISN"
FT   gene            707152..708318
FT                   /gene="aroC"
FT                   /locus_tag="spyM18_0872"
FT   CDS_pept        707152..708318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="spyM18_0872"
FT                   /product="putative chorismate synthase"
FT                   /note="best blastp match gb|AAK33747.1| (AE006532) putative
FT                   chorismate synthase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0872"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97526"
FT                   /db_xref="GOA:Q8P1H5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1H5"
FT                   /protein_id="AAL97526.1"
FT                   /translation="MRYLTAGESHGLSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGR
FT                   GARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVK
FT                   HPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILI
FT                   FGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIV
FT                   QGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPT
FT                   QGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDP
FT                   TALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF"
FT   gene            708379..708720
FT                   /locus_tag="spyM18_0873"
FT   CDS_pept        708379..708720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0873"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33748.1| (AE006532)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0873"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97527"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1H4"
FT                   /protein_id="AAL97527.1"
FT                   /translation="MSQEIYDYANQLERAVRALPEYQKVLEVKEAIQADASASQLFDEF
FT                   VAMQEKIQGMMQSGQMPTAEEQTSIQELSQKIEANDQLKAYFEAQQALSVYMSDIERIV
FT                   FAPLKDLVK"
FT   gene            708941..710293
FT                   /gene="gshR"
FT                   /locus_tag="spyM18_0875"
FT   CDS_pept        708941..710293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshR"
FT                   /locus_tag="spyM18_0875"
FT                   /product="putative glutathione reductase"
FT                   /note="best blastp match gb|AAK33749.1| (AE006532) putative
FT                   glutathione reductase (GR) [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0875"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97528"
FT                   /protein_id="AAL97528.1"
FT                   /translation="MVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTCVNL
FT                   GCVPKKVMWYGAQVADILGTYAKDYGFDFKEKAFDFKQLKANRQAYIDRIHASYERSFE
FT                   QNGVDRIYDYAVFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISSDGFFAL
FT                   DEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKAIVDVLVEEMTVGG
FT                   PCLHPHSEVAKVVKNTDESLTLYLKDGQEVEVDQLIWAIGRKPNLEGFGLDKTGVTLND
FT                   KGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAAGRRLSERLFNNKTDEKLDYQNVA
FT                   TVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTVGDT
FT                   EKIVGLHGIGYGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR"
FT   gene            complement(710381..711649)
FT                   /gene="folC"
FT                   /locus_tag="spyM18_0876"
FT   CDS_pept        complement(710381..711649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="spyM18_0876"
FT                   /product="putative folyl-polyglutamate synthetase"
FT                   /note="best blastp match gb|AAK33750.1| (AE006532) putative
FT                   folyl-polyglutamate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0876"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97529"
FT                   /protein_id="AAL97529.1"
FT                   /translation="MTTYDSISWIHTFKANGRKTDLARMAWLLEALGRPQDKFPAIHVV
FT                   GTNGKGSVTAYLQHILSTSGYQVGTFTSPFIISFHDRICLNGQPISDLELAQCVSVIRP
FT                   ILTKMSLETNWDRPTEFELVTLIMFCYFANLKPVDIAIIEAGIGGKTDATNVFHALAVV
FT                   CPSISFDHQERLGYSLAEIAHQKAEVIKAKEPVIIGQLEQEASQVFQQVTQKAGSRLYQ
FT                   LGKDFLLKPSEKTFSFQHDNLNLTKLRLKLLGQHQKANACLAIMTAQLLRKSFPKISPK
FT                   TIQKGIETTTWPGRFEFIQPNLLLDGAHNPDSIAKLKSLLQEEFPKRPIHILFAGLKRK
FT                   PLADLLAQLDTFEVSVTTFDFPEANLLEDYPDKYPQVKDYRDWLQGSVTSDELFVVTGS
FT                   LYFISEVRQYCLSNANIFKNIFP"
FT   gene            complement(711679..712119)
FT                   /locus_tag="spyM18_0877"
FT   CDS_pept        complement(711679..712119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0877"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33751.1| (AE006532)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0877"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97530"
FT                   /protein_id="AAL97530.1"
FT                   /translation="MSSHYSRQQKPRKSGGVPTEHIKTGFTAFQKSIALIGSILSIIVA
FT                   TITITRALQPVPDKTSNDTPKESSNTIVKIIEKESSQGNQNHTGTSETTDDNKTTLPSS
FT                   STTPSHNETTPTAPETPSTTEGTQLPNATGAEDANTGLPTNP"
FT   gene            712354..713496
FT                   /gene="nifS"
FT                   /locus_tag="spyM18_0878"
FT   CDS_pept        712354..713496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="spyM18_0878"
FT                   /product="putative iron-sulfur cofactor synthesis protein"
FT                   /note="best blastp match gb|AAK33752.1| (AE006532) putative
FT                   iron-sulfur cofactor synthesis protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0878"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97531"
FT                   /protein_id="AAL97531.1"
FT                   /translation="MIYFDNAATTIPYGEALKTYQEVATKIYGNPSSLHQLGTNASRIL
FT                   EASRKQIAGLLGVKSEEIFFTSGGTESANWAIKGIAFEKTAFGKHIIISAIEHPAVSES
FT                   VKWLLTQGFEVSYAPVTTQGVVDVNALAELIRPDTILISIMAVNNEMGAIQPIRAISNL
FT                   LANQPTITFHVDAVQAIGKIPLCDYMTNRVDLASFSGHKFHSVRGVGFLYKKAGKRLNP
FT                   LLSGGGQEQELRSTTENVAGIASMAKALRIVTEKQVSVLPKLTAMRDVIYKALSAYPDV
FT                   TVFSAQEGFVPNILTFGIRGVRGEVIVHAFEKYEIYISTTSACSSKAGKPAGSLVAMGI
FT                   PVKTAQTAVRISLDDDNDMGQVEQFLTIFKQIYDKTQKVR"
FT   gene            713508..714722
FT                   /gene="thiI"
FT                   /locus_tag="spyM18_0879"
FT   CDS_pept        713508..714722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="spyM18_0879"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /note="best blastp match gb|AAK33753.1| (AE006532) putative
FT                   thiamine biosynthesis protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0879"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97532"
FT                   /db_xref="GOA:Q8P1G9"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1G9"
FT                   /protein_id="AAL97532.1"
FT                   /translation="MDYSEIMVRHGELSTKGKNRMRFINKLKNNIQDVLAPFPAITVRS
FT                   DRDRTHVYLNGTDYQPVVEALKLVFGVQALSPVYKLEKSVPLLVTAVQDIMTSLYRDGL
FT                   TFKIATKRSDHAFELDSRELNSLLGGAVFEVLPNIQAQMKHPDVTLKVEIRDEAAYISY
FT                   EEIKGAGGLPVGTSGKGMLMLSGGIDSPVAGYLALKRGLDIEVVHFASPPYTSPGALAK
FT                   AQDLTRRLTRFGGNIQFIEVPFTEIQEEIKNKAPEAYLMTLTRRFMMRITDAIREQRKG
FT                   LVIVNGESLGQVASQTLESMQAINAVTSTPIIRPVVTMDKLEIIEMAQAIDTFDISIQP
FT                   FEDCCTIFAPDRPKTNPKLGNAEKYEERFDIDGLVQRAVSGIVVTEITPEIVNDEVENL
FT                   IDALL"
FT   gene            714760..716052
FT                   /locus_tag="spyM18_0880"
FT   CDS_pept        714760..716052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0880"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33754.1| (AE006532)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0880"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97533"
FT                   /protein_id="AAL97533.1"
FT                   /translation="MILLKSLYKGFFAAMKEENFEARCYNREKGGCVLIKTIPYKKTMA
FT                   AVVALIVALLLFGLIYDLLGVQKNKLAAQKSAQPKVKTARVVANGDILIHDILYMSARK
FT                   ADDTYDFTPYFEYVKDWISGADLAIGDYEGTISPDYPLAGYPLFNAPEEIAGALKNTGY
FT                   DVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKESFLIKNVNGIKIAILG
FT                   YSYGYNGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTIVMPQMGTEYALEPTA
FT                   EQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMGNFISNQRLETVDDI
FT                   WTERGLLMDLTFEKKDNKTKIKTVEAHPTMVLAKGKGIVGKEGFELYNYRTMVLEDFIK
FT                   GGKYHDKIDEETKAKVALAYQEINDLVNLKW"
FT   gene            716176..717153
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0882"
FT   CDS_pept        716176..717153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra"
FT                   /locus_tag="spyM18_0882"
FT                   /product="putative transposase"
FT                   /note="best blastp match gb|AAA59388.1| (U11799) putative
FT                   transposase [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0882"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97534"
FT                   /protein_id="AAL97534.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLFTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGV"
FT   gene            717352..717666
FT                   /gene="rpL21"
FT                   /locus_tag="spyM18_0883"
FT   CDS_pept        717352..717666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpL21"
FT                   /locus_tag="spyM18_0883"
FT                   /product="50S ribosomal protein L21"
FT                   /note="best blastp match gb|AAK33755.1| (AE006533) 50S
FT                   ribosomal protein L21 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0883"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97535"
FT                   /db_xref="GOA:Q7CNC3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CNC3"
FT                   /protein_id="AAL97535.1"
FT                   /translation="MSTYAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGG
FT                   DKTVVGTPVVEGATVVGTVEKQGKQKKVVTFKYKPKKGSHRKQGHRQPYTKVVINAINA
FT                   "
FT   gene            717678..718004
FT                   /locus_tag="spyM18_0884"
FT   CDS_pept        717678..718004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0884"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33756.1| (AE006533)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0884"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97536"
FT                   /protein_id="AAL97536.1"
FT                   /translation="MIKAIFTRQKNGQLSSVTLTGHAGSGKHGFDIVCASVSTLAINFV
FT                   NSLEVLADCQALVDLNDVEGGYMAITIPPHDNKEEVQLLFESFLLGMTSLAKDSSKFVN
FT                   TQVI"
FT   gene            718032..718325
FT                   /gene="rpl27"
FT                   /locus_tag="spyM18_0885"
FT   CDS_pept        718032..718325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl27"
FT                   /locus_tag="spyM18_0885"
FT                   /product="50S ribosomal protein L27"
FT                   /note="best blastp match gb|AAK33757.1| (AE006533) 50S
FT                   ribosomal protein L27 [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0885"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97537"
FT                   /db_xref="GOA:P66139"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66139"
FT                   /protein_id="AAL97537.1"
FT                   /translation="MLKMNLANLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGG
FT                   SILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPVAK"
FT   gene            718471..718572
FT                   /locus_tag="spyM18_0886"
FT   CDS_pept        718471..718572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0886"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0886"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97538"
FT                   /protein_id="AAL97538.1"
FT                   /translation="MSVDIHGSLDSFTTKCIGFSSVLLKIVVAYLEQ"
FT   gene            718674..719588
FT                   /locus_tag="spyM18_0887"
FT   CDS_pept        718674..719588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0887"
FT                   /product="putative capsular polysaccharide"
FT                   /note="best blastp match gb|AAK33758.1| (AE006533) putative
FT                   capsular polysaccharide biosynthesis protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0887"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97539"
FT                   /protein_id="AAL97539.1"
FT                   /translation="MNIQQLRYVVAIANNGTFREAASKLFVSQPSLSVSIKDLEAELGF
FT                   QIFNRTTSGTVLTSQGLVFYEKALEVVKSFDSFEKTFSQADLDQNEFSIASQHYDFLPP
FT                   LITAFSQQYDGHRVFRIFESTTIQILDEVAQGNSEIGIIYLNVDNQKGLFQRMDKLGLE
FT                   YVSLIPFTTHIYLSKTHPLANREALYLNDIQGLPAVRFTQERDEYLYYSENFVDTSECP
FT                   RIYNVSDRATLNGILERTNAFATGSGFLDHRSVNGIKVIPLADHIDNQMIYVKRKDKNL
FT                   SVAGATFVTILKDYFNKRRKALT"
FT   gene            719585..720043
FT                   /gene="lspA"
FT                   /locus_tag="spyM18_0888"
FT   CDS_pept        719585..720043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="spyM18_0888"
FT                   /product="putative prolipoprotein signal peptidase"
FT                   /note="best blastp match gb|AAK33759.1| (AE006533) putative
FT                   prolipoprotein signal peptidase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0888"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97540"
FT                   /db_xref="GOA:Q8P1G4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1G4"
FT                   /protein_id="AAL97540.1"
FT                   /translation="MKKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPFIPGIVSLTY
FT                   LQNNGAAFSILQDQQWFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFI
FT                   DRLRLAYVIDMIHLDFVDFAIFNVADSYLTVGVILLVICLWKEEDYGN"
FT   gene            720033..720923
FT                   /gene="sfhB"
FT                   /locus_tag="spyM18_0889"
FT   CDS_pept        720033..720923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfhB"
FT                   /locus_tag="spyM18_0889"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33760.1| (AE006533)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0889"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97541"
FT                   /protein_id="AAL97541.1"
FT                   /translation="MEINVITSGQRLDKALADLSPLSRGQANDQIKQGLVLVNGQQKKA
FT                   KYTVQAGDVICFELPKEEVLEYQAQNIPLDIIYEDDALAIINKPQGMVVHPSAGHPSET
FT                   MVNALMYHIKDLSSINGVVRPGIVHRIDKDTSGLLMVAKTDAAHQALTEELKAKKSLRK
FT                   YLAIVHGNLPNDRGMIEAPIGRSEKDRKKQAVTAKGKEAVTRFTVLERFGDYSLVELQL
FT                   ETGRTHQIRVHMAYIGHPVAGDPLYGPRKTLSGHGQFLHAKTLGLTHPMTGKEMIFTVE
FT                   APEIFQKVLKLLRKK"
FT   gene            721319..721840
FT                   /gene="pyrR"
FT                   /locus_tag="spyM18_0890"
FT   CDS_pept        721319..721840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="spyM18_0890"
FT                   /product="putative pyrimidine regulatory protein"
FT                   /note="best blastp match gb|AAK33761.1| (AE006533) putative
FT                   pyrimidine regulatory protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0890"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97542"
FT                   /db_xref="GOA:P59013"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59013"
FT                   /protein_id="AAL97542.1"
FT                   /translation="MKTKEIVDDVTMKRAITRITYEIIERNKQLDNVVLAGIKTRGVFL
FT                   ARRIQERLHQLEGLDLPIGELDTKPFRDDMRVEEDTTLMSVDITGKDVILIDDVLYTGR
FT                   TIRAAIDNLVSLGRPARVSLAVLVDRGHRELPIRADYVGKNIPTSSVEEIVVEVVEVDG
FT                   RDRVSIIDPT"
FT   gene            721856..723115
FT                   /gene="pyrP"
FT                   /locus_tag="spyM18_0891"
FT   CDS_pept        721856..723115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrP"
FT                   /locus_tag="spyM18_0891"
FT                   /product="putative uracil permease"
FT                   /note="best blastp match gb|AAK33762.1| (AE006533) putative
FT                   uracil permease [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0891"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97543"
FT                   /protein_id="AAL97543.1"
FT                   /translation="MKDVIYDVEEVPKAGMLVGLSFQHLFAMFGATVLVPILVGIDPSV
FT                   ALLSSGLGTLAHLSVTKFKIPAYMGSSFAYIAAMQLLMKTNGIGAVAQGAMTGGLVYLI
FT                   AALIVKAIGNDWIDKILPPIVVGPIVMVIGLSLASTAVNDVMLKNGNYNLTYLVIGLVT
FT                   LLSVIFFNIYGKGIVAIVPLLLGLLVGYVVALLVGVLTGQEIVDFTNVAQAKWFSIPSV
FT                   EIPFLTYGVKFYPSAILTMAPIAFVTMTEHFGHIMVLNSLTKRDYFKDPGLEKTLTGDG
FT                   FAQIIAGFLGAPPVTSYGENIGVMALNKIFSVYVIAGAAVIAALLSFIGKVSALIQSIP
FT                   TPVIGGISVALFGVIASSGLKILIESKVDMDNKKNLLIASVILVSGIGGLMLQVNGLQI
FT                   SGVAFSTLLGIILYQVLPEK"
FT   gene            723176..724111
FT                   /gene="pyrB"
FT                   /locus_tag="spyM18_0892"
FT   CDS_pept        723176..724111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="spyM18_0892"
FT                   /product="putative aspartate transcarbamoylase"
FT                   /note="best blastp match gb|AAK33763.1| (AE006533) putative
FT                   aspartate transcarbamoylase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0892"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97544"
FT                   /db_xref="GOA:Q8P1G1"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1G1"
FT                   /protein_id="AAL97544.1"
FT                   /translation="MSVVNNRVALTNLVSMEALTTEEVLGLINRGSEYKAGKVVISDHQ
FT                   KDLVANLFFENSTRTHKSFEVAEKKLGLTVLDFNADASAVNKGESLYDTVLTMSALGTD
FT                   ICVIRHPEDDYYKELVESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKIA
FT                   IAGDLTHSRVAKSNMQILKRLGAELYFYGPEEWYSEAFNAYGTYIAIDQIIKELDVLML
FT                   LRVQHERHDGHQSFSKEGYHQAFGLTQERYQQLKDSAIIMHPAPVNRDVEIADSLVEAP
FT                   KARIVSQMANGVFVRMAIIEAILNGRNKNL"
FT   gene            724155..725237
FT                   /gene="carA"
FT                   /locus_tag="spyM18_0893"
FT   CDS_pept        724155..725237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="spyM18_0893"
FT                   /product="putative carbamoyl phosphate synthetase small
FT                   subunit"
FT                   /note="best blastp match gb|AAK33764.1| (AE006533) putative
FT                   carbamoyl phosphate synthetase small subunit [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0893"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97545"
FT                   /db_xref="GOA:P58894"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58894"
FT                   /protein_id="AAL97545.1"
FT                   /translation="MTKRLLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQ
FT                   SYNGQILTFTYPLIGNYGINRDDYESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIK
FT                   GIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQHLKDQLRATVLPTNTIEQVSTKTA
FT                   YPAPGIGKNIVLVDFGLKHSILREFSKRQCNITVVPFNITAEEVFQLNPDGLMLSNGPG
FT                   NPEDLPEALDMIRGVQGKIPIFGICMGHQLFSLANGAKTCKMTFGHRGFNHAVREIATG
FT                   RIDFTSQNHGYAVERSSLPDTLMVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHD
FT                   ASYLFDEFLEMIDSWRCTSK"
FT   gene            725441..728659
FT                   /gene="carB"
FT                   /locus_tag="spyM18_0895"
FT   CDS_pept        725441..728659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="spyM18_0895"
FT                   /product="putative carbamoylphosphate synthetase"
FT                   /note="best blastp match gb|AAK33765.1| (AE006533) putative
FT                   carbamoylphosphate synthetase [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0895"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97546"
FT                   /db_xref="GOA:P58941"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58941"
FT                   /protein_id="AAL97546.1"
FT                   /translation="MTLPLLVVFLVSLIMPKRKDIQKIMVIGSGPIIIGQAAEFDYAGT
FT                   QACLALKEEGYKVILVNSNPATIMTDKEIADKIYIEPLTLEFVNRIIRKERPDAILPTL
FT                   GGQTGLNMAMALSKAGILDDLEIELLGTKLSAIDQAEDRDLFKQLMQELDQPIPESTIV
FT                   KTVDEAVTFARDIGYPVIVRPAFTLGGTGGGICSSEEELCEITENGLKLSPVTQCLIER
FT                   SIAGFKEIEYEVMRDSADNALVVCNMENFDPVGIHTGDSIVFAPTQTLSDIENQMLRDA
FT                   SLKIIRALKIEGGCNVQLALDPYSFKYYVIEVNPRVSRSSALASKATGYPIAKLAAKIA
FT                   VGLTLDEMINPITGTTYAMFEPALDYVVAKIPRFPFDKFEHGERQLGTQMKATGEVMAI
FT                   GRNLEESLLKACRSLEIGVCHNEMTSLSNISDEELVTKVIKAQDDRLFYLSEAIRRGYS
FT                   IEELESLTKIDLFFLDKLLHIVEIEQELQMHVDHLESLKKAKRYGFSDQKIAEIWQKDE
FT                   SDIRAMRHSHSLCPVYKMVDTCAAEFDAKTPYFYSTYELENESVQSNKESILVLGSGPI
FT                   RIGQGVEFDYATVHSVKAIQKAGYEAIIMNSNPETVSTDFSVSDKLYFEPLTFEDVMNV
FT                   IDLEQPKGVIVQFGGQTAINLAQSLSDAGVTILGTQVEDLDRAEDRDLFEKALKELGIP
FT                   QPQGQTATNEEEALEAAKKIGFPVLVRPSYVLGGRAMEIVENKEDLREYIRTAVKASPE
FT                   HPILVDSYIFGKECEVDAISDGKSVLIPGIMEHIERAGVHSGDSMAVYPPQQLSKQIQE
FT                   TIAEYTKRLAIGLNCIGMMNVQFVIKNEQVYVIEVNPRASRTVPFLSKVTGIPMAQIAT
FT                   KLILGQTLKDLGYEDGLYPQSQLVHIKAPVFSFTKLAQVDSLLGPEMKSTGEVMGSDTS
FT                   LEKALYKAFEANNSHLSEFGQIVFTIADDSKAEALSLARRFKAIGYQIMATQGTAAYFA
FT                   EQGLSACLVGKIGDAANDIPTLVRHGHVQAIVNTVGIKRTADKDGQMIRSSAIEQGVPL
FT                   FTALDTAKAMLTVLESRCFNIEAI"
FT   gene            728834..730105
FT                   /locus_tag="spyM18_0896"
FT   CDS_pept        728834..730105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0896"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33766.1| (AE006534)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0896"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97547"
FT                   /protein_id="AAL97547.1"
FT                   /translation="MSKRGKIKITTKTKLITASVITLVLIITGVVLWKQQQNTLTADIA
FT                   KEPYSTVSVTEGSIASSTLLSGTVKALSEEYIYFDANKGNDATVTVKIGDQVTQGQQLV
FT                   QYNTTTAQSAYDTAVRSLNKIGRQINHLKTYGVPAVSTETNKDEATGEETTTTVQPSAQ
FT                   QNANYKQQLQDLNDAYADAQAEVNKAQIALNDTVVISSVSGTVVEVNNDIDPSSKNSQT
FT                   LVHVATEGQLQVKGTLTEYDLANVKVGQSVKIKSKVYSNQEWTGKISYVSNYPTESNAG
FT                   STTPAGSTGAGSSTGAAYDYKIDIISPLNQLKQGFTVSVEVVNEAKQALVPLTAVIKKD
FT                   KKHYVWTYDDATGKAKKVEVTLGNADAQQQEIHKGVAVGDIVIANPDKNIKPDKKLEGV
FT                   ISIGTNTKPEKDSQSKNKKSGVDK"
FT   gene            730129..730815
FT                   /locus_tag="spyM18_0897"
FT   CDS_pept        730129..730815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0897"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /note="best blastp match gb|AAK33767.1| (AE006534) putative
FT                   ABC transporter (ATP-binding protein) [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0897"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97548"
FT                   /protein_id="AAL97548.1"
FT                   /translation="MQLSNIVKSYQNGDQVLKVLKGINLTVYEGEFLAIMGPSGSGKST
FT                   LMNIIGLLDRPTSGDYTLHNTKIEILNDRELANVRNDEIGFVFQQFFLLAKLTALQNVE
FT                   LPLIYAGVNVSKRREQAKQFLEKVGLGRRIKHLPSELSGGQKQRVAIARALVNAPSIIL
FT                   ADEPTGALDTKTGQQIMELLTELNKEGKTIIMVTHEPEIADFATRKIIIRDGDITTDTT
FT                   ASVVID"
FT   gene            730827..732047
FT                   /locus_tag="spyM18_0898"
FT   CDS_pept        730827..732047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0898"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33768.1| (AE006534)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0898"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97549"
FT                   /protein_id="AAL97549.1"
FT                   /translation="MENWKFALSSIWGHKMRSILTMLGIIIGVAAVVIIMGLGNAMKNS
FT                   VTSTFSSKQKDIQLYFQEKGEEEDLYAGLHTHENNHEVKPEWLEQIVKDIDGIDSYYFT
FT                   NSAASTISYEKKKVDNASIIGVSKDYFNIKNYDIVAGRTLTDNDYSNFSRIILLDTVLA
FT                   DDLFGKGNYKSALNKVVSLSDKDYLVIGVYKTDQTPVSFDGLSGGAVMANTQVASEFGT
FT                   KEIGSIYIHVNDIQNSMNLGNQAADMLTNISHIKDGQYAVPDNSKIVEEINSQFSIMTT
FT                   VIGSIAAISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRLKILSQFLIESVVLTVL
FT                   GGLIGLLLAQLSVGALGNAMTLKGACISLDVALIAVLFSASIGVFFGMLPANKASKLDP
FT                   IEALRYE"
FT   gene            732301..734034
FT                   /locus_tag="spyM18_0899"
FT   CDS_pept        732301..734034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0899"
FT                   /product="putative glycerophosphodiester phosphodiesterase"
FT                   /note="best blastp match gb|AAK33769.1| (AE006534) putative
FT                   glycerophosphodiester phosphodiesterase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0899"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97550"
FT                   /protein_id="AAL97550.1"
FT                   /translation="MTFLSDLISLMTKIRLSWVIKAGIFQLLFVTIANIVLSEFFYFIL
FT                   DVTGQYHLDKDNVVTFLKNPIALALLGAYLFLLAAFIHLEFFALYRIIADQEISFYLFR
FT                   KQFSYYLRGLWKTFSGYQLLLFLLYILLTIPVLHIGLSSVITQKLYLPEFIVGELSKIT
FT                   STKYLLYGSLILVFYLNLRLVYFLPLIAINHRTVAQAWRESWQKTKKKHVLLWMKLFAI
FT                   NGLTIVVLSLAISMILIFVDMFNPKGNNIIVQLGALTFTWELIFFTTIFFKLCSAMILK
FT                   EAIEPQKQYDEPRRSNKAYVVIFIVVTVGFAYQSLERLTFFDTSHSKTVIAHRGLVSAG
FT                   VENSLEALEGAKKAGSDYVELDLILTKDNHFVVSHDNRLKRLAGVNKTIRNLTLKEVEH
FT                   LTSHQGHFSGRFVSFDTFYQKAKKLNMPLLIELKPIGTEPGNYVDLFLETYHRLGISKD
FT                   NKVMSLDLEVIEAIKKKNPSITTGYIIPIQFGFFGDEFVDFYVIEDFSYRSYLSSQAFW
FT                   NNKEIYVWTINDPKRIEHYLLKPIQGIITDQPALTNQLIKDLKQDNSYFSRLVRIISSL
FT                   Y"
FT   gene            734161..734433
FT                   /gene="rpsP"
FT                   /locus_tag="spyM18_0900"
FT   CDS_pept        734161..734433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="spyM18_0900"
FT                   /product="30S ribosomal protein S1"
FT                   /note="best blastp match sp|P58124|RS16_STRPY 30S RIBOSOMAL
FT                   PROTEIN S16"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0900"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97551"
FT                   /db_xref="GOA:P66448"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66448"
FT                   /protein_id="AAL97551.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVA
FT                   ENQITIKEDRVLEWLSKGAQPSDTVRNILSKAGVMAKFHDQKFSK"
FT   gene            734443..734682
FT                   /locus_tag="spyM18_0901"
FT   CDS_pept        734443..734682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0901"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33771.1| (AE006534)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0901"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97552"
FT                   /protein_id="AAL97552.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDNLTIKIEDTPDFLEYHLDLDAQDIG
FT                   RVIGKKGRTITAIRSIVYSVPTLGKKVRLVIDEK"
FT   gene            735614..738640
FT                   /locus_tag="spyM18_0903"
FT   CDS_pept        735614..738640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0903"
FT                   /product="hypothetical protein"
FT                   /note="best blastp match gb|AAK33772.1| (AE006534)
FT                   hypothetical protein [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0903"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97553"
FT                   /protein_id="AAL97553.1"
FT                   /translation="MKKHLKTVALTLTTVSVVTHNQEVFSLVKEPILKQTQASSSISGA
FT                   DYAESSGKSKLKINETSGPVDDTVTDLFSDKRTTPEKIKDNLAKGPREQELKAVTENTE
FT                   SEKQINSGSQLEQSKESLSLNKRVPSTSNWEICDFITKGNTLVGLSKSGVEKLSQTDHL
FT                   VLPSQAADGTQLIQVASFAFTPDKKTAIAEYTSRAGENGEISQLDVDGKEIINEGEVFN
FT                   SYLLKKVTIPTGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPDNLK
FT                   AIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRGNSLKVIGEASFQDNDLS
FT                   QLMLPDGLEKIESEAFTGNPGDDHYNNRVVLWTKSGKNPYGLATENTYVNPDKSLWQES
FT                   PEIDYTKWLEEDFTYQKNSVTGFSSKGLQKVKRNKNLEIPKQHNGVTITEIGDNAFRNV
FT                   DFQNKTLRKYDLEEVKLPSTIRKIGAFAFQSNNLKSFEASDDLEEIKEGAFMNNRIETL
FT                   ELKDKLVTIGDAAFHINHIYAIVLPESVQEIGRSAFRQNGANNLIFMGSKVKTLGEMAF
FT                   LSNRLEHLDLSEQKQLTEIPVQAFSDNALKEVLLPASLKTIREEAFKKNHLKQLEVASA
FT                   LSHIAFNALDDNDGDEQFDNKVVVKTHHNSYALADGEHFIVDPDKLSSTIVDLEKILKL
FT                   IEGLDYSTLRQTTQTQFRDMTTAGKALLSKSNLRQGEKQKFLQEAQFFLGRVDLDKAIA
FT                   KAEKALVTKKATKNGQLLERSINKAVLAYNNSAIKKANVKRLEKELDLLTGLVEGKGPL
FT                   AQATMVQGVYLLKTPLPLPEYYIGLNVYFDKSGKLIYALDMSDTIGEGQKDAYGNPILN
FT                   VDEDNEGYHALAVATLADYEGLDIKTILNSKLSQLTSIRQVPTAAYHRAGIFQAIQNAA
FT                   AEAEQLLPKPGTHSEKSSSSESANSKDRGLQSNPKTNRGRHSAILPRTGSKGSFVYGIL
FT                   GYTSVALLSLITAIKKKKY"
FT   gene            738660..739061
FT                   /locus_tag="spyM18_0904"
FT   CDS_pept        738660..739061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0904"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33773.1| (AE006534)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0904"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97554"
FT                   /protein_id="AAL97554.1"
FT                   /translation="MITQEMKDLINNQLAMVATVDAKGQPNIGPKRSMRLWDDKTFIYN
FT                   ENTDGQTRINIEDNGKIEIAFVDRERLLGYRFVGTAEIQTEGAYYEAAKKWAQGRMGVP
FT                   KAVGIIHVERIFNLQSGANAGKEINSESN"
FT   gene            complement(739241..740116)
FT                   /locus_tag="spyM18_0905"
FT   CDS_pept        complement(739241..740116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0905"
FT                   /product="putative cation-efflux system membrane protein"
FT                   /note="best blastp match gb|AAK33774.1| (AE006535) putative
FT                   cation-efflux system membrane protein [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0905"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97555"
FT                   /protein_id="AAL97555.1"
FT                   /translation="MPASKKVIIIFILNLSFSLIEFIFGTLFFSGAILADAVHDFGDAI
FT                   AIGISAILERKAVKKESSNFSLGYKRFSLLGALTTNLILISGSLLVMIETIPKLWHPTI
FT                   VNYDGMFVLAIFAIIINGFASFIIHSNQTKNEEILSLHFLEDILGWLAIIILSLILKWK
FT                   PWYILDPLLSIAIASFILSKALPKLVATANIFLDGVPDSIDYCALHHELSQLPHIVSVN
FT                   QLNVWSMDGIDHRATIHCCLRESTTEKHCKKSIRLICQRYNINSVTVEIDTSLNEHQHH
FT                   CSSLSSIEVN"
FT   gene            740252..740773
FT                   /locus_tag="spyM18_0906"
FT   CDS_pept        740252..740773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="spyM18_0906"
FT                   /product="conserved hypothetical protein"
FT                   /note="best blastp match gb|AAK33775.1| (AE006535)
FT                   conserved hypothetical protein [Streptococcus pyogenes M1
FT                   GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0906"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97556"
FT                   /protein_id="AAL97556.1"
FT                   /translation="MTKDRQIKKTKTAIYSAFLALLQKKEYSKITVRDMITLANVGRST
FT                   FYAHYESKEMLLKELCEELFHHLFRQKRNVTFEDYLVHILKHFEQNKDSIATLLLSNDP
FT                   YFLLRFKNELEHDVYPNLRCKYIDKTTIPEVFLKQFVLSSFIETLKWWLPQRQRMSANE
FT                   LLKYYLELIK"
FT   gene            740988..741506
FT                   /gene="rimM"
FT                   /locus_tag="spyM18_0907"
FT   CDS_pept        740988..741506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="spyM18_0907"
FT                   /product="putative 16S rRNA processing protein RIMM"
FT                   /note="best blastp match sp|P58183|RIMM_STRPY PROBABLE 16S
FT                   RRNA PROCESSING PROTEIN RIMM"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0907"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97557"
FT                   /db_xref="GOA:Q8P1F4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1F4"
FT                   /protein_id="AAL97557.1"
FT                   /translation="MEYFNVGKIVNTQGLQGEMRVLSVSDFAEERFKKGSQLALFDDKD
FT                   QFVQEVTIVSHRKQKHFDIIKFKDMYHINAIEKYKGYTLKVSKANQGDLQEGEFYYHQI
FT                   IGMAVYEKDRLIGYVKEILQPGANDVWVVKRQGKRDLLLPYIPPVVLSVDVPNKRVDVE
FT                   LMEGLDDED"
FT   gene            741496..742215
FT                   /gene="trmD"
FT                   /locus_tag="spyM18_0908"
FT   CDS_pept        741496..742215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="spyM18_0908"
FT                   /product="putative tRNA (guanine-N1)-methyltransferase"
FT                   /note="best blastp match gb|AAK33777.1| (AE006535) putative
FT                   tRNA (guanine-N1)-methyltransferase [Streptococcus pyogenes
FT                   M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0908"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97558"
FT                   /db_xref="GOA:Q8P1F3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1F3"
FT                   /protein_id="AAL97558.1"
FT                   /translation="MKIDILTLFPEMFAPLEHSIVGKAKEKGLLDIHYHNFRDYAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDTIEQIEVKKPRIILLDPAGKPFTQAYAEELALEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERYD
FT                   FSEEERKLLDKIKEALG"
FT   gene            742227..743219
FT                   /gene="trxB"
FT                   /locus_tag="spyM18_0909"
FT   CDS_pept        742227..743219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="spyM18_0909"
FT                   /product="putative thioredoxin reductase"
FT                   /note="best blastp match gb|AAK33778.1| (AE006535) putative
FT                   thioredoxin reductase [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:spyM18_0909"
FT                   /db_xref="EnsemblGenomes-Tr:AAL97559"
FT                   /db_xref="GOA:Q8P1F2"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8P1F2"
FT                   /protein_id="AAL97559.1"
FT                   /translation="MKDKAYDITIIGGGPIGLFAAFYAGLRGVTVKIIESLSELGGQPA
FT