(data stored in ACNUC7421 zone)

EMBL: AE009951

ID   AE009951; SV 2; circular; genomic DNA; STD; PRO; 2174500 BP.
AC   AE009951; AE010459-AE010655;
PR   Project:PRJNA295;
DT   27-JUN-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
DE   Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome.
KW   .
OS   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
OC   Bacteria; Fusobacteria; Fusobacteriales; Fusobacteriaceae; Fusobacterium.
RN   [1]
RP   1-2174500
RX   DOI; 10.1128/JB.184.7.2005-2018.2002.
RX   PUBMED; 11889109.
RA   Kapatral V., Anderson I., Ivanova N., Reznik G., Los T., Lykidis A.,
RA   Bhattacharyya A., Bartman A., Gardner W., Grechkin G., Zhu L., Vasieva O.,
RA   Chu L., Kogan Y., Chaga O., Goltsman E., Bernal A., Larsen N., D'Souza M.,
RA   Walunas T., Pusch G., Haselkorn R., Fonstein M., Kyrpides N., Overbeek R.;
RT   "Genome sequence and analysis of the oral bacterium Fusobacterium nucleatum
RT   strain ATCC 25586";
RL   J. Bacteriol. 184(7):2005-2018(2002).
RN   [2]
RP   1-2174500
RA   Kapatral V., Anderson I., Ivanova N., Reznik G., Los T., Lykidis A.,
RA   Bhattacharayya A., Bartman A., Gardner W., Grechkin G., Zhu L., Chu L.,
RA   Kogan Y., Chaga O., Goltsman E., Bernal A., Larsen N., D'Souza M.,
RA   Walunas T., Pusch G.D., Haselkorn R., Fonstein M., Kyrpides N.,
RA   Overbeek R.;
RT   ;
RL   Submitted (13-FEB-2002) to the INSDC.
RL   Integrated Genomics, 2201 W. Campbell Park Drive, Chicago, IL 60612, USA
DR   MD5; f1e8cff527dfbc1871e22c6f5825175c.
DR   BioSample; SAMN02603417.
DR   EnsemblGenomes-Gn; EBG00000007594.
DR   EnsemblGenomes-Gn; EBG00000007598.
DR   EnsemblGenomes-Gn; EBG00000007601.
DR   EnsemblGenomes-Gn; EBG00000007603.
DR   EnsemblGenomes-Gn; EBG00000007621.
DR   EnsemblGenomes-Gn; EBG00000007622.
DR   EnsemblGenomes-Gn; EBG00000007623.
DR   EnsemblGenomes-Gn; EBG00000007624.
DR   EnsemblGenomes-Gn; EBG00000007625.
DR   EnsemblGenomes-Gn; EBG00000007635.
DR   EnsemblGenomes-Gn; EBG00000007647.
DR   EnsemblGenomes-Gn; EBG00000007649.
DR   EnsemblGenomes-Gn; EBG00000007651.
DR   EnsemblGenomes-Gn; EBG00000007653.
DR   EnsemblGenomes-Gn; EBG00000007655.
DR   EnsemblGenomes-Gn; EBG00000007656.
DR   EnsemblGenomes-Gn; EBG00000007657.
DR   EnsemblGenomes-Gn; EBG00000007659.
DR   EnsemblGenomes-Gn; EBG00000007660.
DR   EnsemblGenomes-Gn; EBG00000007662.
DR   EnsemblGenomes-Gn; EBG00000007665.
DR   EnsemblGenomes-Gn; EBG00000007669.
DR   EnsemblGenomes-Gn; EBG00000007671.
DR   EnsemblGenomes-Gn; EBG00000007673.
DR   EnsemblGenomes-Gn; EBG00000007675.
DR   EnsemblGenomes-Gn; EBG00000007676.
DR   EnsemblGenomes-Gn; EBG00000007678.
DR   EnsemblGenomes-Gn; EBG00000007681.
DR   EnsemblGenomes-Gn; EBG00000007683.
DR   EnsemblGenomes-Gn; EBG00000007685.
DR   EnsemblGenomes-Gn; EBG00000007686.
DR   EnsemblGenomes-Gn; EBG00000007688.
DR   EnsemblGenomes-Gn; EBG00000007689.
DR   EnsemblGenomes-Gn; EBG00000007691.
DR   EnsemblGenomes-Gn; EBG00000007693.
DR   EnsemblGenomes-Gn; EBG00000007695.
DR   EnsemblGenomes-Gn; EBG00000007697.
DR   EnsemblGenomes-Gn; EBG00000007700.
DR   EnsemblGenomes-Gn; EBG00000007701.
DR   EnsemblGenomes-Gn; EBG00000007702.
DR   EnsemblGenomes-Gn; EBG00000007707.
DR   EnsemblGenomes-Gn; EBG00000007709.
DR   EnsemblGenomes-Gn; EBG00000007710.
DR   EnsemblGenomes-Gn; EBG00000007711.
DR   EnsemblGenomes-Gn; EBG00000007712.
DR   EnsemblGenomes-Gn; EBG00000007715.
DR   EnsemblGenomes-Gn; EBG00000007716.
DR   EnsemblGenomes-Gn; EBG00000007718.
DR   EnsemblGenomes-Gn; EBG00000007719.
DR   EnsemblGenomes-Gn; EBG00000007721.
DR   EnsemblGenomes-Gn; EBG00000007724.
DR   EnsemblGenomes-Gn; EBG00000007726.
DR   EnsemblGenomes-Gn; EBG00000007727.
DR   EnsemblGenomes-Gn; EBG00000007729.
DR   EnsemblGenomes-Gn; EBG00000007730.
DR   EnsemblGenomes-Gn; EBG00000007731.
DR   EnsemblGenomes-Gn; EBG00000007733.
DR   EnsemblGenomes-Gn; EBG00000007734.
DR   EnsemblGenomes-Gn; EBG00000007737.
DR   EnsemblGenomes-Gn; EBG00000007738.
DR   EnsemblGenomes-Gn; EBG00000007739.
DR   EnsemblGenomes-Gn; EBG00000007740.
DR   EnsemblGenomes-Gn; EBG00001184888.
DR   EnsemblGenomes-Gn; EBG00001184889.
DR   EnsemblGenomes-Gn; EBG00001184890.
DR   EnsemblGenomes-Gn; EBG00001184891.
DR   EnsemblGenomes-Gn; EBG00001184892.
DR   EnsemblGenomes-Gn; EBG00001184893.
DR   EnsemblGenomes-Gn; EBG00001184894.
DR   EnsemblGenomes-Gn; EBG00001184895.
DR   EnsemblGenomes-Gn; EBG00001184896.
DR   EnsemblGenomes-Gn; EBG00001184897.
DR   EnsemblGenomes-Gn; EBG00001184898.
DR   EnsemblGenomes-Gn; EBG00001184899.
DR   EnsemblGenomes-Gn; EBG00001184900.
DR   EnsemblGenomes-Gn; EBG00001184901.
DR   EnsemblGenomes-Gn; EBG00001184902.
DR   EnsemblGenomes-Gn; EBG00001184903.
DR   EnsemblGenomes-Gn; EBG00001184904.
DR   EnsemblGenomes-Gn; EBG00001184905.
DR   EnsemblGenomes-Gn; EBG00001184906.
DR   EnsemblGenomes-Gn; EBG00001184907.
DR   EnsemblGenomes-Gn; EBG00001184908.
DR   EnsemblGenomes-Gn; EBG00001184909.
DR   EnsemblGenomes-Gn; EBG00001184910.
DR   EnsemblGenomes-Gn; EBG00001184911.
DR   EnsemblGenomes-Gn; EBG00001184912.
DR   EnsemblGenomes-Gn; EBG00001184913.
DR   EnsemblGenomes-Gn; EBG00001184914.
DR   EnsemblGenomes-Gn; EBG00001184915.
DR   EnsemblGenomes-Gn; EBG00001184916.
DR   EnsemblGenomes-Gn; EBG00001184917.
DR   EnsemblGenomes-Gn; EBG00001184918.
DR   EnsemblGenomes-Gn; EBG00001184919.
DR   EnsemblGenomes-Gn; EBG00001184920.
DR   EnsemblGenomes-Gn; EBG00001184921.
DR   EnsemblGenomes-Gn; EBG00001184922.
DR   EnsemblGenomes-Gn; EBG00001184923.
DR   EnsemblGenomes-Gn; EBG00001184924.
DR   EnsemblGenomes-Gn; EBG00001184925.
DR   EnsemblGenomes-Gn; EBG00001184926.
DR   EnsemblGenomes-Gn; EBG00001184927.
DR   EnsemblGenomes-Gn; EBG00001184928.
DR   EnsemblGenomes-Gn; EBG00001184929.
DR   EnsemblGenomes-Gn; EBG00001184930.
DR   EnsemblGenomes-Gn; EBG00001184931.
DR   EnsemblGenomes-Gn; EBG00001184932.
DR   EnsemblGenomes-Gn; EBG00001184933.
DR   EnsemblGenomes-Gn; EBG00001184934.
DR   EnsemblGenomes-Gn; EBG00001184935.
DR   EnsemblGenomes-Gn; EBG00001184936.
DR   EnsemblGenomes-Gn; EBG00001184937.
DR   EnsemblGenomes-Gn; EBG00001184938.
DR   EnsemblGenomes-Gn; EBG00001184939.
DR   EnsemblGenomes-Gn; EBG00001184940.
DR   EnsemblGenomes-Gn; EBG00001184941.
DR   EnsemblGenomes-Gn; EBG00001184942.
DR   EnsemblGenomes-Gn; EBG00001184943.
DR   EnsemblGenomes-Gn; EBG00001184944.
DR   EnsemblGenomes-Gn; EBG00001184945.
DR   EnsemblGenomes-Gn; EBG00001184946.
DR   EnsemblGenomes-Gn; EBG00001184947.
DR   EnsemblGenomes-Gn; EBG00001184948.
DR   EnsemblGenomes-Gn; EBG00001184949.
DR   EnsemblGenomes-Gn; EBG00001184950.
DR   EnsemblGenomes-Gn; EBG00001184951.
DR   EnsemblGenomes-Gn; EBG00001184952.
DR   EnsemblGenomes-Gn; EBG00001184953.
DR   EnsemblGenomes-Gn; EBG00001184954.
DR   EnsemblGenomes-Gn; EBG00001184955.
DR   EnsemblGenomes-Gn; EBG00001184956.
DR   EnsemblGenomes-Gn; EBG00001184957.
DR   EnsemblGenomes-Tr; EBG00000007594-1.
DR   EnsemblGenomes-Tr; EBG00000007598-1.
DR   EnsemblGenomes-Tr; EBG00000007601-1.
DR   EnsemblGenomes-Tr; EBG00000007603-1.
DR   EnsemblGenomes-Tr; EBG00000007621-1.
DR   EnsemblGenomes-Tr; EBG00000007622-1.
DR   EnsemblGenomes-Tr; EBG00000007623-1.
DR   EnsemblGenomes-Tr; EBG00000007624-1.
DR   EnsemblGenomes-Tr; EBG00000007625-1.
DR   EnsemblGenomes-Tr; EBG00000007635-1.
DR   EnsemblGenomes-Tr; EBG00000007647-1.
DR   EnsemblGenomes-Tr; EBG00000007649-1.
DR   EnsemblGenomes-Tr; EBG00000007651-1.
DR   EnsemblGenomes-Tr; EBG00000007653-1.
DR   EnsemblGenomes-Tr; EBG00000007655-1.
DR   EnsemblGenomes-Tr; EBG00000007656-1.
DR   EnsemblGenomes-Tr; EBG00000007657-1.
DR   EnsemblGenomes-Tr; EBG00000007659-1.
DR   EnsemblGenomes-Tr; EBG00000007660-1.
DR   EnsemblGenomes-Tr; EBG00000007662-1.
DR   EnsemblGenomes-Tr; EBG00000007665-1.
DR   EnsemblGenomes-Tr; EBG00000007669-1.
DR   EnsemblGenomes-Tr; EBG00000007671-1.
DR   EnsemblGenomes-Tr; EBG00000007673-1.
DR   EnsemblGenomes-Tr; EBG00000007675-1.
DR   EnsemblGenomes-Tr; EBG00000007676-1.
DR   EnsemblGenomes-Tr; EBG00000007678-1.
DR   EnsemblGenomes-Tr; EBG00000007681-1.
DR   EnsemblGenomes-Tr; EBG00000007683-1.
DR   EnsemblGenomes-Tr; EBG00000007685-1.
DR   EnsemblGenomes-Tr; EBG00000007686-1.
DR   EnsemblGenomes-Tr; EBG00000007688-1.
DR   EnsemblGenomes-Tr; EBG00000007689-1.
DR   EnsemblGenomes-Tr; EBG00000007691-1.
DR   EnsemblGenomes-Tr; EBG00000007693-1.
DR   EnsemblGenomes-Tr; EBG00000007695-1.
DR   EnsemblGenomes-Tr; EBG00000007697-1.
DR   EnsemblGenomes-Tr; EBG00000007700-1.
DR   EnsemblGenomes-Tr; EBG00000007701-1.
DR   EnsemblGenomes-Tr; EBG00000007702-1.
DR   EnsemblGenomes-Tr; EBG00000007707-1.
DR   EnsemblGenomes-Tr; EBG00000007709-1.
DR   EnsemblGenomes-Tr; EBG00000007710-1.
DR   EnsemblGenomes-Tr; EBG00000007711-1.
DR   EnsemblGenomes-Tr; EBG00000007712-1.
DR   EnsemblGenomes-Tr; EBG00000007715-1.
DR   EnsemblGenomes-Tr; EBG00000007716-1.
DR   EnsemblGenomes-Tr; EBG00000007718-1.
DR   EnsemblGenomes-Tr; EBG00000007719-1.
DR   EnsemblGenomes-Tr; EBG00000007721-1.
DR   EnsemblGenomes-Tr; EBG00000007724-1.
DR   EnsemblGenomes-Tr; EBG00000007726-1.
DR   EnsemblGenomes-Tr; EBG00000007727-1.
DR   EnsemblGenomes-Tr; EBG00000007729-1.
DR   EnsemblGenomes-Tr; EBG00000007730-1.
DR   EnsemblGenomes-Tr; EBG00000007731-1.
DR   EnsemblGenomes-Tr; EBG00000007733-1.
DR   EnsemblGenomes-Tr; EBG00000007734-1.
DR   EnsemblGenomes-Tr; EBG00000007737-1.
DR   EnsemblGenomes-Tr; EBG00000007738-1.
DR   EnsemblGenomes-Tr; EBG00000007739-1.
DR   EnsemblGenomes-Tr; EBG00000007740-1.
DR   EnsemblGenomes-Tr; EBT00001763195.
DR   EnsemblGenomes-Tr; EBT00001763196.
DR   EnsemblGenomes-Tr; EBT00001763197.
DR   EnsemblGenomes-Tr; EBT00001763198.
DR   EnsemblGenomes-Tr; EBT00001763199.
DR   EnsemblGenomes-Tr; EBT00001763200.
DR   EnsemblGenomes-Tr; EBT00001763201.
DR   EnsemblGenomes-Tr; EBT00001763202.
DR   EnsemblGenomes-Tr; EBT00001763203.
DR   EnsemblGenomes-Tr; EBT00001763204.
DR   EnsemblGenomes-Tr; EBT00001763205.
DR   EnsemblGenomes-Tr; EBT00001763206.
DR   EnsemblGenomes-Tr; EBT00001763207.
DR   EnsemblGenomes-Tr; EBT00001763208.
DR   EnsemblGenomes-Tr; EBT00001763209.
DR   EnsemblGenomes-Tr; EBT00001763210.
DR   EnsemblGenomes-Tr; EBT00001763211.
DR   EnsemblGenomes-Tr; EBT00001763212.
DR   EnsemblGenomes-Tr; EBT00001763213.
DR   EnsemblGenomes-Tr; EBT00001763214.
DR   EnsemblGenomes-Tr; EBT00001763215.
DR   EnsemblGenomes-Tr; EBT00001763216.
DR   EnsemblGenomes-Tr; EBT00001763217.
DR   EnsemblGenomes-Tr; EBT00001763218.
DR   EnsemblGenomes-Tr; EBT00001763219.
DR   EnsemblGenomes-Tr; EBT00001763220.
DR   EnsemblGenomes-Tr; EBT00001763221.
DR   EnsemblGenomes-Tr; EBT00001763222.
DR   EnsemblGenomes-Tr; EBT00001763223.
DR   EnsemblGenomes-Tr; EBT00001763224.
DR   EnsemblGenomes-Tr; EBT00001763225.
DR   EnsemblGenomes-Tr; EBT00001763226.
DR   EnsemblGenomes-Tr; EBT00001763227.
DR   EnsemblGenomes-Tr; EBT00001763228.
DR   EnsemblGenomes-Tr; EBT00001763229.
DR   EnsemblGenomes-Tr; EBT00001763230.
DR   EnsemblGenomes-Tr; EBT00001763231.
DR   EnsemblGenomes-Tr; EBT00001763232.
DR   EnsemblGenomes-Tr; EBT00001763233.
DR   EnsemblGenomes-Tr; EBT00001763234.
DR   EnsemblGenomes-Tr; EBT00001763235.
DR   EnsemblGenomes-Tr; EBT00001763236.
DR   EnsemblGenomes-Tr; EBT00001763237.
DR   EnsemblGenomes-Tr; EBT00001763238.
DR   EnsemblGenomes-Tr; EBT00001763239.
DR   EnsemblGenomes-Tr; EBT00001763240.
DR   EnsemblGenomes-Tr; EBT00001763241.
DR   EnsemblGenomes-Tr; EBT00001763242.
DR   EnsemblGenomes-Tr; EBT00001763243.
DR   EnsemblGenomes-Tr; EBT00001763244.
DR   EnsemblGenomes-Tr; EBT00001763245.
DR   EnsemblGenomes-Tr; EBT00001763246.
DR   EnsemblGenomes-Tr; EBT00001763247.
DR   EnsemblGenomes-Tr; EBT00001763248.
DR   EnsemblGenomes-Tr; EBT00001763249.
DR   EnsemblGenomes-Tr; EBT00001763250.
DR   EnsemblGenomes-Tr; EBT00001763251.
DR   EnsemblGenomes-Tr; EBT00001763252.
DR   EnsemblGenomes-Tr; EBT00001763253.
DR   EnsemblGenomes-Tr; EBT00001763254.
DR   EnsemblGenomes-Tr; EBT00001763255.
DR   EnsemblGenomes-Tr; EBT00001763256.
DR   EnsemblGenomes-Tr; EBT00001763257.
DR   EnsemblGenomes-Tr; EBT00001763258.
DR   EnsemblGenomes-Tr; EBT00001763259.
DR   EnsemblGenomes-Tr; EBT00001763260.
DR   EnsemblGenomes-Tr; EBT00001763261.
DR   EnsemblGenomes-Tr; EBT00001763262.
DR   EnsemblGenomes-Tr; EBT00001763263.
DR   EnsemblGenomes-Tr; EBT00001763264.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC134920; 11889109.
DR   EuropePMC; PMC1538689; 16870757.
DR   EuropePMC; PMC2815611; 19955278.
DR   EuropePMC; PMC3149608; 21826218.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC3201879; 21745821.
DR   EuropePMC; PMC3237422; 22194794.
DR   EuropePMC; PMC3534352; 22989070.
DR   EuropePMC; PMC3993497; 24430451.
DR   EuropePMC; PMC4234264; 25155235.
DR   EuropePMC; PMC4448311; 25928324.
DR   GOA; P68994.
DR   GOA; P68997.
DR   InterPro; IPR000271; Ribosomal_L34.
DR   InterPro; IPR000473; Ribosomal_L36.
DR   InterPro; IPR020939; Ribosomal_L34_CS.
DR   InterPro; IPR035977; Ribosomal_L36_sp.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE009951.
DR   SILVA-SSU; AE009951.
DR   StrainInfo; 31256; 1.
DR   UniProtKB/Swiss-Prot; P68994; RL36_FUSNN.
DR   UniProtKB/Swiss-Prot; P68997; RL34_FUSNN.
CC   On or before Jun 23, 2005 this sequence version replaced
CC   gi:19712704, gi:19712719, gi:19712735, gi:19712743, gi:19712757,
CC   gi:19712768, gi:19712777, gi:19712788, gi:19712802, gi:19712817,
CC   gi:19712829, gi:19712842, gi:19712870, gi:19712885, gi:19712899,
CC   gi:19712917, gi:19712932, gi:19712948, gi:19712957, gi:19712970,
CC   gi:19712984, gi:19713002, gi:19713012, gi:19713026, gi:19713039,
CC   gi:19713051, gi:19713056, gi:19713072, gi:19713085, gi:19713101,
CC   gi:19713112, gi:19713130, gi:19713143, gi:19713152, gi:19713160,
CC   gi:19713168, gi:19713181, gi:19713193, gi:19713204, gi:19713210,
CC   gi:19713223, gi:19713233, gi:19713245, gi:19713257, gi:19713275,
CC   gi:19713283, gi:19713292, gi:19713296, gi:19713304, gi:19713316,
CC   gi:19713328, gi:19713337, gi:19713349, gi:19713361, gi:19713376,
CC   gi:19713387, gi:19713402, gi:19713415, gi:19713428, gi:19713441,
CC   gi:19713453, gi:19713470, gi:19713484, gi:19713495, gi:19713508,
CC   gi:19713524, gi:19713534, gi:19713549, gi:19713560, gi:19713570,
CC   gi:19713583, gi:19713595, gi:19713610, gi:19713624, gi:19713638,
CC   gi:19713652, gi:19713667, gi:19713681, gi:19713697, gi:19713708,
CC   gi:19713723, gi:19713731, gi:19713745, gi:19713752, gi:19713764,
CC   gi:19713775, gi:19713787, gi:19713801, gi:19713815, gi:19713832,
CC   gi:19713844, gi:19713857, gi:19713865, gi:19713876, gi:19713891,
CC   gi:19713897, gi:19713910, gi:19713919, gi:19713930, gi:19713941,
CC   gi:19713953, gi:19713966, gi:19713980, gi:19713988, gi:19713999,
CC   gi:19714010, gi:19714022, gi:19714037, gi:19714053, gi:19714068,
CC   gi:19714078, gi:19714084, gi:19714098, gi:19714109, gi:19714121,
CC   gi:19714131, gi:19714148, gi:19714164, gi:19714176, gi:19714192,
CC   gi:19714208, gi:19714220, gi:19714233, gi:19714244, gi:19714256,
CC   gi:19714270, gi:19714285, gi:19714299, gi:19714313, gi:19714328,
CC   gi:19714339, gi:19714349, gi:19714362, gi:19714375, gi:19714387,
CC   gi:19714403, gi:19714415, gi:19714430, gi:19714442, gi:19714454,
CC   gi:19714471, gi:19714488, gi:19714504, gi:19714515, gi:19714526,
CC   gi:19714538, gi:19714554, gi:19714567, gi:19714578, gi:19714590,
CC   gi:19714603, gi:19714611, gi:19714626, gi:19714645, gi:19714662,
CC   gi:19714676, gi:19714691, gi:19714705, gi:19714722, gi:19714731,
CC   gi:19714742, gi:19714752, gi:19714760, gi:19714771, gi:19714783,
CC   gi:19714795, gi:19714809, gi:19714819, gi:19714826, gi:19714840,
CC   gi:19714856, gi:19714865, gi:19714878, gi:19714892, gi:19714904,
CC   gi:19714914, gi:19714928, gi:19714940, gi:19714959, gi:19714971,
CC   gi:19714984, gi:19714998, gi:19715012, gi:19715026, gi:19715037,
CC   gi:19715042, gi:19715055, gi:19715066, gi:19715076, gi:19715085,
CC   gi:19715096, gi:19715112, gi:19715118, gi:19715130, gi:19715142,
CC   gi:19715151, gi:19715163, gi:19733154.
FH   Key             Location/Qualifiers
FT   source          1..2174500
FT                   /organism="Fusobacterium nucleatum subsp. nucleatum ATCC
FT                   25586"
FT                   /sub_species="nucleatum"
FT                   /strain="ATCC 25586"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:190304"
FT   gene            complement(join(2174488..2174500,1..77))
FT                   /locus_tag="FN1495"
FT   CDS_pept        complement(join(2174488..2174500,1..77))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1495"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1495"
FT                   /db_xref="EnsemblGenomes-Tr:AAL95689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL8"
FT                   /protein_id="AAL95689.1"
FT                   /translation="MKKFIILLFILVQGLIFSATKTLSDIIAL"
FT   gene            complement(77..709)
FT                   /locus_tag="FN1496"
FT   CDS_pept        complement(77..709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1496"
FT                   /product="Rod shape-determining protein mreC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1496"
FT                   /db_xref="EnsemblGenomes-Tr:AAL95680"
FT                   /db_xref="GOA:Q8RDL7"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RDL7"
FT                   /protein_id="AAL95680.1"
FT   gene            complement(1104..2228)
FT                   /locus_tag="FN1497"
FT   CDS_pept        complement(1104..2228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1497"
FT                   /product="Multidrug resistance protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:FN1497"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93623"
FT                   /db_xref="GOA:Q8RIS2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIS2"
FT                   /protein_id="AAL93623.1"
FT   gene            2703..3602
FT                   /locus_tag="FN1498"
FT   CDS_pept        2703..3602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1498"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1498"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93624"
FT                   /db_xref="GOA:Q8RIS1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIS1"
FT                   /protein_id="AAL93624.1"
FT                   IASAILMIISIIKISKLN"
FT   gene            3787..5226
FT                   /locus_tag="FN1499"
FT   CDS_pept        3787..5226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1499"
FT                   /product="Cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1499"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93625"
FT                   /db_xref="GOA:Q8RIS0"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIS0"
FT                   /protein_id="AAL93625.1"
FT   gene            complement(5283..6017)
FT                   /locus_tag="FN1500"
FT   CDS_pept        complement(5283..6017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1500"
FT                   /product="Nickel transport ATP-binding protein nikE"
FT                   /db_xref="EnsemblGenomes-Gn:FN1500"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93626"
FT                   /db_xref="GOA:Q8RIR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR9"
FT                   /protein_id="AAL93626.1"
FT   gene            complement(6018..6800)
FT                   /locus_tag="FN1501"
FT   CDS_pept        complement(6018..6800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1501"
FT                   /product="Nickel transport ATP-binding protein nikD"
FT                   /db_xref="EnsemblGenomes-Gn:FN1501"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93627"
FT                   /db_xref="GOA:Q8RIR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR8"
FT                   /protein_id="AAL93627.1"
FT   gene            complement(6797..7612)
FT                   /locus_tag="FN1502"
FT   CDS_pept        complement(6797..7612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1502"
FT                   /product="Nickel transport system permease protein nikC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1502"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93628"
FT                   /db_xref="GOA:Q8RIR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR7"
FT                   /protein_id="AAL93628.1"
FT   gene            complement(7593..8531)
FT                   /locus_tag="FN1503"
FT   CDS_pept        complement(7593..8531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1503"
FT                   /product="Nickel transport system permease protein nikB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1503"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93629"
FT                   /db_xref="GOA:Q8RIR6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR6"
FT                   /protein_id="AAL93629.1"
FT   gene            complement(8537..10105)
FT                   /locus_tag="FN1504"
FT   CDS_pept        complement(8537..10105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1504"
FT                   /product="Nickel-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1504"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93630"
FT                   /db_xref="GOA:Q8RIR5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR5"
FT                   /protein_id="AAL93630.1"
FT                   YIDKK"
FT   gene            10536..11009
FT                   /locus_tag="FN1505"
FT   CDS_pept        10536..11009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1505"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1505"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93631"
FT                   /db_xref="GOA:Q8RIR4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIR4"
FT                   /protein_id="AAL93631.1"
FT   gene            11011..12120
FT                   /locus_tag="FN1506"
FT   CDS_pept        11011..12120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1506"
FT                   /product="Diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1506"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93632"
FT                   /db_xref="GOA:Q8RIR3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR3"
FT                   /protein_id="AAL93632.1"
FT   gene            12213..12968
FT                   /locus_tag="FN1507"
FT   CDS_pept        12213..12968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1507"
FT                   /product="Riboflavin synthase alpha chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1507"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93633"
FT                   /db_xref="GOA:Q8RIR2"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR2"
FT                   /protein_id="AAL93633.1"
FT   gene            12978..14177
FT                   /locus_tag="FN1508"
FT   CDS_pept        12978..14177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1508"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number=""
FT                   /EC_number="4.1.2.-"
FT                   /note="3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1508"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93634"
FT                   /db_xref="GOA:Q8RIR1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR1"
FT                   /protein_id="AAL93634.1"
FT                   "
FT   gene            complement(14189..14266)
FT                   /locus_tag="FN1509"
FT   CDS_pept        complement(14189..14266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1509"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1509"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93635"
FT                   /db_xref="GOA:Q8RIR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIR0"
FT                   /protein_id="AAL93635.1"
FT                   /translation="MFFSVIFLFGLNYLICNSPLFNILR"
FT   gene            complement(14321..14401)
FT                   /locus_tag="FN1510"
FT   CDS_pept        complement(14321..14401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1510"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1510"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6I0"
FT                   /protein_id="AAL93636.1"
FT                   /translation="MKKFKIFVIINWFYHKYIILNFEENF"
FT   gene            14357..15838
FT                   /locus_tag="FN1511"
FT   CDS_pept        14357..15838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1511"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1511"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93637"
FT                   /db_xref="GOA:Q8RIQ9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ9"
FT                   /protein_id="AAL93637.1"
FT   gene            15985..17175
FT                   /locus_tag="FN1512"
FT   CDS_pept        15985..17175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1512"
FT                   /product="hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1512"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93638"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ8"
FT                   /protein_id="AAL93638.1"
FT   gene            17147..17362
FT                   /locus_tag="FN1513"
FT   CDS_pept        17147..17362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1513"
FT                   /product="Phophatidylinositol-4-phosphate 5-kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1513"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93639"
FT                   /db_xref="GOA:Q8RIQ7"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ7"
FT                   /protein_id="AAL93639.1"
FT   gene            17516..19027
FT                   /locus_tag="FN1514"
FT   CDS_pept        17516..19027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1514"
FT                   /product="hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1514"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93640"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ6"
FT                   /protein_id="AAL93640.1"
FT   gene            19045..20712
FT                   /locus_tag="FN1515"
FT   CDS_pept        19045..20712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1515"
FT                   /product="hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1515"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93641"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ5"
FT                   /protein_id="AAL93641.1"
FT   gene            complement(20754..20948)
FT                   /locus_tag="FN1516"
FT   CDS_pept        complement(20754..20948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1516"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1516"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93642"
FT                   /db_xref="GOA:Q8RIQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ4"
FT                   /protein_id="AAL93642.1"
FT   gene            complement(20966..23545)
FT                   /locus_tag="FN1517"
FT   CDS_pept        complement(20966..23545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1517"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1517"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93643"
FT                   /db_xref="GOA:Q8RIQ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIQ3"
FT                   /protein_id="AAL93643.1"
FT   gene            complement(23553..24167)
FT                   /locus_tag="FN1518"
FT   CDS_pept        complement(23553..24167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1518"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1518"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93644"
FT                   /db_xref="GOA:Q8RIQ2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="PDB:3MZY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ2"
FT                   /protein_id="AAL93644.1"
FT   gene            complement(24178..24882)
FT                   /locus_tag="FN1519"
FT   CDS_pept        complement(24178..24882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1519"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1519"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93645"
FT                   /db_xref="GOA:Q8R6H6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H6"
FT                   /protein_id="AAL93645.1"
FT                   ASGILLSRIVNR"
FT   gene            complement(24892..26163)
FT                   /locus_tag="FN1520"
FT   CDS_pept        complement(24892..26163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1520"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1520"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93646"
FT                   /db_xref="GOA:Q8RIQ1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIQ1"
FT                   /protein_id="AAL93646.1"
FT   gene            26528..27466
FT                   /locus_tag="FN1521"
FT   CDS_pept        26528..27466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1521"
FT                   /product="Dipeptide transport system permease protein dppB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1521"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93647"
FT                   /db_xref="GOA:Q8RIQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIQ0"
FT                   /protein_id="AAL93647.1"
FT   gene            27467..28297
FT                   /locus_tag="FN1522"
FT   CDS_pept        27467..28297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1522"
FT                   /product="Dipeptide transport system permease protein dppC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1522"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93648"
FT                   /db_xref="GOA:Q8RIP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP9"
FT                   /protein_id="AAL93648.1"
FT   gene            28347..29927
FT                   /locus_tag="FN1523"
FT   CDS_pept        28347..29927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1523"
FT                   /product="Dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1523"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93649"
FT                   /db_xref="GOA:Q8RIP8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP8"
FT                   /protein_id="AAL93649.1"
FT                   LTKDVTVSE"
FT   gene            29939..30724
FT                   /locus_tag="FN1524"
FT   CDS_pept        29939..30724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1524"
FT                   /product="Dipeptide transport ATP-binding protein dppD"
FT                   /db_xref="EnsemblGenomes-Gn:FN1524"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93650"
FT                   /db_xref="GOA:Q8RIP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP7"
FT                   /protein_id="AAL93650.1"
FT   gene            30663..31691
FT                   /locus_tag="FN1525"
FT   CDS_pept        30663..31691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1525"
FT                   /product="Dipeptide transport ATP-binding protein dppF"
FT                   /db_xref="EnsemblGenomes-Gn:FN1525"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93651"
FT                   /db_xref="GOA:Q8RIP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP6"
FT                   /protein_id="AAL93651.1"
FT                   NL"
FT   gene            complement(31842..38273)
FT                   /locus_tag="FN1526"
FT   CDS_pept        complement(31842..38273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1526"
FT                   /product="Fusobacterium outer membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1526"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93652"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP5"
FT                   /protein_id="AAL93652.1"
FT   gene            complement(42273..42662)
FT                   /locus_tag="FN1527"
FT   CDS_pept        complement(42273..42662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1527"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1527"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93653"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP4"
FT                   /protein_id="AAL93653.1"
FT   gene            complement(42678..43034)
FT                   /locus_tag="FN1528"
FT   CDS_pept        complement(42678..43034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1528"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1528"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93654"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP3"
FT                   /protein_id="AAL93654.1"
FT                   NQVEEALKNITEEK"
FT   gene            complement(43083..43454)
FT                   /locus_tag="FN1529"
FT   CDS_pept        complement(43083..43454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1529"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1529"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93655"
FT                   /db_xref="InterPro:IPR018543"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP2"
FT                   /protein_id="AAL93655.1"
FT   gene            43765..44121
FT                   /locus_tag="FN1530"
FT   CDS_pept        43765..44121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1530"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1530"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93656"
FT                   /db_xref="GOA:Q8RIP1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP1"
FT                   /protein_id="AAL93656.1"
FT                   KSEMFYEQKKTTKH"
FT   gene            complement(44326..45060)
FT                   /locus_tag="FN1531"
FT   CDS_pept        complement(44326..45060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1531"
FT                   /product="murein hydrolase export regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FN1531"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93657"
FT                   /db_xref="GOA:Q8RIP0"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIP0"
FT                   /protein_id="AAL93657.1"
FT   gene            complement(45026..45409)
FT                   /locus_tag="FN1532"
FT   CDS_pept        complement(45026..45409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1532"
FT                   /product="murein hydrolase exporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1532"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93658"
FT                   /db_xref="GOA:Q8RIN9"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN9"
FT                   /protein_id="AAL93658.1"
FT   gene            complement(45440..46411)
FT                   /locus_tag="FN1533"
FT   CDS_pept        complement(45440..46411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1533"
FT                   /product="Electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FN1533"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93659"
FT                   /db_xref="GOA:Q8RIN8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN8"
FT                   /protein_id="AAL93659.1"
FT   gene            complement(46423..47202)
FT                   /locus_tag="FN1534"
FT   CDS_pept        complement(46423..47202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1534"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FN1534"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93660"
FT                   /db_xref="GOA:Q8RIN7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN7"
FT                   /protein_id="AAL93660.1"
FT   gene            complement(47214..48350)
FT                   /locus_tag="FN1535"
FT   CDS_pept        complement(47214..48350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1535"
FT                   /product="Acyl-CoA dehydrogenase, short-chain specific"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1535"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93661"
FT                   /db_xref="GOA:Q8RIN6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN6"
FT                   /protein_id="AAL93661.1"
FT   gene            complement(48381..49808)
FT                   /locus_tag="FN1536"
FT   CDS_pept        complement(48381..49808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1536"
FT                   /product="(S)-2-hydroxy-acid oxidase chain D"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1536"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93662"
FT                   /db_xref="GOA:Q8RIN5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN5"
FT                   /protein_id="AAL93662.1"
FT                   VFDPKMILNPNKVCYKA"
FT   gene            complement(50036..51202)
FT                   /locus_tag="FN1537"
FT   CDS_pept        complement(50036..51202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1537"
FT                   /product="Arsenical pump-driving ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1537"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93663"
FT                   /db_xref="GOA:Q8RIN4"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN4"
FT                   /protein_id="AAL93663.1"
FT   gene            complement(51199..52389)
FT                   /locus_tag="FN1538"
FT   CDS_pept        complement(51199..52389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1538"
FT                   /product="Arsenical pump-driving ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1538"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93664"
FT                   /db_xref="GOA:Q8RIN3"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN3"
FT                   /protein_id="AAL93664.1"
FT   gene            52601..53152
FT                   /locus_tag="FN1539"
FT   CDS_pept        52601..53152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1539"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1539"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93665"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN2"
FT                   /protein_id="AAL93665.1"
FT   gene            53195..55354
FT                   /locus_tag="FN1540"
FT   CDS_pept        53195..55354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1540"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1540"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93666"
FT                   /db_xref="GOA:Q8RIN1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN1"
FT                   /protein_id="AAL93666.1"
FT   gene            55355..56335
FT                   /locus_tag="FN1541"
FT   CDS_pept        55355..56335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1541"
FT                   /product="Heptaprenyl diphosphate synthase component II"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1541"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93667"
FT                   /db_xref="GOA:Q8RIN0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIN0"
FT                   /protein_id="AAL93667.1"
FT   gene            56332..57252
FT                   /locus_tag="FN1542"
FT   CDS_pept        56332..57252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1542"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1542"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93668"
FT                   /db_xref="GOA:Q8R6H5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H5"
FT                   /protein_id="AAL93668.1"
FT   gene            57254..57949
FT                   /locus_tag="FN1543"
FT   CDS_pept        57254..57949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1543"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UBIE"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1543"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93669"
FT                   /db_xref="GOA:Q8R6H4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H4"
FT                   /protein_id="AAL93669.1"
FT                   VCVMIQGKK"
FT   gene            57975..59270
FT                   /locus_tag="FN1544"
FT   CDS_pept        57975..59270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1544"
FT                   /product="Probable electron transfer flavoprotein-quinone
FT                   oxidoreductase ydiS"
FT                   /EC_number="1.5.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1544"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93670"
FT                   /db_xref="GOA:Q8R6H3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H3"
FT                   /protein_id="AAL93670.1"
FT   gene            59273..59557
FT                   /locus_tag="FN1545"
FT   CDS_pept        59273..59557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1545"
FT                   /product="Ferredoxin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1545"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93671"
FT                   /db_xref="GOA:Q8RIM9"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM9"
FT                   /protein_id="AAL93671.1"
FT   gene            complement(59619..61691)
FT                   /locus_tag="FN1546"
FT   CDS_pept        complement(59619..61691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1546"
FT                   /product="Protein Translation Elongation Factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:FN1546"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93672"
FT                   /db_xref="GOA:Q8R604"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R604"
FT                   /protein_id="AAL93672.1"
FT   gene            complement(61891..63360)
FT                   /locus_tag="FN1547"
FT   CDS_pept        complement(61891..63360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1547"
FT                   /product="PTS permease for N-acetylglucosamine and glucose"
FT                   /db_xref="EnsemblGenomes-Gn:FN1547"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93673"
FT                   /db_xref="GOA:Q8RIM8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM8"
FT                   /protein_id="AAL93673.1"
FT   gene            63594..64010
FT                   /locus_tag="FN1548"
FT   CDS_pept        63594..64010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1548"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1548"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93674"
FT                   /db_xref="GOA:Q8RIM7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM7"
FT                   /protein_id="AAL93674.1"
FT   gene            64029..64913
FT                   /locus_tag="FN1549"
FT   CDS_pept        64029..64913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1549"
FT                   /product="Stomatin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1549"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93675"
FT                   /db_xref="GOA:Q8RIM6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM6"
FT                   /protein_id="AAL93675.1"
FT                   NLAGFMQAIKEIK"
FT   gene            complement(64977..65720)
FT                   /locus_tag="FN1550"
FT   CDS_pept        complement(64977..65720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1550"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1550"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93676"
FT                   /db_xref="GOA:Q8RIM5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM5"
FT                   /protein_id="AAL93676.1"
FT   gene            complement(65744..66277)
FT                   /locus_tag="FN1551"
FT   CDS_pept        complement(65744..66277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1551"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93677"
FT                   /db_xref="GOA:Q8RIM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM4"
FT                   /protein_id="AAL93677.1"
FT                   LGFILFIIVYGGIL"
FT   gene            complement(66291..67235)
FT                   /locus_tag="FN1552"
FT   CDS_pept        complement(66291..67235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1552"
FT                   /product="abortive phage resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1552"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93678"
FT                   /db_xref="InterPro:IPR025591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM3"
FT                   /protein_id="AAL93678.1"
FT   gene            complement(67240..68628)
FT                   /locus_tag="FN1553"
FT   CDS_pept        complement(67240..68628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1553"
FT                   /product="abortive phage resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1553"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93679"
FT                   /db_xref="GOA:Q8RIM2"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM2"
FT                   /protein_id="AAL93679.1"
FT                   EKED"
FT   gene            complement(68809..73557)
FT                   /locus_tag="FN1554"
FT   CDS_pept        complement(68809..73557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1554"
FT                   /product="Fusobacterium outer membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1554"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93680"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIM1"
FT                   /protein_id="AAL93680.1"
FT                   VIF"
FT   gene            complement(76342..77526)
FT                   /locus_tag="FN1555"
FT   CDS_pept        complement(76342..77526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1555"
FT                   /product="Protein Translation Elongation Factor Tu"
FT                   /note="EF-TU"
FT                   /db_xref="EnsemblGenomes-Gn:FN1555"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93681"
FT                   /db_xref="GOA:Q8R603"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R603"
FT                   /protein_id="AAL93681.1"
FT   gene            complement(77615..79696)
FT                   /locus_tag="FN1556"
FT   CDS_pept        complement(77615..79696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1556"
FT                   /product="Protein Translation Elongation Factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:FN1556"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93682"
FT                   /db_xref="GOA:Q8R602"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R602"
FT                   /protein_id="AAL93682.1"
FT   gene            complement(79742..80212)
FT                   /locus_tag="FN1557"
FT   CDS_pept        complement(79742..80212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1557"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1557"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93683"
FT                   /db_xref="GOA:Q8RIM0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIM0"
FT                   /protein_id="AAL93683.1"
FT   gene            complement(80240..80608)
FT                   /locus_tag="FN1558"
FT   CDS_pept        complement(80240..80608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1558"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1558"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93684"
FT                   /db_xref="GOA:Q8RIL9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIL9"
FT                   /protein_id="AAL93684.1"
FT                   AGVAKRKQGRSKYGAKNA"
FT   gene            80967..82550
FT                   /locus_tag="FN1559"
FT   CDS_pept        80967..82550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1559"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1559"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93685"
FT                   /db_xref="GOA:Q8RIL8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL8"
FT                   /protein_id="AAL93685.1"
FT                   ENDILVLLDR"
FT   gene            complement(82569..83072)
FT                   /locus_tag="FN1560"
FT   CDS_pept        complement(82569..83072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1560"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1560"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93686"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL7"
FT                   /protein_id="AAL93686.1"
FT                   EEKK"
FT   gene            complement(83122..83850)
FT                   /locus_tag="FN1561"
FT   CDS_pept        complement(83122..83850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1561"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1561"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93687"
FT                   /db_xref="GOA:Q8RIL6"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL6"
FT                   /protein_id="AAL93687.1"
FT   gene            complement(83850..84854)
FT                   /locus_tag="FN1562"
FT   CDS_pept        complement(83850..84854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1562"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1562"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93688"
FT                   /db_xref="GOA:Q8RIL5"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL5"
FT                   /protein_id="AAL93688.1"
FT   gene            complement(84867..85130)
FT                   /locus_tag="FN1563"
FT   CDS_pept        complement(84867..85130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1563"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1563"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93689"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL4"
FT                   /protein_id="AAL93689.1"
FT   tRNA            complement(85236..85313)
FT                   /product="tRNA-Asp"
FT   tRNA            complement(85322..85397)
FT                   /product="tRNA-Val"
FT   tRNA            complement(85409..85484)
FT                   /product="tRNA-Phe"
FT   tRNA            complement(85498..85581)
FT                   /product="tRNA-Ser"
FT   tRNA            complement(85583..85657)
FT                   /product="tRNA-Glu"
FT   tRNA            complement(85674..85751)
FT                   /product="tRNA-Met"
FT   tRNA            complement(85760..85836)
FT                   /product="tRNA-Arg"
FT   tRNA            complement(85845..85920)
FT                   /product="tRNA-Lys"
FT   tRNA            complement(85930..86005)
FT                   /product="tRNA-Gly"
FT   tRNA            complement(86029..86105)
FT                   /product="tRNA-Met"
FT   tRNA            complement(86113..86200)
FT                   /product="tRNA-Leu"
FT   gene            complement(86283..86585)
FT                   /locus_tag="FN1575"
FT   CDS_pept        complement(86283..86585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1575"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1575"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93690"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIL3"
FT                   /protein_id="AAL93690.1"
FT   gene            complement(86595..87464)
FT                   /locus_tag="FN1576"
FT   CDS_pept        complement(86595..87464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1576"
FT                   /product="ATPases and helicase subunits involved in DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:FN1576"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93691"
FT                   /db_xref="GOA:Q8RIL2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL2"
FT                   /protein_id="AAL93691.1"
FT                   LISMIMSI"
FT   gene            complement(87467..88495)
FT                   /locus_tag="FN1577"
FT   CDS_pept        complement(87467..88495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1577"
FT                   /product="Rod shape-determining protein mreB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1577"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93692"
FT                   /db_xref="GOA:Q8RIL1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIL1"
FT                   /protein_id="AAL93692.1"
FT                   ER"
FT   gene            complement(88497..88886)
FT                   /locus_tag="FN1578"
FT   CDS_pept        complement(88497..88886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1578"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1578"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93693"
FT                   /db_xref="GOA:Q8RIL0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PDB:2GSL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIL0"
FT                   /protein_id="AAL93693.1"
FT   gene            complement(88874..90295)
FT                   /locus_tag="FN1579"
FT   CDS_pept        complement(88874..90295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1579"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1579"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93694"
FT                   /db_xref="GOA:Q8RIK9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIK9"
FT                   /protein_id="AAL93694.1"
FT                   GIKIKDGKDKTTWTM"
FT   gene            complement(90314..91009)
FT                   /locus_tag="FN1580"
FT   CDS_pept        complement(90314..91009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1580"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1580"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93695"
FT                   /db_xref="GOA:Q8R6H2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6H2"
FT                   /protein_id="AAL93695.1"
FT                   VQEDLKFLK"
FT   gene            complement(90985..93321)
FT                   /locus_tag="FN1581"
FT   CDS_pept        complement(90985..93321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1581"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /db_xref="EnsemblGenomes-Gn:FN1581"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93696"
FT                   /db_xref="GOA:Q8RIK8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIK8"
FT                   /protein_id="AAL93696.1"
FT   gene            complement(93677..95047)
FT                   /locus_tag="FN1582"
FT   CDS_pept        complement(93677..95047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1582"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1582"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93697"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK7"
FT                   /protein_id="AAL93697.1"
FT   gene            complement(95129..95482)
FT                   /locus_tag="FN1583"
FT   CDS_pept        complement(95129..95482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1583"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1583"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93698"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK6"
FT                   /protein_id="AAL93698.1"
FT                   HYKKVKNDFKEKR"
FT   gene            complement(95454..96248)
FT                   /locus_tag="FN1584"
FT   CDS_pept        complement(95454..96248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1584"
FT                   /product="Beta-lactamase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1584"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93699"
FT                   /db_xref="GOA:Q8RIK5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK5"
FT                   /protein_id="AAL93699.1"
FT   gene            complement(96303..97484)
FT                   /locus_tag="FN1585"
FT   CDS_pept        complement(96303..97484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1585"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1585"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93700"
FT                   /db_xref="GOA:Q8RIK4"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK4"
FT                   /protein_id="AAL93700.1"
FT   gene            complement(97505..98632)
FT                   /locus_tag="FN1586"
FT   CDS_pept        complement(97505..98632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1586"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1586"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93701"
FT                   /db_xref="GOA:Q8RIK3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK3"
FT                   /protein_id="AAL93701.1"
FT   gene            98981..99394
FT                   /locus_tag="FN1587"
FT   CDS_pept        98981..99394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1587"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1587"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93702"
FT                   /db_xref="GOA:Q8R6H1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H1"
FT                   /protein_id="AAL93702.1"
FT   gene            99696..99857
FT                   /locus_tag="FN1588"
FT   CDS_pept        99696..99857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1588"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1588"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93703"
FT                   /db_xref="GOA:Q8RIK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK2"
FT                   /protein_id="AAL93703.1"
FT                   LYKIKILI"
FT   gene            99932..100591
FT                   /locus_tag="FN1589"
FT   CDS_pept        99932..100591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1589"
FT                   /product="LexA repressor"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1589"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93704"
FT                   /db_xref="GOA:Q8RIK1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK1"
FT                   /protein_id="AAL93704.1"
FT   gene            complement(100650..101894)
FT                   /locus_tag="FN1590"
FT   CDS_pept        complement(100650..101894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1590"
FT                   /product="Hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1590"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93705"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIK0"
FT                   /protein_id="AAL93705.1"
FT                   ITSVEIPEKYTKIGN"
FT   gene            complement(102068..103225)
FT                   /locus_tag="FN1591"
FT   CDS_pept        complement(102068..103225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1591"
FT                   /product="RNFB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1591"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93706"
FT                   /db_xref="GOA:Q8RIJ9"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ9"
FT                   /protein_id="AAL93706.1"
FT   gene            complement(103252..103836)
FT                   /locus_tag="FN1592"
FT   CDS_pept        complement(103252..103836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1592"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1592"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93707"
FT                   /db_xref="GOA:Q8R6H0"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H0"
FT                   /protein_id="AAL93707.1"
FT   gene            complement(103833..104450)
FT                   /locus_tag="FN1593"
FT   CDS_pept        complement(103833..104450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1593"
FT                   /product="RnfE protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1593"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93708"
FT                   /db_xref="GOA:Q8RIJ8"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ8"
FT                   /protein_id="AAL93708.1"
FT   gene            complement(104450..104983)
FT                   /locus_tag="FN1594"
FT   CDS_pept        complement(104450..104983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1594"
FT                   /product="Nitrogen fixation protein RNFG"
FT                   /db_xref="EnsemblGenomes-Gn:FN1594"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93709"
FT                   /db_xref="GOA:Q8RIJ7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ7"
FT                   /protein_id="AAL93709.1"
FT                   VIRALNTYQNEVSK"
FT   gene            complement(104973..105917)
FT                   /locus_tag="FN1595"
FT   CDS_pept        complement(104973..105917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1595"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1595"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93710"
FT                   /db_xref="GOA:Q8R6G9"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G9"
FT                   /protein_id="AAL93710.1"
FT   gene            complement(105943..107268)
FT                   /locus_tag="FN1596"
FT   CDS_pept        complement(105943..107268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1596"
FT                   /product="Nitrogen fixation iron-sulphur protein RNFC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1596"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93711"
FT                   /db_xref="GOA:Q8RIJ6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ6"
FT                   /protein_id="AAL93711.1"
FT   gene            complement(107325..107900)
FT                   /locus_tag="FN1597"
FT   CDS_pept        complement(107325..107900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1597"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1597"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93712"
FT                   /db_xref="GOA:Q8RIJ5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIJ5"
FT                   /protein_id="AAL93712.1"
FT   gene            complement(108069..108242)
FT                   /locus_tag="FN1598"
FT   CDS_pept        complement(108069..108242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1598"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1598"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ4"
FT                   /protein_id="AAL93713.1"
FT                   NKIRDSRSVFKD"
FT   gene            complement(108367..108873)
FT                   /locus_tag="FN1599"
FT   CDS_pept        complement(108367..108873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1599"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1599"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93714"
FT                   /db_xref="InterPro:IPR016630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ3"
FT                   /protein_id="AAL93714.1"
FT                   YLNGK"
FT   gene            complement(109159..109902)
FT                   /locus_tag="FN1600"
FT   CDS_pept        complement(109159..109902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1600"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1600"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93715"
FT                   /db_xref="GOA:Q8R601"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R601"
FT                   /protein_id="AAL93715.1"
FT   gene            complement(109922..110998)
FT                   /locus_tag="FN1601"
FT   CDS_pept        complement(109922..110998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1601"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1601"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93716"
FT                   /db_xref="GOA:Q8RIJ2"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ2"
FT                   /protein_id="AAL93716.1"
FT                   KKKMMEIFEHSMNKIKVL"
FT   gene            complement(111112..111582)
FT                   /locus_tag="FN1602"
FT   CDS_pept        complement(111112..111582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1602"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1602"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93717"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ1"
FT                   /protein_id="AAL93717.1"
FT   gene            complement(111700..113751)
FT                   /locus_tag="FN1603"
FT   CDS_pept        complement(111700..113751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1603"
FT                   /product="2',3'-cyclic nucleotide 3'-phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1603"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93718"
FT                   /db_xref="GOA:Q8RIJ0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIJ0"
FT                   /protein_id="AAL93718.1"
FT   gene            complement(113748..113912)
FT                   /locus_tag="FN1604"
FT   CDS_pept        complement(113748..113912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1604"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1604"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93719"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII9"
FT                   /protein_id="AAL93719.1"
FT                   LFYIKKGKL"
FT   gene            complement(114089..115366)
FT                   /locus_tag="FN1605"
FT   CDS_pept        complement(114089..115366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1605"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1605"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93720"
FT                   /db_xref="GOA:P58793"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58793"
FT                   /protein_id="AAL93720.1"
FT   gene            complement(115376..117298)
FT                   /locus_tag="FN1606"
FT   CDS_pept        complement(115376..117298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1606"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /note="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1606"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93721"
FT                   /db_xref="GOA:Q8R6G8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6G8"
FT                   /protein_id="AAL93721.1"
FT                   IKKIV"
FT   gene            complement(117327..117983)
FT                   /locus_tag="FN1607"
FT   CDS_pept        complement(117327..117983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1607"
FT                   /product="Cytidylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1607"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93722"
FT                   /db_xref="GOA:Q8RII8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RII8"
FT                   /protein_id="AAL93722.1"
FT   gene            complement(117999..118937)
FT                   /locus_tag="FN1608"
FT   CDS_pept        complement(117999..118937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1608"
FT                   /product="Ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1608"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93723"
FT                   /db_xref="GOA:Q8R6G7"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6G7"
FT                   /protein_id="AAL93723.1"
FT   gene            complement(118912..119703)
FT                   /locus_tag="FN1609"
FT   CDS_pept        complement(118912..119703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1609"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1609"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93724"
FT                   /db_xref="GOA:Q8RII7"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII7"
FT                   /protein_id="AAL93724.1"
FT   gene            complement(119830..120687)
FT                   /locus_tag="FN1610"
FT   CDS_pept        complement(119830..120687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1610"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:FN1610"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93725"
FT                   /db_xref="GOA:Q8RII6"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII6"
FT                   /protein_id="AAL93725.1"
FT                   ILKK"
FT   gene            complement(120687..121166)
FT                   /locus_tag="FN1611"
FT   CDS_pept        complement(120687..121166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1611"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1611"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93726"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII5"
FT                   /protein_id="AAL93726.1"
FT   gene            complement(121214..122623)
FT                   /locus_tag="FN1612"
FT   CDS_pept        complement(121214..122623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1612"
FT                   /product="Oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1612"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93727"
FT                   /db_xref="GOA:Q8R6G6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G6"
FT                   /protein_id="AAL93727.1"
FT                   EKIEMFKKEKI"
FT   gene            complement(122626..123576)
FT                   /locus_tag="FN1613"
FT   CDS_pept        complement(122626..123576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1613"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1613"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93728"
FT                   /db_xref="GOA:Q8RII4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII4"
FT                   /protein_id="AAL93728.1"
FT   gene            complement(123599..125092)
FT                   /locus_tag="FN1614"
FT   CDS_pept        complement(123599..125092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1614"
FT                   /product="MG(2+) chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1614"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93729"
FT                   /db_xref="GOA:Q8RII3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII3"
FT                   /protein_id="AAL93729.1"
FT   gene            125265..125816
FT                   /locus_tag="FN1615"
FT   CDS_pept        125265..125816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1615"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1615"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93730"
FT                   /db_xref="GOA:Q8RII2"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RII2"
FT                   /protein_id="AAL93730.1"
FT   gene            complement(126066..126527)
FT                   /locus_tag="FN1616"
FT   CDS_pept        complement(126066..126527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1616"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:FN1616"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93731"
FT                   /db_xref="GOA:Q8RII1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RII1"
FT                   /protein_id="AAL93731.1"
FT   gene            complement(126532..126756)
FT                   /locus_tag="FN1617"
FT   CDS_pept        complement(126532..126756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1617"
FT                   /product="Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1617"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93732"
FT                   /db_xref="GOA:Q8RII0"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RII0"
FT                   /protein_id="AAL93732.1"
FT   gene            complement(126756..127295)
FT                   /locus_tag="FN1618"
FT   CDS_pept        complement(126756..127295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1618"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1618"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93733"
FT                   /db_xref="GOA:Q8RIH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIH9"
FT                   /protein_id="AAL93733.1"
FT                   SDIPNDENIEDVEVSD"
FT   gene            complement(127366..127734)
FT                   /locus_tag="FN1619"
FT   CDS_pept        complement(127366..127734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1619"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1619"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93734"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIH8"
FT                   /protein_id="AAL93734.1"
FT                   VQNVKMEDIEETTEEFED"
FT   gene            128036..128779
FT                   /locus_tag="FN1620"
FT   CDS_pept        128036..128779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1620"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1620"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93735"
FT                   /db_xref="GOA:Q8RIH7"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH7"
FT                   /protein_id="AAL93735.1"
FT   gene            128813..129715
FT                   /locus_tag="FN1621"
FT   CDS_pept        128813..129715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1621"
FT                   /product="Protein Translation Elongation Factor Ts"
FT                   /note="EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:FN1621"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93736"
FT                   /db_xref="GOA:Q8R600"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R600"
FT                   /protein_id="AAL93736.1"
FT   gene            129780..130499
FT                   /locus_tag="FN1622"
FT   CDS_pept        129780..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1622"
FT                   /product="Uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1622"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93737"
FT                   /db_xref="GOA:Q8R6G5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6G5"
FT                   /protein_id="AAL93737.1"
FT                   LKKVVMGEHIGTTVVAD"
FT   gene            130534..131106
FT                   /locus_tag="FN1623"
FT   CDS_pept        130534..131106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1623"
FT                   /product="Ribosome Recycling Factor (RRF)"
FT                   /db_xref="EnsemblGenomes-Gn:FN1623"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93738"
FT                   /db_xref="GOA:Q8R5Z9"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z9"
FT                   /protein_id="AAL93738.1"
FT   gene            complement(131170..132450)
FT                   /locus_tag="FN1624"
FT   CDS_pept        complement(131170..132450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1624"
FT                   /product="Protein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:FN1624"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93739"
FT                   /db_xref="GOA:Q8RIH6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIH6"
FT                   /protein_id="AAL93739.1"
FT   gene            complement(132475..132954)
FT                   /locus_tag="FN1625"
FT   CDS_pept        complement(132475..132954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1625"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1625"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93740"
FT                   /db_xref="GOA:Q8RIH5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH5"
FT                   /protein_id="AAL93740.1"
FT   gene            complement(132954..133139)
FT                   /locus_tag="FN1626"
FT   CDS_pept        complement(132954..133139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1626"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1626"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93741"
FT                   /db_xref="GOA:Q8RIH4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH4"
FT                   /protein_id="AAL93741.1"
FT                   KLAQVSYLLKVEEVQA"
FT   gene            complement(133152..133646)
FT                   /locus_tag="FN1627"
FT   CDS_pept        complement(133152..133646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1627"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1627"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93742"
FT                   /db_xref="GOA:Q8RIH3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH3"
FT                   /protein_id="AAL93742.1"
FT                   S"
FT   gene            complement(133670..134038)
FT                   /locus_tag="FN1628"
FT   CDS_pept        complement(133670..134038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1628"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1628"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93743"
FT                   /db_xref="GOA:Q8RIH2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH2"
FT                   /protein_id="AAL93743.1"
FT                   TGRVAALADAAREAGLSF"
FT   gene            complement(134065..134598)
FT                   /locus_tag="FN1629"
FT   CDS_pept        complement(134065..134598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1629"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1629"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93744"
FT                   /db_xref="GOA:Q8RIH1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH1"
FT                   /protein_id="AAL93744.1"
FT                   YADEHIRRKEGKKS"
FT   gene            complement(134623..135021)
FT                   /locus_tag="FN1630"
FT   CDS_pept        complement(134623..135021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1630"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1630"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93745"
FT                   /db_xref="GOA:Q8RIH0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIH0"
FT                   /protein_id="AAL93745.1"
FT   gene            complement(135050..135337)
FT                   /locus_tag="FN1631"
FT   CDS_pept        complement(135050..135337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1631"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1631"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93746"
FT                   /db_xref="GOA:Q8RIG9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG9"
FT                   /protein_id="AAL93746.1"
FT   gene            complement(135358..135909)
FT                   /locus_tag="FN1632"
FT   CDS_pept        complement(135358..135909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1632"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1632"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93747"
FT                   /db_xref="GOA:Q8RIG8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG8"
FT                   /protein_id="AAL93747.1"
FT   gene            complement(135928..136029)
FT                   /locus_tag="FN1633"
FT   CDS_pept        complement(135928..136029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1633"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1633"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93748"
FT                   /db_xref="GOA:Q8RIG6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG6"
FT                   /protein_id="AAL93748.1"
FT   gene            complement(136168..136269)
FT                   /locus_tag="FN1634"
FT   CDS_pept        complement(136168..136269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1634"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1634"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93749"
FT                   /db_xref="GOA:Q8RIG6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG6"
FT                   /protein_id="AAL93749.1"
FT   gene            complement(136294..136662)
FT                   /locus_tag="FN1635"
FT   CDS_pept        complement(136294..136662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1635"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1635"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93750"
FT                   /db_xref="GOA:Q8RIG5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG5"
FT                   /protein_id="AAL93750.1"
FT                   ELRARNFMKILSLAIEVI"
FT   gene            complement(136691..136942)
FT                   /locus_tag="FN1636"
FT   CDS_pept        complement(136691..136942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1636"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1636"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93751"
FT                   /db_xref="GOA:Q8RIG4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG4"
FT                   /protein_id="AAL93751.1"
FT   gene            complement(136978..137160)
FT                   /locus_tag="FN1637"
FT   CDS_pept        complement(136978..137160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1637"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1637"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93752"
FT                   /db_xref="GOA:Q8RIG3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG3"
FT                   /protein_id="AAL93752.1"
FT                   IRREIARINTILNER"
FT   gene            complement(137160..137591)
FT                   /locus_tag="FN1638"
FT   CDS_pept        complement(137160..137591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1638"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1638"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93753"
FT                   /db_xref="GOA:Q8RIG2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG2"
FT                   /protein_id="AAL93753.1"
FT   gene            complement(137594..138253)
FT                   /locus_tag="FN1639"
FT   CDS_pept        complement(137594..138253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1639"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1639"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93754"
FT                   /db_xref="GOA:Q8RIG1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG1"
FT                   /protein_id="AAL93754.1"
FT   gene            complement(138272..138607)
FT                   /locus_tag="FN1640"
FT   CDS_pept        complement(138272..138607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1640"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1640"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93755"
FT                   /db_xref="GOA:Q8RIG0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIG0"
FT                   /protein_id="AAL93755.1"
FT                   VAVSDEQ"
FT   gene            complement(138642..138917)
FT                   /locus_tag="FN1641"
FT   CDS_pept        complement(138642..138917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1641"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1641"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93756"
FT                   /db_xref="GOA:Q8RIF9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF9"
FT                   /protein_id="AAL93756.1"
FT   gene            complement(138942..139772)
FT                   /locus_tag="FN1642"
FT   CDS_pept        complement(138942..139772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1642"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1642"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93757"
FT                   /db_xref="GOA:Q8RIF8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF8"
FT                   /protein_id="AAL93757.1"
FT   gene            complement(139820..140107)
FT                   /locus_tag="FN1643"
FT   CDS_pept        complement(139820..140107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1643"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1643"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93758"
FT                   /db_xref="GOA:Q8RIF7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF7"
FT                   /protein_id="AAL93758.1"
FT   gene            complement(140107..140736)
FT                   /locus_tag="FN1644"
FT   CDS_pept        complement(140107..140736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1644"
FT                   /product="LSU ribosomal protein L1E"
FT                   /note="L4P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1644"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93759"
FT                   /db_xref="GOA:Q8RIF6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF6"
FT                   /protein_id="AAL93759.1"
FT   gene            complement(140756..141391)
FT                   /locus_tag="FN1645"
FT   CDS_pept        complement(140756..141391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1645"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1645"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93760"
FT                   /db_xref="GOA:Q8RIF5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF5"
FT                   /protein_id="AAL93760.1"
FT   gene            complement(141539..141850)
FT                   /locus_tag="FN1646"
FT   CDS_pept        complement(141539..141850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1646"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1646"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93761"
FT                   /db_xref="GOA:Q8RIF4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIF4"
FT                   /protein_id="AAL93761.1"
FT   gene            142123..142542
FT                   /locus_tag="FN1647"
FT   CDS_pept        142123..142542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1647"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1647"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIF3"
FT                   /protein_id="AAL93762.1"
FT   gene            complement(142637..143407)
FT                   /locus_tag="FN1648"
FT   CDS_pept        complement(142637..143407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1648"
FT                   /product="Oligopeptide transport ATP-binding protein oppF"
FT                   /db_xref="EnsemblGenomes-Gn:FN1648"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93763"
FT                   /db_xref="GOA:Q8RIF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIF2"
FT                   /protein_id="AAL93763.1"
FT   gene            complement(143417..144205)
FT                   /locus_tag="FN1649"
FT   CDS_pept        complement(143417..144205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1649"
FT                   /product="Oligopeptide transport ATP-binding protein oppD"
FT                   /db_xref="EnsemblGenomes-Gn:FN1649"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93764"
FT                   /db_xref="GOA:Q8RIF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIF1"
FT                   /protein_id="AAL93764.1"
FT   gene            complement(144208..144924)
FT                   /locus_tag="FN1650"
FT   CDS_pept        complement(144208..144924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1650"
FT                   /product="Oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1650"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93765"
FT                   /db_xref="GOA:Q8RIF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIF0"
FT                   /protein_id="AAL93765.1"
FT                   LWVSLSFNLIFDKREN"
FT   gene            complement(144966..145889)
FT                   /locus_tag="FN1651"
FT   CDS_pept        complement(144966..145889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1651"
FT                   /product="Oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1651"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93766"
FT                   /db_xref="GOA:Q8RIE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE9"
FT                   /protein_id="AAL93766.1"
FT   gene            complement(146131..147630)
FT                   /locus_tag="FN1652"
FT   CDS_pept        complement(146131..147630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1652"
FT                   /product="Oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1652"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93767"
FT                   /db_xref="GOA:Q8RIE8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE8"
FT                   /protein_id="AAL93767.1"
FT   gene            complement(147742..149079)
FT                   /locus_tag="FN1653"
FT   CDS_pept        complement(147742..149079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1653"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FN1653"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93768"
FT                   /db_xref="GOA:Q8RIE7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE7"
FT                   /protein_id="AAL93768.1"
FT   gene            complement(149253..150968)
FT                   /locus_tag="FN1654"
FT   CDS_pept        complement(149253..150968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1654"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1654"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93769"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE6"
FT                   /protein_id="AAL93769.1"
FT   gene            151038..152576
FT                   /locus_tag="FN1655"
FT   CDS_pept        151038..152576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1655"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1655"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93770"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE5"
FT                   /protein_id="AAL93770.1"
FT   gene            complement(152632..152850)
FT                   /locus_tag="FN1656"
FT   CDS_pept        complement(152632..152850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1656"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1656"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93771"
FT                   /db_xref="GOA:Q8RIE4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIE4"
FT                   /protein_id="AAL93771.1"
FT   gene            complement(152895..153212)
FT                   /locus_tag="FN1657"
FT   CDS_pept        complement(152895..153212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1657"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1657"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93772"
FT                   /db_xref="GOA:Q8RIE3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIE3"
FT                   /protein_id="AAL93772.1"
FT                   D"
FT   gene            complement(153278..154981)
FT                   /locus_tag="FN1658"
FT   CDS_pept        complement(153278..154981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1658"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1658"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93773"
FT                   /db_xref="GOA:Q8RIE2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIE2"
FT                   /protein_id="AAL93773.1"
FT   gene            155176..155886
FT                   /locus_tag="FN1659"
FT   CDS_pept        155176..155886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1659"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1659"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93774"
FT                   /db_xref="GOA:Q8RIE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIE1"
FT                   /protein_id="AAL93774.1"
FT                   LDLIKMLPNLKLSS"
FT   gene            complement(155929..157998)
FT                   /locus_tag="FN1660"
FT   CDS_pept        complement(155929..157998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1660"
FT                   /product="ATP-dependent DNA helicase recG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1660"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93775"
FT                   /db_xref="GOA:Q8R6G4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G4"
FT                   /protein_id="AAL93775.1"
FT   gene            complement(158053..158802)
FT                   /locus_tag="FN1661"
FT   CDS_pept        complement(158053..158802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1661"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1661"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93776"
FT                   /db_xref="GOA:Q8RIE0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIE0"
FT                   /protein_id="AAL93776.1"
FT   gene            complement(158982..160436)
FT                   /locus_tag="FN1662"
FT   CDS_pept        complement(158982..160436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1662"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1662"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93777"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID9"
FT                   /protein_id="AAL93777.1"
FT   gene            complement(160454..161824)
FT                   /locus_tag="FN1663"
FT   CDS_pept        complement(160454..161824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1663"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1663"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93778"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID8"
FT                   /protein_id="AAL93778.1"
FT   gene            162255..162590
FT                   /locus_tag="FN1664"
FT   CDS_pept        162255..162590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1664"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1664"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93779"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID7"
FT                   /protein_id="AAL93779.1"
FT                   EVSNHYE"
FT   gene            162655..162954
FT                   /locus_tag="FN1665"
FT   CDS_pept        162655..162954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1665"
FT                   /product="Virulence-associated protein I"
FT                   /db_xref="EnsemblGenomes-Gn:FN1665"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93780"
FT                   /db_xref="GOA:Q8RID6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID6"
FT                   /protein_id="AAL93780.1"
FT   gene            162964..163317
FT                   /locus_tag="FN1666"
FT   CDS_pept        162964..163317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1666"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1666"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID5"
FT                   /protein_id="AAL93781.1"
FT                   NSIGLNSIQLPEF"
FT   gene            complement(163363..164562)
FT                   /locus_tag="FN1667"
FT   CDS_pept        complement(163363..164562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1667"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1667"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93782"
FT                   /db_xref="GOA:Q8RID4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID4"
FT                   /protein_id="AAL93782.1"
FT                   "
FT   gene            complement(164781..165653)
FT                   /locus_tag="FN1668"
FT   CDS_pept        complement(164781..165653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1668"
FT                   /product="Cholinephosphate cytidylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1668"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93783"
FT                   /db_xref="GOA:Q8RID3"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID3"
FT                   /protein_id="AAL93783.1"
FT                   EYSIELHSS"
FT   gene            complement(165650..166576)
FT                   /locus_tag="FN1669"
FT   CDS_pept        complement(165650..166576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1669"
FT                   /product="Choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1669"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93784"
FT                   /db_xref="GOA:Q8RID2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID2"
FT                   /protein_id="AAL93784.1"
FT   gene            complement(166560..168356)
FT                   /locus_tag="FN1670"
FT   CDS_pept        complement(166560..168356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1670"
FT                   /product="Choline kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Cholinephosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1670"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93785"
FT                   /db_xref="GOA:Q8RID1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017190"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID1"
FT                   /protein_id="AAL93785.1"
FT   gene            complement(168573..169910)
FT                   /locus_tag="FN1671"
FT   CDS_pept        complement(168573..169910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1671"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1671"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93786"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RID0"
FT                   /protein_id="AAL93786.1"
FT   gene            complement(169923..171383)
FT                   /locus_tag="FN1672"
FT   CDS_pept        complement(169923..171383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1672"
FT                   /product="Membrane-bound O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1672"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93787"
FT                   /db_xref="GOA:Q8RIC9"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC9"
FT                   /protein_id="AAL93787.1"
FT   gene            complement(171763..171948)
FT                   /locus_tag="FN1673"
FT   CDS_pept        complement(171763..171948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1673"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1673"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93788"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC8"
FT                   /protein_id="AAL93788.1"
FT                   FVFSRTIFDNIFRITM"
FT   gene            172181..172285
FT                   /locus_tag="FN1674"
FT   CDS_pept        172181..172285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1674"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1674"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93789"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC7"
FT                   /protein_id="AAL93789.1"
FT   gene            complement(172296..172568)
FT                   /locus_tag="FN1675"
FT   CDS_pept        complement(172296..172568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1675"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1675"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93790"
FT                   /db_xref="GOA:Q8RIC6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC6"
FT                   /protein_id="AAL93790.1"
FT   gene            172879..174054
FT                   /locus_tag="FN1676"
FT   CDS_pept        172879..174054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1676"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1676"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93791"
FT                   /db_xref="GOA:Q8RIC5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC5"
FT                   /protein_id="AAL93791.1"
FT   gene            complement(174159..174314)
FT                   /locus_tag="FN1677"
FT   CDS_pept        complement(174159..174314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1677"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1677"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93792"
FT                   /db_xref="GOA:Q8RIC4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC4"
FT                   /protein_id="AAL93792.1"
FT                   FKGDQL"
FT   gene            174427..174603
FT                   /locus_tag="FN1678"
FT   CDS_pept        174427..174603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1678"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1678"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93793"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC3"
FT                   /protein_id="AAL93793.1"
FT                   FEYLNLDILKILY"
FT   gene            complement(174680..175801)
FT                   /locus_tag="FN1679"
FT   CDS_pept        complement(174680..175801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1679"
FT                   /product="LPS biosynthesis protein WbpG"
FT                   /db_xref="EnsemblGenomes-Gn:FN1679"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93794"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC2"
FT                   /protein_id="AAL93794.1"
FT   gene            complement(176061..176345)
FT                   /locus_tag="FN1680"
FT   CDS_pept        complement(176061..176345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1680"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1680"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93795"
FT                   /db_xref="GOA:Q8RIC1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC1"
FT                   /protein_id="AAL93795.1"
FT   gene            complement(176578..176652)
FT                   /locus_tag="FN1681"
FT   CDS_pept        complement(176578..176652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1681"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1681"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIC0"
FT                   /protein_id="AAL93796.1"
FT                   /translation="MTKLKKNNKLLSAKKENTLHTKDK"
FT   gene            complement(177153..178613)
FT                   /locus_tag="FN1682"
FT   CDS_pept        complement(177153..178613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1682"
FT                   /product="Heteropolysaccharide repeat unit export protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1682"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93797"
FT                   /db_xref="GOA:Q8RIB9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB9"
FT                   /protein_id="AAL93797.1"
FT   gene            complement(178639..179172)
FT                   /locus_tag="FN1683"
FT   CDS_pept        complement(178639..179172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1683"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1683"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93798"
FT                   /db_xref="GOA:Q8R6G3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G3"
FT                   /protein_id="AAL93798.1"
FT                   DSYIFSILKKEFLL"
FT   gene            complement(179173..180228)
FT                   /locus_tag="FN1684"
FT   CDS_pept        complement(179173..180228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1684"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1684"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93799"
FT                   /db_xref="GOA:Q8RIB8"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB8"
FT                   /protein_id="AAL93799.1"
FT                   SDSYLTWKDVE"
FT   gene            complement(180225..181103)
FT                   /locus_tag="FN1685"
FT   CDS_pept        complement(180225..181103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1685"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1685"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93800"
FT                   /db_xref="GOA:Q8RIB7"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB7"
FT                   /protein_id="AAL93800.1"
FT                   GITQVLRGVKK"
FT   gene            complement(181117..181896)
FT                   /locus_tag="FN1686"
FT   CDS_pept        complement(181117..181896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1686"
FT                   /product="Spore coat polysaccharide biosynthesis protein
FT                   spsF"
FT                   /db_xref="EnsemblGenomes-Gn:FN1686"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93801"
FT                   /db_xref="GOA:Q8RIB6"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB6"
FT                   /protein_id="AAL93801.1"
FT   gene            complement(182990..183802)
FT                   /locus_tag="FN1687"
FT   CDS_pept        complement(182990..183802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1687"
FT                   /product="Gluconate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1687"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93802"
FT                   /db_xref="GOA:Q8RIB5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB5"
FT                   /protein_id="AAL93802.1"
FT   gene            complement(183787..184659)
FT                   /locus_tag="FN1688"
FT   CDS_pept        complement(183787..184659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1688"
FT                   /product="Oxidoreductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1688"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93803"
FT                   /db_xref="GOA:Q8R6G2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G2"
FT                   /protein_id="AAL93803.1"
FT                   LNPSLWREK"
FT   gene            complement(184678..185688)
FT                   /locus_tag="FN1689"
FT   CDS_pept        complement(184678..185688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1689"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /EC_number="1.1.1.-"
FT                   /note="UDP-4-dehydro-6-deoxy-2-acetamido-D-glucose
FT                   4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1689"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93804"
FT                   /db_xref="GOA:Q8R6G1"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G1"
FT                   /protein_id="AAL93804.1"
FT   gene            complement(185691..186479)
FT                   /locus_tag="FN1690"
FT   CDS_pept        complement(185691..186479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1690"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1690"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93805"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB4"
FT                   /protein_id="AAL93805.1"
FT   gene            complement(186722..187870)
FT                   /locus_tag="FN1691"
FT   CDS_pept        complement(186722..187870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1691"
FT                   /product="Hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1691"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93806"
FT                   /db_xref="GOA:Q8RIB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB3"
FT                   /protein_id="AAL93806.1"
FT   gene            complement(187873..188679)
FT                   /locus_tag="FN1692"
FT   CDS_pept        complement(187873..188679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1692"
FT                   /product="Glycosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1692"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93807"
FT                   /db_xref="GOA:Q8R6G0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6G0"
FT                   /protein_id="AAL93807.1"
FT   gene            complement(188676..189257)
FT                   /locus_tag="FN1693"
FT   CDS_pept        complement(188676..189257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1693"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1693"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93808"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB2"
FT                   /protein_id="AAL93808.1"
FT   gene            complement(189387..190259)
FT                   /locus_tag="FN1694"
FT   CDS_pept        complement(189387..190259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1694"
FT                   /product="UDP-N-acetyl-D-quinovosamine 4-epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1694"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93809"
FT                   /db_xref="GOA:Q8R6F9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F9"
FT                   /protein_id="AAL93809.1"
FT                   YKNGIKEAI"
FT   gene            complement(190259..190951)
FT                   /locus_tag="FN1695"
FT   CDS_pept        complement(190259..190951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1695"
FT                   /product="Probable quinovosaminephosphotransferae"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1695"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93810"
FT                   /db_xref="GOA:Q8R6F8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F8"
FT                   /protein_id="AAL93810.1"
FT                   KKKVGIEY"
FT   gene            complement(190966..192789)
FT                   /locus_tag="FN1696"
FT   CDS_pept        complement(190966..192789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1696"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /EC_number="1.1.1.-"
FT                   /note="UDP-4-dehydro-6-deoxy-2-acetamido-D-glucose
FT                   4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1696"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93811"
FT                   /db_xref="GOA:Q8R6F7"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F7"
FT                   /protein_id="AAL93811.1"
FT   gene            complement(192789..193775)
FT                   /locus_tag="FN1697"
FT   CDS_pept        complement(192789..193775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1697"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1697"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93812"
FT                   /db_xref="GOA:Q8RIB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB1"
FT                   /protein_id="AAL93812.1"
FT   gene            complement(193787..194683)
FT                   /locus_tag="FN1698"
FT   CDS_pept        complement(193787..194683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1698"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1698"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93813"
FT                   /db_xref="GOA:Q8RIB0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIB0"
FT                   /protein_id="AAL93813.1"
FT                   IPNWKDAIDRYFKENNK"
FT   gene            complement(194693..194941)
FT                   /locus_tag="FN1699"
FT   CDS_pept        complement(194693..194941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1699"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1699"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93814"
FT                   /db_xref="GOA:Q8RIA9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA9"
FT                   /protein_id="AAL93814.1"
FT   gene            complement(195335..195889)
FT                   /locus_tag="FN1700"
FT   CDS_pept        complement(195335..195889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1700"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1700"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93815"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA8"
FT                   /protein_id="AAL93815.1"
FT   gene            complement(195879..197228)
FT                   /locus_tag="FN1701"
FT   CDS_pept        complement(195879..197228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1701"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1701"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93816"
FT                   /db_xref="GOA:Q8RIA7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA7"
FT                   /protein_id="AAL93816.1"
FT   gene            complement(197254..198054)
FT                   /locus_tag="FN1702"
FT   CDS_pept        complement(197254..198054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1702"
FT                   /product="Bacitracin resistance protein (Putative
FT                   undecaprenol kinase)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1702"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93817"
FT                   /db_xref="GOA:Q8RIA6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIA6"
FT                   /protein_id="AAL93817.1"
FT   gene            complement(198084..199082)
FT                   /locus_tag="FN1703"
FT   CDS_pept        complement(198084..199082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1703"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1703"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93818"
FT                   /db_xref="GOA:Q8RIA5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIA5"
FT                   /protein_id="AAL93818.1"
FT   gene            199275..201557
FT                   /locus_tag="FN1704"
FT   CDS_pept        199275..201557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1704"
FT                   /product="Serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1704"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93819"
FT                   /db_xref="GOA:Q8R6F6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F6"
FT                   /protein_id="AAL93819.1"
FT                   SIGYKLD"
FT   gene            complement(201554..201763)
FT                   /locus_tag="FN1705"
FT   CDS_pept        complement(201554..201763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1705"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1705"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93820"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA4"
FT                   /protein_id="AAL93820.1"
FT   gene            201573..202337
FT                   /locus_tag="FN1706"
FT   CDS_pept        201573..202337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1706"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1706"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93821"
FT                   /db_xref="GOA:Q8RIA3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA3"
FT                   /protein_id="AAL93821.1"
FT   gene            202321..203328
FT                   /locus_tag="FN1707"
FT   CDS_pept        202321..203328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1707"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1707"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93822"
FT                   /db_xref="GOA:Q8RIA2"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA2"
FT                   /protein_id="AAL93822.1"
FT   gene            203428..205539
FT                   /locus_tag="FN1708"
FT   CDS_pept        203428..205539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1708"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1708"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93823"
FT                   /db_xref="GOA:Q8RIA1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RIA1"
FT                   /protein_id="AAL93823.1"
FT                   KISLSKKKV"
FT   gene            205555..206118
FT                   /locus_tag="FN1709"
FT   CDS_pept        205555..206118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1709"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1709"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93824"
FT                   /db_xref="GOA:Q8RIA0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RIA0"
FT                   /protein_id="AAL93824.1"
FT   gene            206132..206407
FT                   /locus_tag="FN1710"
FT   CDS_pept        206132..206407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1710"
FT                   /product="Integral membrane protein, YGGT family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1710"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93825"
FT                   /db_xref="GOA:Q8RI99"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI99"
FT                   /protein_id="AAL93825.1"
FT   gene            206465..207409
FT                   /locus_tag="FN1711"
FT   CDS_pept        206465..207409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1711"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1711"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93826"
FT                   /db_xref="GOA:Q8R6F5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6F5"
FT                   /protein_id="AAL93826.1"
FT   gene            207402..207668
FT                   /locus_tag="FN1712"
FT   CDS_pept        207402..207668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1712"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1712"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93827"
FT                   /db_xref="GOA:Q8RI98"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI98"
FT                   /protein_id="AAL93827.1"
FT   gene            207634..209028
FT                   /locus_tag="FN1713"
FT   CDS_pept        207634..209028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1713"
FT                   /product="tRNA (Uracil-5-)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1713"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93828"
FT                   /db_xref="GOA:Q8R5Z8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z8"
FT                   /protein_id="AAL93828.1"
FT                   LIERKI"
FT   gene            210116..211096
FT                   /locus_tag="FN1714"
FT   CDS_pept        210116..211096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1714"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1714"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI97"
FT                   /protein_id="AAL93829.1"
FT   gene            211180..212472
FT                   /locus_tag="FN1715"
FT   CDS_pept        211180..212472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1715"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1715"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93830"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI96"
FT                   /protein_id="AAL93830.1"
FT   gene            212616..213185
FT                   /locus_tag="FN1716"
FT   CDS_pept        212616..213185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1716"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1716"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93831"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI95"
FT                   /protein_id="AAL93831.1"
FT   gene            213290..215380
FT                   /locus_tag="FN1717"
FT   CDS_pept        213290..215380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1717"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1717"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93832"
FT                   /db_xref="GOA:Q8RI94"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI94"
FT                   /protein_id="AAL93832.1"
FT                   FD"
FT   gene            215439..218048
FT                   /locus_tag="FN1718"
FT   CDS_pept        215439..218048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1718"
FT                   /product="Protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1718"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93833"
FT                   /db_xref="GOA:Q8RI93"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI93"
FT                   /protein_id="AAL93833.1"
FT   gene            218088..218807
FT                   /locus_tag="FN1719"
FT   CDS_pept        218088..218807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1719"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1719"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI92"
FT                   /protein_id="AAL93834.1"
FT                   LYLAYPQFLSKVDRWGR"
FT   gene            complement(218861..219589)
FT                   /locus_tag="FN1720"
FT   CDS_pept        complement(218861..219589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1720"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1720"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93835"
FT                   /db_xref="GOA:Q8RI91"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI91"
FT                   /protein_id="AAL93835.1"
FT   gene            complement(219751..220035)
FT                   /locus_tag="FN1721"
FT   CDS_pept        complement(219751..220035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1721"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1721"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93836"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI90"
FT                   /protein_id="AAL93836.1"
FT   gene            complement(220134..220832)
FT                   /locus_tag="FN1722"
FT   CDS_pept        complement(220134..220832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1722"
FT                   /product="Glucose inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:FN1722"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93837"
FT                   /db_xref="GOA:Q8RI89"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI89"
FT                   /protein_id="AAL93837.1"
FT                   KIGIPLKKPL"
FT   gene            complement(220834..222735)
FT                   /locus_tag="FN1723"
FT   CDS_pept        complement(220834..222735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1723"
FT                   /product="Glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:FN1723"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93838"
FT                   /db_xref="GOA:Q8RI88"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI88"
FT                   /protein_id="AAL93838.1"
FT   gene            complement(222744..223400)
FT                   /locus_tag="FN1724"
FT   CDS_pept        complement(222744..223400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1724"
FT                   /product="Potassium uptake protein KtrA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1724"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93839"
FT                   /db_xref="GOA:Q8RI87"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI87"
FT                   /protein_id="AAL93839.1"
FT   gene            complement(223415..224761)
FT                   /locus_tag="FN1725"
FT   CDS_pept        complement(223415..224761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1725"
FT                   /product="Potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1725"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93840"
FT                   /db_xref="GOA:Q8RI86"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI86"
FT                   /protein_id="AAL93840.1"
FT   gene            complement(224776..226149)
FT                   /locus_tag="FN1726"
FT   CDS_pept        complement(224776..226149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1726"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FN1726"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93841"
FT                   /db_xref="GOA:Q8RI85"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI85"
FT                   /protein_id="AAL93841.1"
FT   gene            complement(226152..227717)
FT                   /locus_tag="FN1727"
FT   CDS_pept        complement(226152..227717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1727"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1727"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93842"
FT                   /db_xref="GOA:Q8RI84"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI84"
FT                   /protein_id="AAL93842.1"
FT                   TSVE"
FT   gene            complement(227812..228456)
FT                   /locus_tag="FN1728"
FT   CDS_pept        complement(227812..228456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1728"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1728"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93843"
FT                   /db_xref="GOA:Q8RI83"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI83"
FT                   /protein_id="AAL93843.1"
FT   gene            complement(228428..229177)
FT                   /locus_tag="FN1729"
FT   CDS_pept        complement(228428..229177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1729"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1729"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93844"
FT                   /db_xref="GOA:Q8R6F4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F4"
FT                   /protein_id="AAL93844.1"
FT   gene            complement(229171..230532)
FT                   /locus_tag="FN1730"
FT   CDS_pept        complement(229171..230532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1730"
FT                   /product="Para-aminobenzoate synthase component I"
FT                   /EC_number="4.1.3.-"
FT                   /EC_number=""
FT                   /note="Anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:FN1730"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93845"
FT                   /db_xref="GOA:Q8R6F3"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F3"
FT                   /protein_id="AAL93845.1"
FT   gene            complement(230516..231127)
FT                   /locus_tag="FN1731"
FT   CDS_pept        complement(230516..231127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1731"
FT                   /product="Anthranilate synthase component II"
FT                   /EC_number=""
FT                   /EC_number="4.1.3.-"
FT                   /note="Para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:FN1731"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93846"
FT                   /db_xref="GOA:Q8RI82"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI82"
FT                   /protein_id="AAL93846.1"
FT   gene            complement(231371..232168)
FT                   /locus_tag="FN1732"
FT   CDS_pept        complement(231371..232168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1732"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1732"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93847"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI81"
FT                   /protein_id="AAL93847.1"
FT   gene            complement(232326..232961)
FT                   /locus_tag="FN1733"
FT   CDS_pept        complement(232326..232961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1733"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1733"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93848"
FT                   /db_xref="GOA:Q8RI80"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI80"
FT                   /protein_id="AAL93848.1"
FT   gene            complement(232972..234348)
FT                   /locus_tag="FN1734"
FT   CDS_pept        complement(232972..234348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1734"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1734"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93849"
FT                   /db_xref="GOA:Q8RI79"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI79"
FT                   /protein_id="AAL93849.1"
FT                   "
FT   gene            complement(234341..235489)
FT                   /locus_tag="FN1735"
FT   CDS_pept        complement(234341..235489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1735"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1735"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93850"
FT                   /db_xref="GOA:Q8RI78"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI78"
FT                   /protein_id="AAL93850.1"
FT   gene            complement(235503..236111)
FT                   /locus_tag="FN1736"
FT   CDS_pept        complement(235503..236111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1736"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1736"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93851"
FT                   /db_xref="GOA:Q8RI77"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI77"
FT                   /protein_id="AAL93851.1"
FT   gene            complement(236129..236446)
FT                   /locus_tag="FN1737"
FT   CDS_pept        complement(236129..236446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1737"
FT                   /product="V-type sodium ATP synthase subunit G"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1737"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93852"
FT                   /db_xref="GOA:Q8RI76"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI76"
FT                   /protein_id="AAL93852.1"
FT                   M"
FT   gene            complement(236430..237434)
FT                   /locus_tag="FN1738"
FT   CDS_pept        complement(236430..237434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1738"
FT                   /product="V-type sodium ATP synthase subunit C"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1738"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93853"
FT                   /db_xref="GOA:Q8RI75"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI75"
FT                   /protein_id="AAL93853.1"
FT   gene            complement(237441..237992)
FT                   /locus_tag="FN1739"
FT   CDS_pept        complement(237441..237992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1739"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1739"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93854"
FT                   /db_xref="GOA:Q8RI74"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI74"
FT                   /protein_id="AAL93854.1"
FT   gene            complement(238008..238490)
FT                   /locus_tag="FN1740"
FT   CDS_pept        complement(238008..238490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1740"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1740"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93855"
FT                   /db_xref="GOA:Q8RI73"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI73"
FT                   /protein_id="AAL93855.1"
FT   gene            complement(238651..240567)
FT                   /locus_tag="FN1741"
FT   CDS_pept        complement(238651..240567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1741"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1741"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93856"
FT                   /db_xref="GOA:Q8RI72"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI72"
FT                   /protein_id="AAL93856.1"
FT                   FRV"
FT   gene            complement(240554..240880)
FT                   /locus_tag="FN1742"
FT   CDS_pept        complement(240554..240880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1742"
FT                   /product="V-type sodium ATP synthase subunit G"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1742"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93857"
FT                   /db_xref="GOA:Q8RI71"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI71"
FT                   /protein_id="AAL93857.1"
FT                   NGNS"
FT   gene            complement(241122..241928)
FT                   /locus_tag="FN1743"
FT   CDS_pept        complement(241122..241928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1743"
FT                   /product="Multidrug-efflux transporter 2 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FN1743"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93858"
FT                   /db_xref="GOA:Q8RI70"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI70"
FT                   /protein_id="AAL93858.1"
FT   gene            complement(242129..243010)
FT                   /locus_tag="FN1744"
FT   CDS_pept        complement(242129..243010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1744"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1744"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93859"
FT                   /db_xref="GOA:Q8RI69"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI69"
FT                   /protein_id="AAL93859.1"
FT                   VCIINMTDKLEN"
FT   gene            complement(243043..244233)
FT                   /locus_tag="FN1745"
FT   CDS_pept        complement(243043..244233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1745"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1745"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93860"
FT                   /db_xref="GOA:Q8RI68"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI68"
FT                   /protein_id="AAL93860.1"
FT   gene            244481..245740
FT                   /locus_tag="FN1746"
FT   CDS_pept        244481..245740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1746"
FT                   /product="Cystathionine beta-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1746"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93861"
FT                   /db_xref="GOA:Q8RI67"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI67"
FT                   /protein_id="AAL93861.1"
FT   gene            245787..247322
FT                   /locus_tag="FN1747"
FT   CDS_pept        245787..247322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1747"
FT                   /product="Cysteine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN1747"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93862"
FT                   /db_xref="GOA:Q8RI66"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI66"
FT                   /protein_id="AAL93862.1"
FT   gene            247392..247619
FT                   /locus_tag="FN1748"
FT   CDS_pept        247392..247619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1748"
FT                   /product="Pyruvate-flavodoxin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1748"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93863"
FT                   /db_xref="GOA:Q8R6F2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F2"
FT                   /protein_id="AAL93863.1"
FT   gene            247601..247765
FT                   /locus_tag="FN1749"
FT   CDS_pept        247601..247765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1749"
FT                   /product="Pyruvate-flavodoxin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1749"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93864"
FT                   /protein_id="AAL93864.1"
FT                   ALSIFGDHQ"
FT   gene            247951..248139
FT                   /locus_tag="FN1750"
FT   CDS_pept        247951..248139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1750"
FT                   /product="Pyruvate-flavodoxin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1750"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93865"
FT                   /db_xref="GOA:Q8R6F0"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6F0"
FT                   /protein_id="AAL93865.1"
FT                   VSMGANQQQFLKAYTRS"
FT   gene            248207..248503
FT                   /locus_tag="FN1751"
FT   CDS_pept        248207..248503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1751"
FT                   /product="Pyruvate-flavodoxin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1751"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93866"
FT                   /db_xref="GOA:Q8R6E9"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E9"
FT                   /protein_id="AAL93866.1"
FT   gene            complement(248681..249301)
FT                   /locus_tag="FN1752"
FT   CDS_pept        complement(248681..249301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1752"
FT                   /product="Regulatory protein TENI"
FT                   /db_xref="EnsemblGenomes-Gn:FN1752"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93867"
FT                   /db_xref="GOA:Q8RI65"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI65"
FT                   /protein_id="AAL93867.1"
FT   gene            complement(249304..250434)
FT                   /locus_tag="FN1753"
FT   CDS_pept        complement(249304..250434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1753"
FT                   /product="ThiH protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1753"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93868"
FT                   /db_xref="GOA:Q8RI64"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI64"
FT                   /protein_id="AAL93868.1"
FT   gene            complement(250434..251207)
FT                   /locus_tag="FN1754"
FT   CDS_pept        complement(250434..251207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1754"
FT                   /product="Thiazole biosynthesis protein thiG"
FT                   /db_xref="EnsemblGenomes-Gn:FN1754"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93869"
FT                   /db_xref="GOA:Q8RI63"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI63"
FT                   /protein_id="AAL93869.1"
FT   gene            complement(251330..251827)
FT                   /locus_tag="FN1755"
FT   CDS_pept        complement(251330..251827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1755"
FT                   /product="ThiF protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1755"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93870"
FT                   /db_xref="GOA:Q8RI62"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI62"
FT                   /protein_id="AAL93870.1"
FT                   FI"
FT   gene            complement(251831..252025)
FT                   /locus_tag="FN1756"
FT   CDS_pept        complement(251831..252025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1756"
FT                   /product="ThiS protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1756"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93871"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI61"
FT                   /protein_id="AAL93871.1"
FT   gene            complement(252038..253339)
FT                   /locus_tag="FN1757"
FT   CDS_pept        complement(252038..253339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1757"
FT                   /product="Thiamine biosynthesis protein thiC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1757"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93872"
FT                   /db_xref="GOA:Q8RI60"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI60"
FT                   /protein_id="AAL93872.1"
FT   gene            complement(253356..253976)
FT                   /locus_tag="FN1758"
FT   CDS_pept        complement(253356..253976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1758"
FT                   /product="Thiamin-phosphate pyrophosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1758"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93873"
FT                   /db_xref="GOA:Q8RI59"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI59"
FT                   /protein_id="AAL93873.1"
FT   gene            complement(253986..254855)
FT                   /locus_tag="FN1759"
FT   CDS_pept        complement(253986..254855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1759"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Hydroxymethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1759"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93874"
FT                   /db_xref="GOA:Q8RI58"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI58"
FT                   /protein_id="AAL93874.1"
FT                   NIDIEKLY"
FT   tRNA            complement(255127..255201)
FT                   /product="tRNA-Gln"
FT   tRNA            complement(255208..255284)
FT                   /product="tRNA-Pro"
FT   gene            complement(255348..256094)
FT                   /locus_tag="FN1762"
FT   CDS_pept        complement(255348..256094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1762"
FT                   /product="Protein yaaA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1762"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93875"
FT                   /db_xref="GOA:Q8RI57"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI57"
FT                   /protein_id="AAL93875.1"
FT   gene            complement(256098..256652)
FT                   /locus_tag="FN1763"
FT   CDS_pept        complement(256098..256652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1763"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1763"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93876"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI56"
FT                   /protein_id="AAL93876.1"
FT   gene            complement(256783..258087)
FT                   /locus_tag="FN1764"
FT   CDS_pept        complement(256783..258087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1764"
FT                   /product="Enolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1764"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93877"
FT                   /db_xref="GOA:Q8RI55"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI55"
FT                   /protein_id="AAL93877.1"
FT   gene            complement(258113..259540)
FT                   /locus_tag="FN1765"
FT   CDS_pept        complement(258113..259540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1765"
FT                   /product="Pyruvate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1765"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93878"
FT                   /db_xref="GOA:Q8RI54"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI54"
FT                   /protein_id="AAL93878.1"
FT                   VFIQGTTNSIKVIQVKA"
FT   tRNA            complement(259676..259752)
FT                   /product="tRNA-Met"
FT   tRNA            complement(259757..259833)
FT                   /product="tRNA-Ala"
FT   tRNA            complement(259852..259927)
FT                   /product="tRNA-Gly"
FT   tRNA            complement(259945..260028)
FT                   /product="tRNA-Leu"
FT   tRNA            complement(260044..260119)
FT                   /product="tRNA-Thr"
FT   tRNA            complement(260128..260204)
FT                   /product="tRNA-Asp"
FT   tRNA            complement(260215..260290)
FT                   /product="tRNA-Val"
FT   tRNA            complement(260295..260369)
FT                   /product="tRNA-Glu"
FT   tRNA            complement(260377..260452)
FT                   /product="tRNA-Lys"
FT   tRNA            complement(260460..260535)
FT                   /product="tRNA-Gly"
FT   tRNA            complement(260587..260660)
FT                   /product="tRNA-Cys"
FT   tRNA            complement(260676..260751)
FT                   /product="tRNA-Phe"
FT   tRNA            complement(260770..260846)
FT                   /product="tRNA-Asp"
FT   tRNA            complement(260857..260932)
FT                   /product="tRNA-Val"
FT   gene            complement(261011..261754)
FT                   /locus_tag="FN1780"
FT   CDS_pept        complement(261011..261754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1780"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1780"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93879"
FT                   /db_xref="InterPro:IPR025357"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI53"
FT                   /protein_id="AAL93879.1"
FT   gene            complement(261822..264305)
FT                   /locus_tag="FN1781"
FT   CDS_pept        complement(261822..264305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1781"
FT                   /product="LytB protein"
FT                   /note="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1781"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93880"
FT                   /db_xref="GOA:Q8RI52"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI52"
FT                   /protein_id="AAL93880.1"
FT                   EREQIEKYSTSSSEE"
FT   gene            complement(264311..264580)
FT                   /locus_tag="FN1782"
FT   CDS_pept        complement(264311..264580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1782"
FT                   /product="Phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:FN1782"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93881"
FT                   /db_xref="GOA:Q8RI51"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI51"
FT                   /protein_id="AAL93881.1"
FT   gene            264766..265590
FT                   /locus_tag="FN1783"
FT   CDS_pept        264766..265590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1783"
FT                   /product="Ethanolamine utilization protein eutJ"
FT                   /db_xref="EnsemblGenomes-Gn:FN1783"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93882"
FT                   /db_xref="GOA:Q8RI50"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI50"
FT                   /protein_id="AAL93882.1"
FT   gene            complement(265825..266280)
FT                   /locus_tag="FN1784"
FT   CDS_pept        complement(265825..266280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1784"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1784"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93883"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI49"
FT                   /protein_id="AAL93883.1"
FT   gene            complement(266302..266775)
FT                   /locus_tag="FN1785"
FT   CDS_pept        complement(266302..266775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1785"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1785"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93884"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI48"
FT                   /protein_id="AAL93884.1"
FT   gene            266910..267881
FT                   /locus_tag="FN1786"
FT   CDS_pept        266910..267881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1786"
FT                   /product="ADP-heptose synthase"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1786"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93885"
FT                   /db_xref="GOA:Q8R6E8"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E8"
FT                   /protein_id="AAL93885.1"
FT   gene            267902..269788
FT                   /locus_tag="FN1787"
FT   CDS_pept        267902..269788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1787"
FT                   /product="Tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1787"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93886"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI47"
FT                   /protein_id="AAL93886.1"
FT   gene            269811..270293
FT                   /locus_tag="FN1788"
FT   CDS_pept        269811..270293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1788"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1788"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93887"
FT                   /db_xref="GOA:Q8R6E7"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6E7"
FT                   /protein_id="AAL93887.1"
FT   gene            270260..271639
FT                   /locus_tag="FN1789"
FT   CDS_pept        270260..271639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1789"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FN1789"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93888"
FT                   /db_xref="GOA:Q8RI46"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI46"
FT                   /protein_id="AAL93888.1"
FT                   N"
FT   gene            271651..272172
FT                   /locus_tag="FN1790"
FT   CDS_pept        271651..272172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1790"
FT                   /product="Cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1790"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93889"
FT                   /db_xref="GOA:Q8RI45"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI45"
FT                   /protein_id="AAL93889.1"
FT                   GVMARKGIEK"
FT   gene            272181..272939
FT                   /locus_tag="FN1791"
FT   CDS_pept        272181..272939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1791"
FT                   /product="Mutator MutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1791"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93890"
FT                   /db_xref="GOA:Q8R6E6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E6"
FT                   /protein_id="AAL93890.1"
FT   gene            complement(272989..273354)
FT                   /locus_tag="FN1792"
FT   CDS_pept        complement(272989..273354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1792"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1792"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93891"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI44"
FT                   /protein_id="AAL93891.1"
FT                   ILTLGDLKEVPVTVEAK"
FT   gene            complement(273624..275363)
FT                   /locus_tag="FN1793"
FT   CDS_pept        complement(273624..275363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1793"
FT                   /product="Phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1793"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93892"
FT                   /db_xref="GOA:Q8RI43"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI43"
FT                   /protein_id="AAL93892.1"
FT                   EKI"
FT   gene            complement(275418..275681)
FT                   /locus_tag="FN1794"
FT   CDS_pept        complement(275418..275681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1794"
FT                   /product="Phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:FN1794"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93893"
FT                   /db_xref="GOA:Q8RI42"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI42"
FT                   /protein_id="AAL93893.1"
FT   gene            complement(275829..276668)
FT                   /locus_tag="FN1795"
FT   CDS_pept        complement(275829..276668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1795"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1795"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93894"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI41"
FT                   /protein_id="AAL93894.1"
FT   gene            278616..278855
FT                   /locus_tag="FN1796"
FT   CDS_pept        278616..278855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1796"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1796"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI40"
FT                   /protein_id="AAL93895.1"
FT   gene            278961..280091
FT                   /locus_tag="FN1797"
FT   CDS_pept        278961..280091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1797"
FT                   /product="Spermidine/putrescine transport ATP-binding
FT                   protein potA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1797"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93896"
FT                   /db_xref="GOA:Q8RI39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI39"
FT                   /protein_id="AAL93896.1"
FT   gene            280078..280932
FT                   /locus_tag="FN1798"
FT   CDS_pept        280078..280932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1798"
FT                   /product="Spermidine/putrescine transport system permease
FT                   protein potB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1798"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93897"
FT                   /db_xref="GOA:Q8RI38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI38"
FT                   /protein_id="AAL93897.1"
FT                   NNV"
FT   gene            280916..281710
FT                   /locus_tag="FN1799"
FT   CDS_pept        280916..281710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1799"
FT                   /product="Spermidine/putrescine transport system permease
FT                   protein potC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1799"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93898"
FT                   /db_xref="GOA:Q8RI37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI37"
FT                   /protein_id="AAL93898.1"
FT   gene            281770..282594
FT                   /locus_tag="FN1800"
FT   CDS_pept        281770..282594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1800"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1800"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93899"
FT                   /db_xref="GOA:Q8RI36"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI36"
FT                   /protein_id="AAL93899.1"
FT   gene            complement(282726..283967)
FT                   /locus_tag="FN1801"
FT   CDS_pept        complement(282726..283967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1801"
FT                   /product="Sodium/glutamate symport carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1801"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93900"
FT                   /db_xref="GOA:Q8RI35"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI35"
FT                   /protein_id="AAL93900.1"
FT                   TVWFIKTFIKGFVQ"
FT   gene            284088..284246
FT                   /locus_tag="FN1802"
FT   CDS_pept        284088..284246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1802"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1802"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93901"
FT                   /db_xref="GOA:Q8RI34"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI34"
FT                   /protein_id="AAL93901.1"
FT                   IYYIYNF"
FT   gene            284354..285007
FT                   /locus_tag="FN1803"
FT   CDS_pept        284354..285007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1803"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1803"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93902"
FT                   /db_xref="GOA:Q8RI33"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI33"
FT                   /protein_id="AAL93902.1"
FT   gene            285065..286525
FT                   /locus_tag="FN1804"
FT   CDS_pept        285065..286525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1804"
FT                   /product="Aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1804"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93903"
FT                   /db_xref="GOA:Q8RI32"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI32"
FT                   /protein_id="AAL93903.1"
FT   gene            286593..287759
FT                   /locus_tag="FN1805"
FT   CDS_pept        286593..287759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1805"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1805"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93904"
FT                   /db_xref="GOA:Q8RI31"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI31"
FT                   /protein_id="AAL93904.1"
FT   gene            287864..288727
FT                   /locus_tag="FN1806"
FT   CDS_pept        287864..288727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1806"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1806"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93905"
FT                   /db_xref="GOA:Q8RI30"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI30"
FT                   /protein_id="AAL93905.1"
FT                   KKTVTN"
FT   gene            complement(288775..289569)
FT                   /locus_tag="FN1807"
FT   CDS_pept        complement(288775..289569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1807"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1807"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93906"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI29"
FT                   /protein_id="AAL93906.1"
FT   gene            complement(289618..289995)
FT                   /locus_tag="FN1808"
FT   CDS_pept        complement(289618..289995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1808"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1808"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI28"
FT                   /protein_id="AAL93907.1"
FT   gene            complement(290270..291121)
FT                   /locus_tag="FN1809"
FT   CDS_pept        complement(290270..291121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1809"
FT                   /product="Iron/zinc/copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1809"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93908"
FT                   /db_xref="GOA:Q8RI27"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI27"
FT                   /protein_id="AAL93908.1"
FT                   SK"
FT   gene            complement(291150..292043)
FT                   /locus_tag="FN1810"
FT   CDS_pept        complement(291150..292043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1810"
FT                   /product="Manganese transport system membrane protein mntB"
FT                   /db_xref="EnsemblGenomes-Gn:FN1810"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93909"
FT                   /db_xref="GOA:Q8RI26"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI26"
FT                   /protein_id="AAL93909.1"
FT                   VTIIIKVLFKNFAEGE"
FT   gene            complement(292251..292940)
FT                   /locus_tag="FN1811"
FT   CDS_pept        complement(292251..292940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1811"
FT                   /product="Manganese transport system ATP-binding protein
FT                   mntA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1811"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93910"
FT                   /db_xref="GOA:Q8RI25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI25"
FT                   /protein_id="AAL93910.1"
FT                   KIMRIFE"
FT   gene            complement(292942..293850)
FT                   /locus_tag="FN1812"
FT   CDS_pept        complement(292942..293850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1812"
FT                   /product="Manganese-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1812"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93911"
FT                   /db_xref="GOA:Q8RI24"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI24"
FT                   /protein_id="AAL93911.1"
FT   gene            complement(293862..294770)
FT                   /locus_tag="FN1813"
FT   CDS_pept        complement(293862..294770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1813"
FT                   /product="Manganese-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1813"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93912"
FT                   /db_xref="GOA:Q8RI23"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI23"
FT                   /protein_id="AAL93912.1"
FT   gene            complement(294782..295360)
FT                   /locus_tag="FN1814"
FT   CDS_pept        complement(294782..295360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1814"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1814"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93913"
FT                   /db_xref="GOA:Q8RI22"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI22"
FT                   /protein_id="AAL93913.1"
FT   gene            complement(295716..296051)
FT                   /locus_tag="FN1815"
FT   CDS_pept        complement(295716..296051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1815"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1815"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93914"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI21"
FT                   /protein_id="AAL93914.1"
FT                   RLGLYNK"
FT   gene            complement(296229..296930)
FT                   /locus_tag="FN1816"
FT   CDS_pept        complement(296229..296930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1816"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1816"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93915"
FT                   /db_xref="InterPro:IPR025412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI20"
FT                   /protein_id="AAL93915.1"
FT                   IEMGLEKLIKN"
FT   gene            complement(296943..305363)
FT                   /locus_tag="FN1817"
FT   CDS_pept        complement(296943..305363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1817"
FT                   /product="Hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:FN1817"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93916"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI19"
FT                   /protein_id="AAL93916.1"
FT   gene            complement(305378..307045)
FT                   /locus_tag="FN1818"
FT   CDS_pept        complement(305378..307045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1818"
FT                   /product="Hemolysin activator protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1818"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93917"
FT                   /db_xref="GOA:Q8RI18"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI18"
FT                   /protein_id="AAL93917.1"
FT   gene            307659..309404
FT                   /locus_tag="FN1819"
FT   CDS_pept        307659..309404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1819"
FT                   /product="Export ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1819"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93918"
FT                   /db_xref="GOA:Q8RI17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI17"
FT                   /protein_id="AAL93918.1"
FT                   ENNEK"
FT   gene            309385..311076
FT                   /locus_tag="FN1820"
FT   CDS_pept        309385..311076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1820"
FT                   /product="Export ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1820"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93919"
FT                   /db_xref="GOA:Q8RI16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI16"
FT                   /protein_id="AAL93919.1"
FT   gene            311171..311269
FT                   /locus_tag="FN1821"
FT   CDS_pept        311171..311269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1821"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1821"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI15"
FT                   /protein_id="AAL93920.1"
FT                   /translation="MASNTPRFVRLTLFNFYSKIWNVTHLFLFNNL"
FT   gene            311288..311797
FT                   /locus_tag="FN1822"
FT   CDS_pept        311288..311797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1822"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FN1822"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93921"
FT                   /db_xref="GOA:Q8RI14"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI14"
FT                   /protein_id="AAL93921.1"
FT                   DKNFNY"
FT   gene            311860..312330
FT                   /locus_tag="FN1823"
FT   CDS_pept        311860..312330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1823"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1823"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93922"
FT                   /db_xref="GOA:Q8RI13"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI13"
FT                   /protein_id="AAL93922.1"
FT   gene            complement(312370..313986)
FT                   /locus_tag="FN1824"
FT   CDS_pept        complement(312370..313986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1824"
FT                   /product="Manganese-dependent inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1824"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93923"
FT                   /db_xref="GOA:Q8RI12"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI12"
FT                   /protein_id="AAL93923.1"
FT   gene            314134..314571
FT                   /locus_tag="FN1825"
FT   CDS_pept        314134..314571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1825"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1825"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93924"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI11"
FT                   /protein_id="AAL93924.1"
FT   gene            complement(314744..315976)
FT                   /locus_tag="FN1826"
FT   CDS_pept        complement(314744..315976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1826"
FT                   /product="Protease"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1826"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93925"
FT                   /db_xref="GOA:Q8R6E5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E5"
FT                   /protein_id="AAL93925.1"
FT                   MNELDMLRIVL"
FT   gene            complement(315989..317329)
FT                   /locus_tag="FN1827"
FT   CDS_pept        complement(315989..317329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1827"
FT                   /product="Replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1827"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93926"
FT                   /db_xref="GOA:Q8R6E4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E4"
FT                   /protein_id="AAL93926.1"
FT   gene            complement(317341..317790)
FT                   /locus_tag="FN1828"
FT   CDS_pept        complement(317341..317790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1828"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1828"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93927"
FT                   /db_xref="GOA:Q8RI10"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RI10"
FT                   /protein_id="AAL93927.1"
FT   gene            complement(317807..318646)
FT                   /locus_tag="FN1829"
FT   CDS_pept        complement(317807..318646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1829"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1829"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93928"
FT                   /db_xref="GOA:Q8RI09"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI09"
FT                   /protein_id="AAL93928.1"
FT   gene            complement(318661..320115)
FT                   /locus_tag="FN1830"
FT   CDS_pept        complement(318661..320115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1830"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1830"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93929"
FT                   /db_xref="GOA:Q8RI08"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI08"
FT                   /protein_id="AAL93929.1"
FT   gene            complement(320119..321513)
FT                   /locus_tag="FN1831"
FT   CDS_pept        complement(320119..321513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1831"
FT                   /product="Nitrogen assimilation regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1831"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93930"
FT                   /db_xref="GOA:Q8RI07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI07"
FT                   /protein_id="AAL93930.1"
FT                   NYYDLE"
FT   gene            complement(321530..322234)
FT                   /locus_tag="FN1832"
FT   CDS_pept        complement(321530..322234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1832"
FT                   /product="TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1832"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93931"
FT                   /db_xref="GOA:Q8RI06"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI06"
FT                   /protein_id="AAL93931.1"
FT                   GTFYLNYNFNFK"
FT   gene            complement(322312..322656)
FT                   /locus_tag="FN1833"
FT   CDS_pept        complement(322312..322656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1833"
FT                   /product="Biopolymer transport exbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1833"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93932"
FT                   /db_xref="GOA:Q8RI05"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI05"
FT                   /protein_id="AAL93932.1"
FT                   INIDTAIQSR"
FT   gene            complement(322766..323329)
FT                   /locus_tag="FN1834"
FT   CDS_pept        complement(322766..323329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1834"
FT                   /product="Biopolymer transport exbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1834"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93933"
FT                   /db_xref="GOA:Q8RI04"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI04"
FT                   /protein_id="AAL93933.1"
FT   gene            complement(323405..323770)
FT                   /locus_tag="FN1835"
FT   CDS_pept        complement(323405..323770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1835"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1835"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93934"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI03"
FT                   /protein_id="AAL93934.1"
FT                   GVEKKGFFRRVLDKLFG"
FT   gene            complement(323994..326804)
FT                   /locus_tag="FN1836"
FT   CDS_pept        complement(323994..326804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1836"
FT                   /product="Tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1836"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93935"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI02"
FT                   /protein_id="AAL93935.1"
FT                   KFKAYF"
FT   gene            complement(326815..327345)
FT                   /locus_tag="FN1837"
FT   CDS_pept        complement(326815..327345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1837"
FT                   /product="putative nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1837"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93936"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI01"
FT                   /protein_id="AAL93936.1"
FT                   MDDIYEILDEINL"
FT   gene            327629..328393
FT                   /locus_tag="FN1838"
FT   CDS_pept        327629..328393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1838"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1838"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93937"
FT                   /db_xref="GOA:Q8RI00"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RI00"
FT                   /protein_id="AAL93937.1"
FT   gene            328412..329905
FT                   /locus_tag="FN1839"
FT   CDS_pept        328412..329905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1839"
FT                   /product="Glycerol kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1839"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93938"
FT                   /db_xref="GOA:Q8RHZ9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHZ9"
FT                   /protein_id="AAL93938.1"
FT   gene            329975..330973
FT                   /locus_tag="FN1840"
FT   CDS_pept        329975..330973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1840"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1840"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93939"
FT                   /db_xref="GOA:Q8RHZ8"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ8"
FT                   /protein_id="AAL93939.1"
FT   gene            331019..331627
FT                   /locus_tag="FN1841"
FT   CDS_pept        331019..331627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1841"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1841"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93940"
FT                   /db_xref="GOA:Q8RHZ7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ7"
FT                   /protein_id="AAL93940.1"
FT   gene            331631..332041
FT                   /locus_tag="FN1842"
FT   CDS_pept        331631..332041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1842"
FT                   /product="Dihydroxyacetone kinase phosphotransfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1842"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93941"
FT                   /db_xref="GOA:Q8RHZ6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ6"
FT                   /protein_id="AAL93941.1"
FT   gene            332077..333528
FT                   /locus_tag="FN1843"
FT   CDS_pept        332077..333528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1843"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:FN1843"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93942"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ5"
FT                   /protein_id="AAL93942.1"
FT   gene            333733..334506
FT                   /locus_tag="FN1844"
FT   CDS_pept        333733..334506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1844"
FT                   /product="Ketoacyl reductase hetN"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1844"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93943"
FT                   /db_xref="GOA:Q8R6E3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E3"
FT                   /protein_id="AAL93943.1"
FT   gene            334527..335669
FT                   /locus_tag="FN1845"
FT   CDS_pept        334527..335669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1845"
FT                   /product="Ceramide glucosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1845"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93944"
FT                   /db_xref="GOA:Q8RHZ4"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ4"
FT                   /protein_id="AAL93944.1"
FT   gene            335659..336285
FT                   /locus_tag="FN1846"
FT   CDS_pept        335659..336285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1846"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1846"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ3"
FT                   /protein_id="AAL93945.1"
FT   gene            336282..337268
FT                   /locus_tag="FN1847"
FT   CDS_pept        336282..337268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1847"
FT                   /product="DTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="DTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1847"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93946"
FT                   /db_xref="GOA:Q8RHZ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ2"
FT                   /protein_id="AAL93946.1"
FT   gene            337252..338043
FT                   /locus_tag="FN1848"
FT   CDS_pept        337252..338043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1848"
FT                   /product="Metal dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1848"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93947"
FT                   /db_xref="GOA:Q8R6E2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E2"
FT                   /protein_id="AAL93947.1"
FT   gene            338074..339348
FT                   /locus_tag="FN1849"
FT   CDS_pept        338074..339348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1849"
FT                   /product="Coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1849"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93948"
FT                   /db_xref="InterPro:IPR012685"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ1"
FT                   /protein_id="AAL93948.1"
FT   gene            339345..340274
FT                   /locus_tag="FN1850"
FT   CDS_pept        339345..340274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1850"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1850"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93949"
FT                   /db_xref="GOA:Q8RHZ0"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHZ0"
FT                   /protein_id="AAL93949.1"
FT   gene            340319..341623
FT                   /locus_tag="FN1851"
FT   CDS_pept        340319..341623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1851"
FT                   /product="Ribonuclease PH"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1851"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93950"
FT                   /db_xref="GOA:Q8RHY9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY9"
FT                   /protein_id="AAL93950.1"
FT   gene            341756..342136
FT                   /locus_tag="FN1852"
FT   CDS_pept        341756..342136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1852"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1852"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93951"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY8"
FT                   /protein_id="AAL93951.1"
FT   gene            342257..342667
FT                   /locus_tag="FN1853"
FT   CDS_pept        342257..342667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1853"
FT                   /product="Methylaspartate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1853"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93952"
FT                   /db_xref="GOA:Q8RHY7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR006394"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHY7"
FT                   /protein_id="AAL93952.1"
FT   gene            342685..344073
FT                   /locus_tag="FN1854"
FT   CDS_pept        342685..344073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1854"
FT                   /product="Methylaspartate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1854"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93953"
FT                   /db_xref="GOA:Q8RHY6"
FT                   /db_xref="InterPro:IPR006230"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY6"
FT                   /protein_id="AAL93953.1"
FT                   LVEI"
FT   gene            344089..345546
FT                   /locus_tag="FN1855"
FT   CDS_pept        344089..345546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1855"
FT                   /product="Methylaspartate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1855"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93954"
FT                   /db_xref="GOA:Q8RHY5"
FT                   /db_xref="InterPro:IPR006396"
FT                   /db_xref="InterPro:IPR014714"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHY5"
FT                   /protein_id="AAL93954.1"
FT   gene            complement(345583..346236)
FT                   /locus_tag="FN1856"
FT   CDS_pept        complement(345583..346236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1856"
FT                   /product="Butyrate-acetoacetate CoA-transferase subunit B"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1856"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93955"
FT                   /db_xref="GOA:Q8RHY4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY4"
FT                   /protein_id="AAL93955.1"
FT   gene            complement(346254..346907)
FT                   /locus_tag="FN1857"
FT   CDS_pept        complement(346254..346907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1857"
FT                   /product="Acetoacetate:butyrate/acetate coenzyme A
FT                   transferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1857"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93956"
FT                   /db_xref="GOA:Q8RHY3"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY3"
FT                   /protein_id="AAL93956.1"
FT   gene            complement(346986..348362)
FT                   /locus_tag="FN1858"
FT   CDS_pept        complement(346986..348362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1858"
FT                   /product="Short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1858"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93957"
FT                   /db_xref="GOA:Q8RHY2"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY2"
FT                   /protein_id="AAL93957.1"
FT                   "
FT   gene            complement(348639..349745)
FT                   /locus_tag="FN1859"
FT   CDS_pept        complement(348639..349745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1859"
FT                   /product="Major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1859"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93958"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY1"
FT                   /protein_id="AAL93958.1"
FT   gene            complement(349990..351567)
FT                   /locus_tag="FN1860"
FT   CDS_pept        complement(349990..351567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1860"
FT                   /product="NA+/H+ antiporter NHAC"
FT                   /db_xref="EnsemblGenomes-Gn:FN1860"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93959"
FT                   /db_xref="GOA:Q8RHY0"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHY0"
FT                   /protein_id="AAL93959.1"
FT                   AVRLKKQK"
FT   gene            complement(351775..352398)
FT                   /locus_tag="FN1861"
FT   CDS_pept        complement(351775..352398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1861"
FT                   /product="L-lysine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN1861"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93960"
FT                   /db_xref="GOA:Q8RHX9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHX9"
FT                   /protein_id="AAL93960.1"
FT   gene            complement(352421..353212)
FT                   /locus_tag="FN1862"
FT   CDS_pept        complement(352421..353212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1862"
FT                   /product="L-beta-lysine 5,6-aminomutase beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1862"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93961"
FT                   /db_xref="GOA:Q8RHX8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR028991"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR036843"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX8"
FT                   /protein_id="AAL93961.1"
FT   gene            complement(353212..354768)
FT                   /locus_tag="FN1863"
FT   CDS_pept        complement(353212..354768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1863"
FT                   /product="L-beta-lysine 5,6-aminomutase alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1863"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93962"
FT                   /db_xref="GOA:Q8RHX7"
FT                   /db_xref="InterPro:IPR015130"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR037086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX7"
FT                   /protein_id="AAL93962.1"
FT                   R"
FT   gene            complement(354768..356231)
FT                   /locus_tag="FN1864"
FT   CDS_pept        complement(354768..356231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1864"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /db_xref="EnsemblGenomes-Gn:FN1864"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93963"
FT                   /db_xref="GOA:Q8RHX6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHX6"
FT                   /protein_id="AAL93963.1"
FT   gene            complement(356233..357195)
FT                   /locus_tag="FN1865"
FT   CDS_pept        complement(356233..357195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1865"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1865"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93964"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHX5"
FT                   /protein_id="AAL93964.1"
FT   gene            complement(357253..358530)
FT                   /locus_tag="FN1866"
FT   CDS_pept        complement(357253..358530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1866"
FT                   /product="Lysine 2,3-aminomutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1866"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93965"
FT                   /db_xref="GOA:Q8RHX4"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX4"
FT                   /protein_id="AAL93965.1"
FT   gene            complement(358650..359687)
FT                   /locus_tag="FN1867"
FT   CDS_pept        complement(358650..359687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1867"
FT                   /product="Zn-dependent alcohol dehydrogenases and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:FN1867"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93966"
FT                   /db_xref="GOA:Q8RHX3"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX3"
FT                   /protein_id="AAL93966.1"
FT                   NEIYL"
FT   gene            complement(359705..360523)
FT                   /locus_tag="FN1868"
FT   CDS_pept        complement(359705..360523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1868"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1868"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93967"
FT                   /db_xref="GOA:Q8RHX2"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX2"
FT                   /protein_id="AAL93967.1"
FT   gene            complement(360543..360929)
FT                   /locus_tag="FN1869"
FT   CDS_pept        complement(360543..360929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1869"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1869"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93968"
FT                   /db_xref="GOA:Q8RHX1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHX1"
FT                   /protein_id="AAL93968.1"
FT   gene            complement(361544..362272)
FT                   /locus_tag="FN1870"
FT   CDS_pept        complement(361544..362272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1870"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1870"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93969"
FT                   /db_xref="GOA:Q8RHX0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHX0"
FT                   /protein_id="AAL93969.1"
FT   gene            complement(362387..362641)
FT                   /locus_tag="FN1871"
FT   CDS_pept        complement(362387..362641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1871"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1871"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93970"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW9"
FT                   /protein_id="AAL93970.1"
FT   gene            complement(362879..363133)
FT                   /locus_tag="FN1872"
FT   CDS_pept        complement(362879..363133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1872"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1872"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93971"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW8"
FT                   /protein_id="AAL93971.1"
FT   gene            complement(363192..363530)
FT                   /locus_tag="FN1873"
FT   CDS_pept        complement(363192..363530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1873"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase"
FT                   /EC_number=""
FT                   /note="asymmetrical"
FT                   /db_xref="EnsemblGenomes-Gn:FN1873"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93972"
FT                   /db_xref="GOA:Q8RHW7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW7"
FT                   /protein_id="AAL93972.1"
FT                   GEKLGTMV"
FT   gene            complement(363543..363992)
FT                   /locus_tag="FN1874"
FT   CDS_pept        complement(363543..363992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1874"
FT                   /product="Ribose 5-phosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1874"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93973"
FT                   /db_xref="GOA:Q8RHW6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW6"
FT                   /protein_id="AAL93973.1"
FT   gene            complement(363996..364490)
FT                   /locus_tag="FN1875"
FT   CDS_pept        complement(363996..364490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1875"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1875"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93974"
FT                   /db_xref="GOA:Q8RHW5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW5"
FT                   /protein_id="AAL93974.1"
FT                   E"
FT   gene            complement(364552..365154)
FT                   /locus_tag="FN1876"
FT   CDS_pept        complement(364552..365154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1876"
FT                   /product="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:FN1876"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93975"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW4"
FT                   /protein_id="AAL93975.1"
FT   gene            complement(365299..366627)
FT                   /locus_tag="FN1877"
FT   CDS_pept        complement(365299..366627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1877"
FT                   /product="Guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN1877"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93976"
FT                   /db_xref="GOA:Q8RHW3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW3"
FT                   /protein_id="AAL93976.1"
FT   gene            366847..367146
FT                   /locus_tag="FN1878"
FT   CDS_pept        366847..367146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1878"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1878"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93977"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW2"
FT                   /protein_id="AAL93977.1"
FT   gene            367295..367567
FT                   /locus_tag="FN1879"
FT   CDS_pept        367295..367567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1879"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1879"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93978"
FT                   /db_xref="GOA:Q8RHW1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHW1"
FT                   /protein_id="AAL93978.1"
FT   gene            367693..368271
FT                   /locus_tag="FN1880"
FT   CDS_pept        367693..368271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1880"
FT                   /product="Oxygen-insensitive NAD(P)H nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /EC_number=""
FT                   /note="Dihydropteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1880"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93979"
FT                   /db_xref="GOA:Q8R6E1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E1"
FT                   /protein_id="AAL93979.1"
FT   gene            complement(368340..368729)
FT                   /locus_tag="FN1881"
FT   CDS_pept        complement(368340..368729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1881"
FT                   /product="Esterase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1881"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93980"
FT                   /db_xref="GOA:Q8R6E0"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6E0"
FT                   /protein_id="AAL93980.1"
FT   gene            368700..368894
FT                   /locus_tag="FN1882"
FT   CDS_pept        368700..368894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1882"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1882"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93981"
FT                   /db_xref="GOA:Q8RHW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHW0"
FT                   /protein_id="AAL93981.1"
FT   gene            369003..370178
FT                   /locus_tag="FN1883"
FT   CDS_pept        369003..370178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1883"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1883"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93982"
FT                   /db_xref="GOA:Q8R6J4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J4"
FT                   /protein_id="AAL93982.1"
FT   gene            complement(370418..370597)
FT                   /locus_tag="FN1884"
FT   CDS_pept        complement(370418..370597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1884"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1884"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93983"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV9"
FT                   /protein_id="AAL93983.1"
FT                   CEFICCGKPLVKVK"
FT   gene            370824..371471
FT                   /locus_tag="FN1885"
FT   CDS_pept        370824..371471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1885"
FT                   /product="Hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:FN1885"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93984"
FT                   /db_xref="GOA:Q8RHV8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV8"
FT                   /protein_id="AAL93984.1"
FT   gene            371539..371814
FT                   /locus_tag="FN1886"
FT   CDS_pept        371539..371814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1886"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1886"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV7"
FT                   /protein_id="AAL93985.1"
FT   gene            371811..372320
FT                   /locus_tag="FN1887"
FT   CDS_pept        371811..372320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1887"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1887"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93986"
FT                   /db_xref="GOA:Q8RHV6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV6"
FT                   /protein_id="AAL93986.1"
FT                   LKEKKK"
FT   gene            372551..372892
FT                   /locus_tag="FN1888"
FT   CDS_pept        372551..372892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1888"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1888"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93987"
FT                   /db_xref="GOA:Q8RHV5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV5"
FT                   /protein_id="AAL93987.1"
FT                   NLIFHSDQG"
FT   gene            372950..373087
FT                   /locus_tag="FN1889"
FT   CDS_pept        372950..373087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1889"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1889"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93988"
FT                   /protein_id="AAL93988.1"
FT                   "
FT   gene            complement(373135..373311)
FT                   /locus_tag="FN1890"
FT   CDS_pept        complement(373135..373311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1890"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1890"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93989"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV3"
FT                   /protein_id="AAL93989.1"
FT                   KLEEVIKVARKYV"
FT   gene            complement(373599..374384)
FT                   /locus_tag="FN1891"
FT   CDS_pept        complement(373599..374384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1891"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1891"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93990"
FT                   /db_xref="GOA:Q8RHV2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV2"
FT                   /protein_id="AAL93990.1"
FT   gene            complement(374502..378587)
FT                   /locus_tag="FN1893"
FT   CDS_pept        complement(374502..378587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1893"
FT                   /product="Fusobacterium outer membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1893"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV1"
FT                   /protein_id="AAL93991.1"
FT                   YDTKGHNVRGGLGLRVIF"
FT   gene            377788..377970
FT                   /locus_tag="FN1892"
FT   CDS_pept        377788..377970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1892"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1892"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93992"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHV0"
FT                   /protein_id="AAL93992.1"
FT                   EFPFRLNPIELAPIV"
FT   gene            complement(381821..382432)
FT                   /locus_tag="FN1894"
FT   CDS_pept        complement(381821..382432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1894"
FT                   /product="BAX protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1894"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93993"
FT                   /db_xref="GOA:Q8RHU9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU9"
FT                   /protein_id="AAL93993.1"
FT   gene            complement(382632..382961)
FT                   /locus_tag="FN1895"
FT   CDS_pept        complement(382632..382961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1895"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1895"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93994"
FT                   /db_xref="GOA:Q8RHU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU8"
FT                   /protein_id="AAL93994.1"
FT                   EKDGN"
FT   gene            complement(382977..383999)
FT                   /locus_tag="FN1896"
FT   CDS_pept        complement(382977..383999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1896"
FT                   /product="ABC transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1896"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93995"
FT                   /db_xref="GOA:Q8RHU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU7"
FT                   /protein_id="AAL93995.1"
FT                   "
FT   gene            complement(384055..385074)
FT                   /locus_tag="FN1897"
FT   CDS_pept        complement(384055..385074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1897"
FT                   /product="ABC transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1897"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93996"
FT                   /db_xref="GOA:Q8RHU6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU6"
FT                   /protein_id="AAL93996.1"
FT   gene            complement(385076..386659)
FT                   /locus_tag="FN1898"
FT   CDS_pept        complement(385076..386659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1898"
FT                   /product="Sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1898"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93997"
FT                   /db_xref="GOA:Q8RHU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU5"
FT                   /protein_id="AAL93997.1"
FT                   KLMSGIKGGE"
FT   gene            complement(386804..388054)
FT                   /locus_tag="FN1899"
FT   CDS_pept        complement(386804..388054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1899"
FT                   /product="Hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1899"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93998"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU4"
FT                   /protein_id="AAL93998.1"
FT                   MGITSVEVPEKYGKIGN"
FT   gene            388384..389376
FT                   /locus_tag="FN1900"
FT   CDS_pept        388384..389376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1900"
FT                   /product="pfoS/R"
FT                   /db_xref="EnsemblGenomes-Gn:FN1900"
FT                   /db_xref="EnsemblGenomes-Tr:AAL93999"
FT                   /db_xref="GOA:Q8RHU3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU3"
FT                   /protein_id="AAL93999.1"
FT   gene            complement(389454..390107)
FT                   /locus_tag="FN1901"
FT   CDS_pept        complement(389454..390107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1901"
FT                   /product="Transcription regulator, CRP family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1901"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94000"
FT                   /db_xref="GOA:Q8R5Z7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5Z7"
FT                   /protein_id="AAL94000.1"
FT   gene            complement(390117..390641)
FT                   /locus_tag="FN1902"
FT   CDS_pept        complement(390117..390641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1902"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1902"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94001"
FT                   /db_xref="GOA:Q8RHU2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU2"
FT                   /protein_id="AAL94001.1"
FT                   EKLEINFANIE"
FT   gene            complement(390762..393194)
FT                   /locus_tag="FN1903"
FT   CDS_pept        complement(390762..393194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1903"
FT                   /product="Coenzyme A disulfide reductase/ disulfide bond
FT                   regulator domain"
FT                   /db_xref="EnsemblGenomes-Gn:FN1903"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94002"
FT                   /db_xref="GOA:Q8RHU1"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU1"
FT                   /protein_id="AAL94002.1"
FT   gene            393247..393693
FT                   /locus_tag="FN1904"
FT   CDS_pept        393247..393693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1904"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1904"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94003"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHU0"
FT                   /protein_id="AAL94003.1"
FT   gene            complement(393743..398206)
FT                   /locus_tag="FN1905"
FT   CDS_pept        complement(393743..398206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1905"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1905"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94004"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT9"
FT                   /protein_id="AAL94004.1"
FT   gene            398507..399943
FT                   /locus_tag="FN1906"
FT   CDS_pept        398507..399943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1906"
FT                   /product="Cytosol aminopeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1906"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94005"
FT                   /db_xref="GOA:Q8RHT8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHT8"
FT                   /protein_id="AAL94005.1"
FT   gene            400019..400606
FT                   /locus_tag="FN1907"
FT   CDS_pept        400019..400606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1907"
FT                   /product="Thymidylate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1907"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94006"
FT                   /db_xref="GOA:Q8RHT7"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT7"
FT                   /protein_id="AAL94006.1"
FT   gene            complement(400686..401759)
FT                   /locus_tag="FN1908"
FT   CDS_pept        complement(400686..401759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1908"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1908"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94007"
FT                   /db_xref="GOA:Q8RHT6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT6"
FT                   /protein_id="AAL94007.1"
FT                   DFPDLGVQFLENQKNKK"
FT   gene            complement(401802..402800)
FT                   /locus_tag="FN1909"
FT   CDS_pept        complement(401802..402800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1909"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1909"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94008"
FT                   /db_xref="GOA:Q8R6D9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6D9"
FT                   /protein_id="AAL94008.1"
FT   gene            complement(402825..403298)
FT                   /locus_tag="FN1910"
FT   CDS_pept        complement(402825..403298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1910"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1910"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94009"
FT                   /db_xref="GOA:Q8RHT5"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT5"
FT                   /protein_id="AAL94009.1"
FT   gene            complement(403339..405375)
FT                   /locus_tag="FN1911"
FT   CDS_pept        complement(403339..405375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1911"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1911"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94010"
FT                   /db_xref="GOA:Q8RHT4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT4"
FT                   /protein_id="AAL94010.1"
FT   gene            complement(405508..409035)
FT                   /locus_tag="FN1912"
FT   CDS_pept        complement(405508..409035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1912"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1912"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94011"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT3"
FT                   /protein_id="AAL94011.1"
FT                   RDFSEIFSF"
FT   gene            complement(410144..411670)
FT                   /locus_tag="FN1913"
FT   CDS_pept        complement(410144..411670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1913"
FT                   /product="hydrolase (HD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:FN1913"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94012"
FT                   /db_xref="GOA:Q8RHT2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHT2"
FT                   /protein_id="AAL94012.1"
FT   gene            complement(411733..412080)
FT                   /locus_tag="FN1914"
FT   CDS_pept        complement(411733..412080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1914"
FT                   /product="Anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:FN1914"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94013"
FT                   /db_xref="GOA:Q8RHT1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT1"
FT                   /protein_id="AAL94013.1"
FT                   KNEEEALKNFK"
FT   gene            complement(412081..412410)
FT                   /locus_tag="FN1915"
FT   CDS_pept        complement(412081..412410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1915"
FT                   /product="Anti-sigma B factor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1915"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHT0"
FT                   /protein_id="AAL94014.1"
FT                   IKEAV"
FT   gene            complement(412496..412786)
FT                   /locus_tag="FN1916"
FT   CDS_pept        complement(412496..412786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1916"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1916"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94015"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS9"
FT                   /protein_id="AAL94015.1"
FT   gene            complement(412935..413846)
FT                   /locus_tag="FN1917"
FT   CDS_pept        complement(412935..413846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1917"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1917"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94016"
FT                   /db_xref="GOA:Q8R5Z6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z6"
FT                   /protein_id="AAL94016.1"
FT   gene            complement(413830..415116)
FT                   /locus_tag="FN1918"
FT   CDS_pept        complement(413830..415116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1918"
FT                   /product="SPO0B-associated GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1918"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94017"
FT                   /db_xref="GOA:Q8RHS8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHS8"
FT                   /protein_id="AAL94017.1"
FT   gene            complement(415223..415972)
FT                   /locus_tag="FN1919"
FT   CDS_pept        complement(415223..415972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1919"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1919"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94018"
FT                   /db_xref="GOA:Q8R6D8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D8"
FT                   /protein_id="AAL94018.1"
FT   gene            complement(415969..417000)
FT                   /locus_tag="FN1920"
FT   CDS_pept        complement(415969..417000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1920"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1920"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94019"
FT                   /db_xref="GOA:Q8R5Z5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z5"
FT                   /protein_id="AAL94019.1"
FT                   EIK"
FT   gene            complement(417000..417704)
FT                   /locus_tag="FN1921"
FT   CDS_pept        complement(417000..417704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1921"
FT                   /product="Biotin operon repressor"
FT                   /EC_number=""
FT                   /note="Biotin-[acetyl-COA-carboxylase] synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1921"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94020"
FT                   /db_xref="GOA:Q8RHS7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS7"
FT                   /protein_id="AAL94020.1"
FT                   SVGEIKIEKGYY"
FT   gene            complement(417723..419525)
FT                   /locus_tag="FN1922"
FT   CDS_pept        complement(417723..419525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1922"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1922"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94021"
FT                   /db_xref="InterPro:IPR018573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS6"
FT                   /protein_id="AAL94021.1"
FT   gene            complement(419697..421187)
FT                   /locus_tag="FN1923"
FT   CDS_pept        complement(419697..421187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1923"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1923"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94022"
FT                   /db_xref="GOA:Q8RHS5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS5"
FT                   /protein_id="AAL94022.1"
FT   gene            complement(421806..423083)
FT                   /locus_tag="FN1924"
FT   CDS_pept        complement(421806..423083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1924"
FT                   /product="Arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1924"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94023"
FT                   /db_xref="GOA:Q8RHS4"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS4"
FT                   /protein_id="AAL94023.1"
FT   gene            complement(423151..424425)
FT                   /locus_tag="FN1925"
FT   CDS_pept        complement(423151..424425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1925"
FT                   /product="Arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1925"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94024"
FT                   /db_xref="GOA:Q8RHS3"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS3"
FT                   /protein_id="AAL94024.1"
FT   gene            complement(424442..425377)
FT                   /locus_tag="FN1926"
FT   CDS_pept        complement(424442..425377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1926"
FT                   /product="Nitrogen regulatory IIA protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1926"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94025"
FT                   /db_xref="GOA:Q8RHS2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS2"
FT                   /protein_id="AAL94025.1"
FT   gene            complement(425505..428042)
FT                   /locus_tag="FN1927"
FT   CDS_pept        complement(425505..428042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1927"
FT                   /product="DEGV protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1927"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94026"
FT                   /db_xref="GOA:Q8RHS1"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS1"
FT                   /protein_id="AAL94026.1"
FT   gene            complement(428054..428608)
FT                   /locus_tag="FN1928"
FT   CDS_pept        complement(428054..428608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1928"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1928"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94027"
FT                   /db_xref="GOA:Q8RHS0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHS0"
FT                   /protein_id="AAL94027.1"
FT   gene            complement(428615..429823)
FT                   /locus_tag="FN1929"
FT   CDS_pept        complement(428615..429823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1929"
FT                   /product="Competence-damage protein cinA"
FT                   /db_xref="EnsemblGenomes-Gn:FN1929"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94028"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHR9"
FT                   /protein_id="AAL94028.1"
FT                   KVR"
FT   gene            complement(429834..430349)
FT                   /locus_tag="FN1930"
FT   CDS_pept        complement(429834..430349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1930"
FT                   /product="Phosphatidylglycerophosphatase A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1930"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94029"
FT                   /db_xref="GOA:Q8RHR8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR8"
FT                   /protein_id="AAL94029.1"
FT                   FIWTKFFY"
FT   gene            complement(430349..432511)
FT                   /locus_tag="FN1931"
FT   CDS_pept        complement(430349..432511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1931"
FT                   /product="Protease"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1931"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94030"
FT                   /db_xref="GOA:Q8R6D7"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D7"
FT                   /protein_id="AAL94030.1"
FT   gene            complement(432508..433089)
FT                   /locus_tag="FN1932"
FT   CDS_pept        complement(432508..433089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1932"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1932"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94031"
FT                   /db_xref="GOA:Q8RHR7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHR7"
FT                   /protein_id="AAL94031.1"
FT   gene            complement(433090..434133)
FT                   /locus_tag="FN1933"
FT   CDS_pept        complement(433090..434133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1933"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1933"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR6"
FT                   /protein_id="AAL94032.1"
FT                   FLKIYIS"
FT   gene            complement(434356..435519)
FT                   /locus_tag="FN1934"
FT   CDS_pept        complement(434356..435519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1934"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1934"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94033"
FT                   /db_xref="GOA:Q8RHR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR5"
FT                   /protein_id="AAL94033.1"
FT   gene            complement(436150..437151)
FT                   /locus_tag="FN1935"
FT   CDS_pept        complement(436150..437151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1935"
FT                   /product="Adenine-specific methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1935"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94034"
FT                   /db_xref="GOA:Q8RHR4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR4"
FT                   /protein_id="AAL94034.1"
FT   gene            complement(437232..437822)
FT                   /locus_tag="FN1936"
FT   CDS_pept        complement(437232..437822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1936"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1936"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94035"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR3"
FT                   /protein_id="AAL94035.1"
FT   gene            complement(437795..438022)
FT                   /locus_tag="FN1937"
FT   CDS_pept        complement(437795..438022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1937"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1937"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94036"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR2"
FT                   /protein_id="AAL94036.1"
FT   gene            complement(438039..438506)
FT                   /locus_tag="FN1938"
FT   CDS_pept        complement(438039..438506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1938"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1938"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94037"
FT                   /db_xref="GOA:Q8RHR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR1"
FT                   /protein_id="AAL94037.1"
FT   gene            complement(438584..439555)
FT                   /locus_tag="FN1939"
FT   CDS_pept        complement(438584..439555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1939"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1939"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHR0"
FT                   /protein_id="AAL94038.1"
FT   gene            complement(439675..441045)
FT                   /locus_tag="FN1940"
FT   CDS_pept        complement(439675..441045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1940"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FN1940"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94039"
FT                   /db_xref="GOA:Q8RHQ9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ9"
FT                   /protein_id="AAL94039.1"
FT   gene            441419..444013
FT                   /locus_tag="FN1941"
FT   CDS_pept        441419..444013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1941"
FT                   /product="ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1941"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94040"
FT                   /db_xref="GOA:Q8RHQ8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHQ8"
FT                   /protein_id="AAL94040.1"
FT   gene            complement(444090..444779)
FT                   /locus_tag="FN1942"
FT   CDS_pept        complement(444090..444779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1942"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1942"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94041"
FT                   /db_xref="GOA:Q8RHQ7"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ7"
FT                   /protein_id="AAL94041.1"
FT                   VGKIEKG"
FT   gene            444991..446628
FT                   /locus_tag="FN1943"
FT   CDS_pept        444991..446628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1943"
FT                   /product="Tryptophanase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1943"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94042"
FT                   /db_xref="GOA:Q8RHQ6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ6"
FT                   /protein_id="AAL94042.1"
FT   gene            446707..448086
FT                   /locus_tag="FN1944"
FT   CDS_pept        446707..448086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1944"
FT                   /product="Sodium-dependent tryptophan transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1944"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94043"
FT                   /db_xref="GOA:Q8RHQ5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ5"
FT                   /protein_id="AAL94043.1"
FT                   G"
FT   rRNA            complement(448158..451028)
FT                   /product="LSU Ribosomal RNA"
FT   rRNA            complement(448247..448362)
FT                   /product="5S Ribosomal RNA"
FT   rRNA            complement(451529..453030)
FT                   /product="SSU Ribosomal RNA"
FT   gene            complement(453255..453614)
FT                   /locus_tag="FN1948"
FT   CDS_pept        complement(453255..453614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1948"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1948"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94044"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011411"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ4"
FT                   /protein_id="AAL94044.1"
FT                   DKEEENIKRTWSINK"
FT   gene            complement(453624..455012)
FT                   /locus_tag="FN1949"
FT   CDS_pept        complement(453624..455012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1949"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1949"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94045"
FT                   /db_xref="GOA:Q8RHQ3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ3"
FT                   /protein_id="AAL94045.1"
FT                   EYRK"
FT   gene            complement(455153..457945)
FT                   /locus_tag="FN1950"
FT   CDS_pept        complement(455153..457945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1950"
FT                   /product="Serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1950"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94046"
FT                   /db_xref="GOA:Q8R6D6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D6"
FT                   /protein_id="AAL94046.1"
FT                   "
FT   gene            complement(458490..459017)
FT                   /locus_tag="FN1951"
FT   CDS_pept        complement(458490..459017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1951"
FT                   /product="ATPase associated with chromosome
FT                   architecture/replication"
FT                   /db_xref="EnsemblGenomes-Gn:FN1951"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94047"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHQ2"
FT                   /protein_id="AAL94047.1"
FT                   VYKEKYKKLLEI"
FT   gene            complement(459033..459140)
FT                   /locus_tag="FN1952"
FT   CDS_pept        complement(459033..459140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1952"
FT                   /product="Na(+)-linked D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN1952"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ1"
FT                   /protein_id="AAL94048.1"
FT   gene            complement(459287..459589)
FT                   /locus_tag="FN1953"
FT   CDS_pept        complement(459287..459589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1953"
FT                   /product="Na(+)-linked D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN1953"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94049"
FT                   /db_xref="GOA:Q8RHQ0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHQ0"
FT                   /protein_id="AAL94049.1"
FT   gene            complement(459867..460082)
FT                   /locus_tag="FN1954"
FT   CDS_pept        complement(459867..460082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1954"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1954"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94050"
FT                   /db_xref="GOA:Q8RHP9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP9"
FT                   /protein_id="AAL94050.1"
FT   gene            460076..460270
FT                   /locus_tag="FN1955"
FT   CDS_pept        460076..460270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1955"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1955"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94051"
FT                   /db_xref="GOA:Q8RHP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP8"
FT                   /protein_id="AAL94051.1"
FT   gene            complement(460247..460621)
FT                   /locus_tag="FN1956"
FT   CDS_pept        complement(460247..460621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1956"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1956"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP7"
FT                   /protein_id="AAL94052.1"
FT   gene            complement(460669..460917)
FT                   /locus_tag="FN1957"
FT   CDS_pept        complement(460669..460917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1957"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1957"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP6"
FT                   /protein_id="AAL94053.1"
FT   tRNA            complement(461093..461167)
FT                   /product="tRNA-Gln"
FT   tRNA            complement(461208..461291)
FT                   /product="tRNA-Leu"
FT   tRNA            complement(461304..461379)
FT                   /product="tRNA-Lys"
FT   tRNA            complement(461383..461458)
FT                   /product="tRNA-His"
FT   tRNA            complement(461469..461544)
FT                   /product="tRNA-Gly"
FT   tRNA            complement(461552..461628)
FT                   /product="tRNA-Pro"
FT   gene            complement(461736..463865)
FT                   /locus_tag="FN1964"
FT   CDS_pept        complement(461736..463865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1964"
FT                   /product="O-linked GLCNAC transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1964"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94054"
FT                   /db_xref="GOA:Q8R5Z4"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5Z4"
FT                   /protein_id="AAL94054.1"
FT                   IDEIEKGILSLARLS"
FT   gene            complement(464150..465187)
FT                   /locus_tag="FN1965"
FT   CDS_pept        complement(464150..465187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1965"
FT                   /product="Tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1965"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94055"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP5"
FT                   /protein_id="AAL94055.1"
FT                   LIAKI"
FT   gene            complement(465255..465467)
FT                   /locus_tag="FN1966"
FT   CDS_pept        complement(465255..465467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1966"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1966"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP4"
FT                   /protein_id="AAL94056.1"
FT   gene            complement(465543..466493)
FT                   /locus_tag="FN1967"
FT   CDS_pept        complement(465543..466493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1967"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1967"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94057"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP3"
FT                   /protein_id="AAL94057.1"
FT   gene            complement(466506..467279)
FT                   /locus_tag="FN1968"
FT   CDS_pept        complement(466506..467279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1968"
FT                   /product="Hemin transport system ATP-binding protein hmuV"
FT                   /db_xref="EnsemblGenomes-Gn:FN1968"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94058"
FT                   /db_xref="GOA:Q8RHP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP2"
FT                   /protein_id="AAL94058.1"
FT   gene            complement(467276..468301)
FT                   /locus_tag="FN1969"
FT   CDS_pept        complement(467276..468301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1969"
FT                   /product="Hemin transport system permease protein hmuU"
FT                   /db_xref="EnsemblGenomes-Gn:FN1969"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94059"
FT                   /db_xref="GOA:Q8RHP1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP1"
FT                   /protein_id="AAL94059.1"
FT                   L"
FT   gene            complement(468304..469146)
FT                   /locus_tag="FN1970"
FT   CDS_pept        complement(468304..469146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1970"
FT                   /product="Hemin-binding periplasmic protein hmuT precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1970"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94060"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHP0"
FT                   /protein_id="AAL94060.1"
FT   gene            complement(469223..471196)
FT                   /locus_tag="FN1971"
FT   CDS_pept        complement(469223..471196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1971"
FT                   /product="Hemin receptor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1971"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94061"
FT                   /db_xref="GOA:Q8RHN9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN9"
FT                   /protein_id="AAL94061.1"
FT   gene            complement(471793..472161)
FT                   /locus_tag="FN1972"
FT   CDS_pept        complement(471793..472161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1972"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1972"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94062"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN8"
FT                   /protein_id="AAL94062.1"
FT                   TALEDSDIFIYLVGENKK"
FT   gene            complement(472320..472706)
FT                   /locus_tag="FN1973"
FT   CDS_pept        complement(472320..472706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1973"
FT                   /product="Translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:FN1973"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94063"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN7"
FT                   /protein_id="AAL94063.1"
FT   gene            complement(472788..475616)
FT                   /locus_tag="FN1974"
FT   CDS_pept        complement(472788..475616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1974"
FT                   /product="DNA/RNA helicase (DEAD/DEAH BOX family)"
FT                   /db_xref="EnsemblGenomes-Gn:FN1974"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94064"
FT                   /db_xref="GOA:Q8R5Z3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5Z3"
FT                   /protein_id="AAL94064.1"
FT                   DVKKELLDYFNM"
FT   gene            475739..477325
FT                   /locus_tag="FN1975"
FT   CDS_pept        475739..477325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1975"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1975"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94065"
FT                   /db_xref="GOA:Q8RHN6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN6"
FT                   /protein_id="AAL94065.1"
FT                   KPLIEKAKSKK"
FT   gene            477335..478267
FT                   /locus_tag="FN1976"
FT   CDS_pept        477335..478267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1976"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1976"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94066"
FT                   /db_xref="GOA:Q8R6D5"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D5"
FT                   /protein_id="AAL94066.1"
FT   gene            478276..479622
FT                   /locus_tag="FN1977"
FT   CDS_pept        478276..479622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1977"
FT                   /product="Cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:FN1977"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94067"
FT                   /db_xref="GOA:Q8RHN5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHN5"
FT                   /protein_id="AAL94067.1"
FT   gene            479619..481763
FT                   /locus_tag="FN1978"
FT   CDS_pept        479619..481763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1978"
FT                   /product="Cell division protein ftsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN1978"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94068"
FT                   /db_xref="GOA:Q8R6D4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D4"
FT                   /protein_id="AAL94068.1"
FT   gene            481876..482133
FT                   /locus_tag="FN1979"
FT   CDS_pept        481876..482133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1979"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:FN1979"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94069"
FT                   /db_xref="GOA:Q8RHN4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHN4"
FT                   /protein_id="AAL94069.1"
FT   gene            482203..483312
FT                   /locus_tag="FN1980"
FT   CDS_pept        482203..483312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1980"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1980"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94070"
FT                   /db_xref="GOA:Q8RHN3"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN3"
FT                   /protein_id="AAL94070.1"
FT   gene            483439..483807
FT                   /locus_tag="FN1981"
FT   CDS_pept        483439..483807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1981"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1981"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94071"
FT                   /db_xref="GOA:Q8RHN2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN2"
FT                   /protein_id="AAL94071.1"
FT                   LKKLFLSYTKRIKDYSLM"
FT   gene            484453..484632
FT                   /locus_tag="FN1982"
FT   CDS_pept        484453..484632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1982"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN1982"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN1"
FT                   /protein_id="AAL94072.1"
FT                   IRFSKIRKYLIEKL"
FT   gene            484759..485325
FT                   /locus_tag="FN1983"
FT   CDS_pept        484759..485325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1983"
FT                   /product="Alkyl hydroperoxide reductase C22 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1983"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94073"
FT                   /db_xref="GOA:Q8R6D3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D3"
FT                   /protein_id="AAL94073.1"
FT   gene            485627..487264
FT                   /locus_tag="FN1984"
FT   CDS_pept        485627..487264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1984"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number=""
FT                   /note="Glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1984"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94074"
FT                   /db_xref="GOA:Q8RHN0"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017561"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHN0"
FT                   /protein_id="AAL94074.1"
FT   gene            complement(487363..488727)
FT                   /locus_tag="FN1985"
FT   CDS_pept        complement(487363..488727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1985"
FT                   /product="Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1985"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94075"
FT                   /db_xref="GOA:Q8RHM9"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM9"
FT                   /protein_id="AAL94075.1"
FT   gene            489057..490067
FT                   /locus_tag="FN1986"
FT   CDS_pept        489057..490067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1986"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1986"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94076"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM8"
FT                   /protein_id="AAL94076.1"
FT   gene            complement(490108..490758)
FT                   /locus_tag="FN1987"
FT   CDS_pept        complement(490108..490758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1987"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN1987"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94077"
FT                   /db_xref="GOA:Q8RHM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM7"
FT                   /protein_id="AAL94077.1"
FT   gene            491058..492440
FT                   /locus_tag="FN1988"
FT   CDS_pept        491058..492440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1988"
FT                   /product="Tyrosine phenol-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1988"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94078"
FT                   /db_xref="GOA:Q8RHM6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013441"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHM6"
FT                   /protein_id="AAL94078.1"
FT                   KK"
FT   gene            492571..493887
FT                   /locus_tag="FN1989"
FT   CDS_pept        492571..493887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1989"
FT                   /product="Sodium-dependent tyrosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1989"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94079"
FT                   /db_xref="GOA:Q8RHM5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM5"
FT                   /protein_id="AAL94079.1"
FT   gene            494225..494752
FT                   /locus_tag="FN1990"
FT   CDS_pept        494225..494752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1990"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1990"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94080"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM4"
FT                   /protein_id="AAL94080.1"
FT                   KEINDAYENLTK"
FT   gene            494763..496103
FT                   /locus_tag="FN1991"
FT   CDS_pept        494763..496103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1991"
FT                   /product="Glucosamine-1-phosphate acetyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FN1991"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94081"
FT                   /db_xref="GOA:Q8RHM3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHM3"
FT                   /protein_id="AAL94081.1"
FT   gene            496105..497055
FT                   /locus_tag="FN1992"
FT   CDS_pept        496105..497055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1992"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN1992"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94082"
FT                   /db_xref="GOA:Q8RHM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHM2"
FT                   /protein_id="AAL94082.1"
FT   gene            497057..497710
FT                   /locus_tag="FN1993"
FT   CDS_pept        497057..497710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1993"
FT                   /product="SUA5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1993"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94083"
FT                   /db_xref="GOA:Q8RHM1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM1"
FT                   /protein_id="AAL94083.1"
FT   gene            497717..498151
FT                   /locus_tag="FN1994"
FT   CDS_pept        497717..498151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1994"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1994"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHM0"
FT                   /protein_id="AAL94084.1"
FT   gene            498385..499098
FT                   /locus_tag="FN1995"
FT   CDS_pept        498385..499098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1995"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1995"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94085"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL9"
FT                   /protein_id="AAL94085.1"
FT                   IEILIDNKDLGVFEQ"
FT   gene            499095..499802
FT                   /locus_tag="FN1996"
FT   CDS_pept        499095..499802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1996"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN1996"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94086"
FT                   /db_xref="GOA:Q8RHL8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL8"
FT                   /protein_id="AAL94086.1"
FT                   DKMFRDKKIPEDI"
FT   gene            499898..500218
FT                   /locus_tag="FN1997"
FT   CDS_pept        499898..500218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1997"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FN1997"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94087"
FT                   /db_xref="GOA:Q8RHL7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL7"
FT                   /protein_id="AAL94087.1"
FT                   QD"
FT   gene            500269..500451
FT                   /locus_tag="FN1998"
FT   CDS_pept        500269..500451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1998"
FT                   /product="HIPA protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1998"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94088"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL6"
FT                   /protein_id="AAL94088.1"
FT                   VFSDSLPDSLGKITC"
FT   gene            500402..500929
FT                   /locus_tag="FN1999"
FT   CDS_pept        500402..500929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN1999"
FT                   /product="HIPA protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN1999"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94089"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL5"
FT                   /protein_id="AAL94089.1"
FT                   KNHQQMQLEKFI"
FT   gene            500926..501363
FT                   /locus_tag="FN2000"
FT   CDS_pept        500926..501363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2000"
FT                   /product="HIPA protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2000"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94090"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL4"
FT                   /protein_id="AAL94090.1"
FT   gene            complement(501388..501948)
FT                   /locus_tag="FN2001"
FT   CDS_pept        complement(501388..501948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94091"
FT                   /db_xref="GOA:Q8RHL3"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL3"
FT                   /protein_id="AAL94091.1"
FT   gene            complement(501941..503653)
FT                   /locus_tag="FN2002"
FT   CDS_pept        complement(501941..503653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2002"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN2002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94092"
FT                   /db_xref="GOA:Q8RHL2"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="InterPro:IPR025513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL2"
FT                   /protein_id="AAL94092.1"
FT   gene            503885..504433
FT                   /locus_tag="FN2003"
FT   CDS_pept        503885..504433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2003"
FT                   /product="bioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94093"
FT                   /db_xref="GOA:Q8RHL1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHL1"
FT                   /protein_id="AAL94093.1"
FT   gene            504443..505237
FT                   /locus_tag="FN2004"
FT   CDS_pept        504443..505237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2004"
FT                   /product="Cobalt transport ATP-binding protein cbiO"
FT                   /db_xref="EnsemblGenomes-Gn:FN2004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94094"
FT                   /db_xref="GOA:Q8RHL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHL0"
FT                   /protein_id="AAL94094.1"
FT   gene            505221..506036
FT                   /locus_tag="FN2005"
FT   CDS_pept        505221..506036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2005"
FT                   /product="Cobalt transport ATP-binding protein cbiO"
FT                   /db_xref="EnsemblGenomes-Gn:FN2005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94095"
FT                   /db_xref="GOA:Q8RHK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHK9"
FT                   /protein_id="AAL94095.1"
FT   gene            506219..507019
FT                   /locus_tag="FN2006"
FT   CDS_pept        506219..507019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2006"
FT                   /product="Cobalt transport protein cbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:FN2006"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94096"
FT                   /db_xref="GOA:Q8RHK8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK8"
FT                   /protein_id="AAL94096.1"
FT   gene            complement(506967..507566)
FT                   /locus_tag="FN2007"
FT   CDS_pept        complement(506967..507566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2007"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94097"
FT                   /db_xref="GOA:Q8RHK7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK7"
FT                   /protein_id="AAL94097.1"
FT   gene            complement(507687..508409)
FT                   /locus_tag="FN2008"
FT   CDS_pept        complement(507687..508409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2008"
FT                   /product="Glycine betaine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94098"
FT                   /db_xref="GOA:Q8RHK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK6"
FT                   /protein_id="AAL94098.1"
FT                   CSNPKNEFVKQLLKMAEM"
FT   gene            complement(508409..509950)
FT                   /locus_tag="FN2009"
FT   CDS_pept        complement(508409..509950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2009"
FT                   /product="Glycine betaine transport system permease
FT                   protein"
FT                   /note="Glycine betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94099"
FT                   /db_xref="GOA:Q8RHK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK5"
FT                   /protein_id="AAL94099.1"
FT   gene            complement(509910..510392)
FT                   /locus_tag="FN2010"
FT   CDS_pept        complement(509910..510392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2010"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN2010"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94100"
FT                   /db_xref="GOA:Q8RHK4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK4"
FT                   /protein_id="AAL94100.1"
FT   gene            complement(510523..513186)
FT                   /locus_tag="FN2011"
FT   CDS_pept        complement(510523..513186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2011"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94101"
FT                   /db_xref="GOA:Q8RHK3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHK3"
FT                   /protein_id="AAL94101.1"
FT                   QDKIKKLKESLKSFEE"
FT   gene            complement(513216..513989)
FT                   /locus_tag="FN2012"
FT   CDS_pept        complement(513216..513989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2012"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHK2"
FT                   /protein_id="AAL94102.1"
FT   gene            complement(514158..514742)
FT                   /locus_tag="FN2013"
FT   CDS_pept        complement(514158..514742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2013"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94103"
FT                   /db_xref="GOA:Q8RHK1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHK1"
FT                   /protein_id="AAL94103.1"
FT   gene            complement(514758..517064)
FT                   /locus_tag="FN2014"
FT   CDS_pept        complement(514758..517064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2014"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94104"
FT                   /db_xref="GOA:Q8RHK0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHK0"
FT                   /protein_id="AAL94104.1"
FT                   FAKTYDDVSKLVFVK"
FT   gene            complement(517074..518345)
FT                   /locus_tag="FN2015"
FT   CDS_pept        complement(517074..518345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2015"
FT                   /product="ATP-dependent clp protease ATP-binding subunit
FT                   clpX"
FT                   /db_xref="EnsemblGenomes-Gn:FN2015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94105"
FT                   /db_xref="GOA:Q8RHJ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHJ9"
FT                   /protein_id="AAL94105.1"
FT   gene            complement(518357..518938)
FT                   /locus_tag="FN2016"
FT   CDS_pept        complement(518357..518938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2016"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94106"
FT                   /db_xref="GOA:Q8RHJ8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHJ8"
FT                   /protein_id="AAL94106.1"
FT   gene            complement(519042..520331)
FT                   /locus_tag="FN2017"
FT   CDS_pept        complement(519042..520331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2017"
FT                   /product="Trigger factor, ppiase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94107"
FT                   /db_xref="GOA:Q8R5Z2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z2"
FT                   /protein_id="AAL94107.1"
FT   gene            complement(520347..522017)
FT                   /locus_tag="FN2018"
FT   CDS_pept        complement(520347..522017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2018"
FT                   /product="Single-stranded-DNA-specific exonuclease recJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN2018"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94108"
FT                   /db_xref="GOA:Q8R6D2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D2"
FT                   /protein_id="AAL94108.1"
FT   gene            complement(522020..522382)
FT                   /locus_tag="FN2019"
FT   CDS_pept        complement(522020..522382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2019"
FT                   /product="Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:FN2019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94109"
FT                   /db_xref="GOA:Q8RHJ7"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHJ7"
FT                   /protein_id="AAL94109.1"
FT                   MENAIKITKLLNDLKV"
FT   gene            complement(522399..524612)
FT                   /locus_tag="FN2020"
FT   CDS_pept        complement(522399..524612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2020"
FT                   /product="Bacterial Protein Translation Initiation Factor 2
FT                   (IF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:FN2020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94110"
FT                   /db_xref="GOA:Q8R5Z1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5Z1"
FT                   /protein_id="AAL94110.1"
FT   gene            complement(524639..525169)
FT                   /locus_tag="FN2021"
FT   CDS_pept        complement(524639..525169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2021"
FT                   /product="ABC1 family protein"
FT                   /note="LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:FN2021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94111"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHJ6"
FT                   /protein_id="AAL94111.1"
FT                   IKDKKMARGLIEE"
FT   gene            complement(525162..526235)
FT                   /locus_tag="FN2022"
FT   CDS_pept        complement(525162..526235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2022"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:FN2022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94112"
FT                   /db_xref="GOA:Q8RHJ5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHJ5"
FT                   /protein_id="AAL94112.1"
FT                   VDIKVIDSEALKEEENE"
FT   gene            complement(526262..526732)
FT                   /locus_tag="FN2023"
FT   CDS_pept        complement(526262..526732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2023"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94113"
FT                   /db_xref="GOA:Q8RHJ4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHJ4"
FT                   /protein_id="AAL94113.1"
FT   rRNA            complement(526875..529745)
FT                   /product="LSU Ribosomal RNA"
FT   rRNA            complement(526964..527079)
FT                   /product="5S Ribosomal RNA"
FT   tRNA            complement(530150..530226)
FT                   /product="tRNA-Ala"
FT   tRNA            complement(530230..530306)
FT                   /product="tRNA-Ile"
FT   rRNA            complement(530422..531923)
FT                   /product="SSU Ribosomal RNA"
FT   gene            complement(532139..533953)
FT                   /locus_tag="FN2029"
FT   CDS_pept        complement(532139..533953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2029"
FT                   /product="O-antigen acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:FN2029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94114"
FT                   /db_xref="GOA:Q8RHJ3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHJ3"
FT                   /protein_id="AAL94114.1"
FT   gene            complement(534119..536134)
FT                   /locus_tag="FN2030"
FT   CDS_pept        complement(534119..536134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2030"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94115"
FT                   /db_xref="GOA:Q8RHJ2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHJ2"
FT                   /protein_id="AAL94115.1"
FT   gene            complement(536211..537173)
FT                   /locus_tag="FN2031"
FT   CDS_pept        complement(536211..537173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2031"
FT                   /product="Thiamine biosynthesis lipoprotein apbE"
FT                   /db_xref="EnsemblGenomes-Gn:FN2031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94116"
FT                   /db_xref="GOA:Q8RHJ1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHJ1"
FT                   /protein_id="AAL94116.1"
FT   gene            complement(537211..537405)
FT                   /locus_tag="FN2032"
FT   CDS_pept        complement(537211..537405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2032"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94117"
FT                   /db_xref="GOA:Q8RHJ0"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHJ0"
FT                   /protein_id="AAL94117.1"
FT   gene            complement(537437..537994)
FT                   /locus_tag="FN2033"
FT   CDS_pept        complement(537437..537994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2033"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94118"
FT                   /db_xref="GOA:Q8RHI9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI9"
FT                   /protein_id="AAL94118.1"
FT   gene            complement(538007..538885)
FT                   /locus_tag="FN2034"
FT   CDS_pept        complement(538007..538885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2034"
FT                   /product="Protein yicC"
FT                   /db_xref="EnsemblGenomes-Gn:FN2034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94119"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHI8"
FT                   /protein_id="AAL94119.1"
FT                   EKMREQIMNIE"
FT   gene            complement(538912..542871)
FT                   /locus_tag="FN2035"
FT   CDS_pept        complement(538912..542871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2035"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94120"
FT                   /db_xref="GOA:Q8RHI7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI7"
FT                   /protein_id="AAL94120.1"
FT   gene            complement(542907..546461)
FT                   /locus_tag="FN2036"
FT   CDS_pept        complement(542907..546461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2036"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94121"
FT                   /db_xref="GOA:Q8RHI6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI6"
FT                   /protein_id="AAL94121.1"
FT                   IEMTGLHEIDEDAEDFEE"
FT   gene            complement(546859..547227)
FT                   /locus_tag="FN2037"
FT   CDS_pept        complement(546859..547227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2037"
FT                   /product="LSU ribosomal protein L12P (L7/L12)"
FT                   /db_xref="EnsemblGenomes-Gn:FN2037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94122"
FT                   /db_xref="GOA:Q8RHI5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI5"
FT                   /protein_id="AAL94122.1"
FT                   ANAIKEKLTAAGAEVEVK"
FT   gene            complement(547274..547786)
FT                   /locus_tag="FN2038"
FT   CDS_pept        complement(547274..547786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2038"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:FN2038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94123"
FT                   /db_xref="GOA:Q8RHI4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI4"
FT                   /protein_id="AAL94123.1"
FT                   KKEGSAE"
FT   gene            complement(547940..548647)
FT                   /locus_tag="FN2039"
FT   CDS_pept        complement(547940..548647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2039"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:FN2039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94124"
FT                   /db_xref="GOA:Q8RHI3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI3"
FT                   /protein_id="AAL94124.1"
FT                   VKMDPAIVGKIVG"
FT   gene            complement(548708..549133)
FT                   /locus_tag="FN2040"
FT   CDS_pept        complement(548708..549133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2040"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:FN2040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94125"
FT                   /db_xref="GOA:Q8RHI2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHI2"
FT                   /protein_id="AAL94125.1"
FT   gene            complement(549168..549749)
FT                   /locus_tag="FN2041"
FT   CDS_pept        complement(549168..549749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2041"
FT                   /product="Transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:FN2041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94126"
FT                   /db_xref="GOA:Q8RHI1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHI1"
FT                   /protein_id="AAL94126.1"
FT   gene            complement(549746..549922)
FT                   /locus_tag="FN2042"
FT   CDS_pept        complement(549746..549922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2042"
FT                   /product="Protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:FN2042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94127"
FT                   /db_xref="GOA:Q8RHI0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHI0"
FT                   /protein_id="AAL94127.1"
FT                   LAVRALNFLEALI"
FT   tRNA            complement(549945..550020)
FT                   /product="tRNA-Trp"
FT   gene            complement(550047..550199)
FT                   /locus_tag="FN2044"
FT   CDS_pept        complement(550047..550199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2044"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:FN2044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94128"
FT                   /db_xref="GOA:Q8RHH9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHH9"
FT                   /protein_id="AAL94128.1"
FT                   KETKK"
FT   gene            complement(550464..550892)
FT                   /locus_tag="FN2045"
FT   CDS_pept        complement(550464..550892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2045"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94129"
FT                   /db_xref="GOA:Q8RHH8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH8"
FT                   /protein_id="AAL94129.1"
FT   gene            complement(551001..551450)
FT                   /locus_tag="FN2046"
FT   CDS_pept        complement(551001..551450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2046"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN2046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94130"
FT                   /db_xref="GOA:Q8R6D1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D1"
FT                   /protein_id="AAL94130.1"
FT   gene            complement(551581..556473)
FT                   /locus_tag="FN2047"
FT   CDS_pept        complement(551581..556473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2047"
FT                   /product="Fusobacterium outer membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:FN2047"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94131"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH7"
FT                   /protein_id="AAL94131.1"
FT   gene            complement(558891..559346)
FT                   /locus_tag="FN2048"
FT   CDS_pept        complement(558891..559346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2048"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94132"
FT                   /db_xref="GOA:Q8R6J1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J1"
FT                   /protein_id="AAL94132.1"
FT   gene            complement(559415..559663)
FT                   /locus_tag="FN2049"
FT   CDS_pept        complement(559415..559663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2049"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94133"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H9"
FT                   /protein_id="AAL94133.1"
FT   gene            complement(559680..560060)
FT                   /locus_tag="FN2050"
FT   CDS_pept        complement(559680..560060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2050"
FT                   /product="Hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2050"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J6"
FT                   /protein_id="AAL94134.1"
FT   gene            complement(560121..560660)
FT                   /locus_tag="FN2051"
FT   CDS_pept        complement(560121..560660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2051"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94135"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J3"
FT                   /protein_id="AAL94135.1"
FT                   AAPAEIQPETPEEAAK"
FT   gene            complement(560674..561033)
FT                   /locus_tag="FN2052"
FT   CDS_pept        complement(560674..561033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2052"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2052"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94136"
FT                   /db_xref="InterPro:IPR018543"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6K0"
FT                   /protein_id="AAL94136.1"
FT                   EQQIVELTKLLEVLN"
FT   gene            complement(561318..562505)
FT                   /locus_tag="FN2053"
FT   CDS_pept        complement(561318..562505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2053"
FT                   /product="Serine/threonine sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN2053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94137"
FT                   /db_xref="GOA:Q8RHH6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH6"
FT                   /protein_id="AAL94137.1"
FT   gene            562676..564022
FT                   /locus_tag="FN2054"
FT   CDS_pept        562676..564022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2054"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2054"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94138"
FT                   /db_xref="GOA:Q8RHH5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHH5"
FT                   /protein_id="AAL94138.1"
FT   gene            complement(564092..564748)
FT                   /locus_tag="FN2055"
FT   CDS_pept        complement(564092..564748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2055"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94139"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH4"
FT                   /protein_id="AAL94139.1"
FT   gene            complement(564853..565407)
FT                   /locus_tag="FN2056"
FT   CDS_pept        complement(564853..565407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2056"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94140"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH3"
FT                   /protein_id="AAL94140.1"
FT   gene            complement(565376..565714)
FT                   /locus_tag="FN2057"
FT   CDS_pept        complement(565376..565714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2057"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94141"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH2"
FT                   /protein_id="AAL94141.1"
FT                   RKNSCYPF"
FT   gene            complement(565801..571185)
FT                   /locus_tag="FN2058"
FT   CDS_pept        complement(565801..571185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2058"
FT                   /product="Fusobacterium outer membrane protein family"
FT                   /db_xref="EnsemblGenomes-Gn:FN2058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94142"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH1"
FT                   /protein_id="AAL94142.1"
FT   gene            complement(572967..573422)
FT                   /locus_tag="FN2059"
FT   CDS_pept        complement(572967..573422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2059"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94143"
FT                   /db_xref="GOA:Q8R6J1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J1"
FT                   /protein_id="AAL94143.1"
FT   gene            complement(573491..573739)
FT                   /locus_tag="FN2060"
FT   CDS_pept        complement(573491..573739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2060"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94144"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6H9"
FT                   /protein_id="AAL94144.1"
FT   gene            complement(573756..574136)
FT                   /locus_tag="FN2061"
FT   CDS_pept        complement(573756..574136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2061"
FT                   /product="Hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94145"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J6"
FT                   /protein_id="AAL94145.1"
FT   gene            complement(574197..574736)
FT                   /locus_tag="FN2062"
FT   CDS_pept        complement(574197..574736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2062"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94146"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6J3"
FT                   /protein_id="AAL94146.1"
FT                   AAPAEIQPETPEEAAK"
FT   gene            complement(574750..575109)
FT                   /locus_tag="FN2063"
FT   CDS_pept        complement(574750..575109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2063"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94147"
FT                   /db_xref="InterPro:IPR018543"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6K0"
FT                   /protein_id="AAL94147.1"
FT                   EQQIVELTKLLEVLN"
FT   gene            complement(575303..575806)
FT                   /locus_tag="FN2064"
FT   CDS_pept        complement(575303..575806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2064"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94148"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHH0"
FT                   /protein_id="AAL94148.1"
FT                   SERY"
FT   gene            575990..576457
FT                   /locus_tag="FN2065"
FT   CDS_pept        575990..576457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2065"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:FN2065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94149"
FT                   /db_xref="GOA:Q8RHG9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG9"
FT                   /protein_id="AAL94149.1"
FT   gene            576417..576833
FT                   /locus_tag="FN2066"
FT   CDS_pept        576417..576833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2066"
FT                   /product="Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2066"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94150"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG8"
FT                   /protein_id="AAL94150.1"
FT   gene            complement(576974..577468)
FT                   /locus_tag="FN2067"
FT   CDS_pept        complement(576974..577468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2067"
FT                   /product="Thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:FN2067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94151"
FT                   /db_xref="GOA:Q8RHG7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG7"
FT                   /protein_id="AAL94151.1"
FT                   K"
FT   gene            complement(577535..579076)
FT                   /locus_tag="FN2068"
FT   CDS_pept        complement(577535..579076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2068"
FT                   /product="dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FN2068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94152"
FT                   /db_xref="GOA:Q8R5Z0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5Z0"
FT                   /protein_id="AAL94152.1"
FT   gene            complement(579112..580467)
FT                   /locus_tag="FN2069"
FT   CDS_pept        complement(579112..580467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2069"
FT                   /product="Amino acid carrier protein alsT"
FT                   /db_xref="EnsemblGenomes-Gn:FN2069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94153"
FT                   /db_xref="GOA:Q8RHG6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG6"
FT                   /protein_id="AAL94153.1"
FT   gene            complement(580594..582069)
FT                   /locus_tag="FN2070"
FT   CDS_pept        complement(580594..582069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2070"
FT                   /product="Cobyric acid synthase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN2070"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94154"
FT                   /db_xref="GOA:Q8R6D0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6D0"
FT                   /protein_id="AAL94154.1"
FT   gene            complement(582214..582465)
FT                   /locus_tag="FN2071"
FT   CDS_pept        complement(582214..582465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2071"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2071"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94155"
FT                   /db_xref="GOA:Q8RHG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG5"
FT                   /protein_id="AAL94155.1"
FT   gene            582646..583713
FT                   /locus_tag="FN2072"
FT   CDS_pept        582646..583713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2072"
FT                   /product="Guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN2072"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94156"
FT                   /db_xref="GOA:Q8RHG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG4"
FT                   /protein_id="AAL94156.1"
FT                   LLVALVVKYIFIFIG"
FT   gene            583725..584258
FT                   /locus_tag="FN2073"
FT   CDS_pept        583725..584258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2073"
FT                   /product="Adenine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94157"
FT                   /db_xref="GOA:Q8RHG3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG3"
FT                   /protein_id="AAL94157.1"
FT                   NRKDIIFLEALPIF"
FT   gene            complement(584336..586366)
FT                   /locus_tag="FN2074"
FT   CDS_pept        complement(584336..586366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2074"
FT                   /product="BslIM"
FT                   /db_xref="EnsemblGenomes-Gn:FN2074"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94158"
FT                   /db_xref="GOA:Q8RHG2"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG2"
FT                   /protein_id="AAL94158.1"
FT   gene            complement(586530..587459)
FT                   /locus_tag="FN2075"
FT   CDS_pept        complement(586530..587459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2075"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG1"
FT                   /protein_id="AAL94159.1"
FT   gene            complement(587626..587856)
FT                   /locus_tag="FN2076"
FT   CDS_pept        complement(587626..587856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2076"
FT                   /product="MunI regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2076"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94160"
FT                   /db_xref="GOA:Q8RHG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHG0"
FT                   /protein_id="AAL94160.1"
FT   gene            588040..589470
FT                   /locus_tag="FN2077"
FT   CDS_pept        588040..589470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2077"
FT                   /product="NA+/H+ antiporter NHAC"
FT                   /db_xref="EnsemblGenomes-Gn:FN2077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94161"
FT                   /db_xref="GOA:Q8RHF9"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF9"
FT                   /protein_id="AAL94161.1"
FT                   DKSKPIKDRLTDEDLKEL"
FT   gene            complement(589514..590356)
FT                   /locus_tag="FN2078"
FT   CDS_pept        complement(589514..590356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2078"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:FN2078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94162"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF8"
FT                   /protein_id="AAL94162.1"
FT   gene            complement(590432..591208)
FT                   /locus_tag="FN2079"
FT   CDS_pept        complement(590432..591208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2079"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94163"
FT                   /db_xref="GOA:Q8RHF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF7"
FT                   /protein_id="AAL94163.1"
FT   gene            complement(591211..592047)
FT                   /locus_tag="FN2080"
FT   CDS_pept        complement(591211..592047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2080"
FT                   /product="ABC transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94164"
FT                   /db_xref="GOA:Q8RHF6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF6"
FT                   /protein_id="AAL94164.1"
FT   gene            complement(592165..593064)
FT                   /locus_tag="FN2081"
FT   CDS_pept        complement(592165..593064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2081"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94165"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF5"
FT                   /protein_id="AAL94165.1"
FT                   KKYNISLDNPKLKNAVIK"
FT   gene            complement(593347..594981)
FT                   /locus_tag="FN2082"
FT   CDS_pept        complement(593347..594981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2082"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94166"
FT                   /db_xref="GOA:Q8RHF4"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHF4"
FT                   /protein_id="AAL94166.1"
FT   gene            complement(595142..595732)
FT                   /locus_tag="FN2083"
FT   CDS_pept        complement(595142..595732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2083"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2083"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94167"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF3"
FT                   /protein_id="AAL94167.1"
FT   gene            595848..596567
FT                   /locus_tag="FN2084"
FT   CDS_pept        595848..596567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2084"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN2084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94168"
FT                   /db_xref="GOA:Q8RHF2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF2"
FT                   /protein_id="AAL94168.1"
FT                   LYFFSKSLRTYKTKKLK"
FT   gene            complement(596650..597135)
FT                   /locus_tag="FN2085"
FT   CDS_pept        complement(596650..597135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2085"
FT                   /product="Hypothetical Exported Protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2085"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94169"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5Y9"
FT                   /protein_id="AAL94169.1"
FT   gene            complement(597597..598805)
FT                   /locus_tag="FN2086"
FT   CDS_pept        complement(597597..598805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2086"
FT                   /product="General secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:FN2086"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94170"
FT                   /db_xref="GOA:Q8RHF1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF1"
FT                   /protein_id="AAL94170.1"
FT                   IDE"
FT   gene            complement(599129..599809)
FT                   /locus_tag="FN2087"
FT   CDS_pept        complement(599129..599809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2087"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2087"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHF0"
FT                   /protein_id="AAL94171.1"
FT                   GENR"
FT   gene            complement(599938..601107)
FT                   /locus_tag="FN2088"
FT   CDS_pept        complement(599938..601107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2088"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2088"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94172"
FT                   /db_xref="GOA:Q8RHE9"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE9"
FT                   /protein_id="AAL94172.1"
FT   gene            complement(601100..601639)
FT                   /locus_tag="FN2089"
FT   CDS_pept        complement(601100..601639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2089"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2089"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94173"
FT                   /db_xref="GOA:Q8RHE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE8"
FT                   /protein_id="AAL94173.1"
FT                   TLHNGILTRMWIKENV"
FT   gene            complement(601626..602195)
FT                   /locus_tag="FN2090"
FT   CDS_pept        complement(601626..602195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2090"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2090"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94174"
FT                   /db_xref="GOA:Q8RHE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE7"
FT                   /protein_id="AAL94174.1"
FT   gene            complement(602185..602571)
FT                   /locus_tag="FN2091"
FT   CDS_pept        complement(602185..602571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2091"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94175"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE6"
FT                   /protein_id="AAL94175.1"
FT   gene            complement(602704..603201)
FT                   /locus_tag="FN2092"
FT   CDS_pept        complement(602704..603201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2092"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2092"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94176"
FT                   /db_xref="GOA:Q8RHE5"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE5"
FT                   /protein_id="AAL94176.1"
FT                   KF"
FT   gene            complement(603186..603641)
FT                   /locus_tag="FN2093"
FT   CDS_pept        complement(603186..603641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2093"
FT                   /product="General secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:FN2093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE4"
FT                   /protein_id="AAL94177.1"
FT   gene            complement(603889..604929)
FT                   /locus_tag="FN2094"
FT   CDS_pept        complement(603889..604929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2094"
FT                   /product="General secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:FN2094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94178"
FT                   /db_xref="GOA:Q8RHE3"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE3"
FT                   /protein_id="AAL94178.1"
FT                   GDVFSQ"
FT   gene            complement(604926..606170)
FT                   /locus_tag="FN2095"
FT   CDS_pept        complement(604926..606170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2095"
FT                   /product="General secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:FN2095"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94179"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE2"
FT                   /protein_id="AAL94179.1"
FT                   AKEGLTSLDEIMRQL"
FT   gene            complement(606357..606554)
FT                   /locus_tag="FN2096"
FT   CDS_pept        complement(606357..606554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2096"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94180"
FT                   /db_xref="GOA:Q8RHE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE1"
FT                   /protein_id="AAL94180.1"
FT   gene            complement(606539..606943)
FT                   /locus_tag="FN2097"
FT   CDS_pept        complement(606539..606943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2097"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2097"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHE0"
FT                   /protein_id="AAL94181.1"
FT   gene            complement(607463..608236)
FT                   /locus_tag="FN2098"
FT   CDS_pept        complement(607463..608236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2098"
FT                   /product="MRP-family nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94182"
FT                   /db_xref="GOA:Q8RHD9"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD9"
FT                   /protein_id="AAL94182.1"
FT   gene            608385..608762
FT                   /locus_tag="FN2099"
FT   CDS_pept        608385..608762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2099"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94183"
FT                   /db_xref="GOA:Q8RHD8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD8"
FT                   /protein_id="AAL94183.1"
FT   gene            609126..610376
FT                   /locus_tag="FN2100"
FT   CDS_pept        609126..610376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2100"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94184"
FT                   /db_xref="GOA:Q8RHD7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD7"
FT                   /protein_id="AAL94184.1"
FT                   SDRDIKKSYTLIVEKLN"
FT   gene            610386..611291
FT                   /locus_tag="FN2101"
FT   CDS_pept        610386..611291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2101"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN2101"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94185"
FT                   /db_xref="GOA:Q8RHD6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD6"
FT                   /protein_id="AAL94185.1"
FT   gene            611317..613212
FT                   /locus_tag="FN2102"
FT   CDS_pept        611317..613212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2102"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2102"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94186"
FT                   /db_xref="GOA:Q8RHD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD5"
FT                   /protein_id="AAL94186.1"
FT   gene            613343..614269
FT                   /locus_tag="FN2103"
FT   CDS_pept        613343..614269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2103"
FT                   /product="tricarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2103"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94187"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD4"
FT                   /protein_id="AAL94187.1"
FT   gene            614377..614820
FT                   /locus_tag="FN2104"
FT   CDS_pept        614377..614820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2104"
FT                   /product="tricarboxylate transport membrane protein TctB"
FT                   /db_xref="EnsemblGenomes-Gn:FN2104"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94188"
FT                   /db_xref="GOA:Q8RHD3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD3"
FT                   /protein_id="AAL94188.1"
FT   gene            614841..616325
FT                   /locus_tag="FN2105"
FT   CDS_pept        614841..616325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2105"
FT                   /product="tricarboxylate transport membrane protein RctA"
FT                   /db_xref="EnsemblGenomes-Gn:FN2105"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94189"
FT                   /db_xref="GOA:Q8RHD2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD2"
FT                   /protein_id="AAL94189.1"
FT   gene            616598..618154
FT                   /locus_tag="FN2106"
FT   CDS_pept        616598..618154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2106"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN2106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94190"
FT                   /db_xref="GOA:Q8RHD1"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHD1"
FT                   /protein_id="AAL94190.1"
FT                   L"
FT   gene            618290..619459
FT                   /locus_tag="FN2107"
FT   CDS_pept        618290..619459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2107"
FT                   /product="Galactokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2107"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94191"
FT                   /db_xref="GOA:Q8RHD0"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHD0"
FT                   /protein_id="AAL94191.1"
FT   gene            619459..620988
FT                   /locus_tag="FN2108"
FT   CDS_pept        619459..620988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2108"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94192"
FT                   /db_xref="GOA:Q8RHC9"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHC9"
FT                   /protein_id="AAL94192.1"
FT   gene            620988..621977
FT                   /locus_tag="FN2109"
FT   CDS_pept        620988..621977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2109"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2109"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94193"
FT                   /db_xref="GOA:Q8RHC8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC8"
FT                   /protein_id="AAL94193.1"
FT   gene            complement(621998..622420)
FT                   /locus_tag="FN2110"
FT   CDS_pept        complement(621998..622420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2110"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2110"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94194"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC7"
FT                   /protein_id="AAL94194.1"
FT   gene            complement(622524..623183)
FT                   /locus_tag="FN2111"
FT   CDS_pept        complement(622524..623183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2111"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94195"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC6"
FT                   /protein_id="AAL94195.1"
FT   gene            complement(623259..623753)
FT                   /locus_tag="FN2112"
FT   CDS_pept        complement(623259..623753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2112"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2112"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC5"
FT                   /protein_id="AAL94196.1"
FT                   K"
FT   gene            complement(623828..624022)
FT                   /locus_tag="FN2113"
FT   CDS_pept        complement(623828..624022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2113"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2113"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94197"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC4"
FT                   /protein_id="AAL94197.1"
FT   gene            complement(624100..624297)
FT                   /locus_tag="FN2114"
FT   CDS_pept        complement(624100..624297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2114"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2114"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC3"
FT                   /protein_id="AAL94198.1"
FT   gene            complement(624478..624933)
FT                   /locus_tag="FN2115"
FT   CDS_pept        complement(624478..624933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2115"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2115"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94199"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC2"
FT                   /protein_id="AAL94199.1"
FT   gene            complement(625088..625594)
FT                   /locus_tag="FN2116"
FT   CDS_pept        complement(625088..625594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2116"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94200"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC1"
FT                   /protein_id="AAL94200.1"
FT                   GVRVK"
FT   gene            complement(625615..626349)
FT                   /locus_tag="FN2117"
FT   CDS_pept        complement(625615..626349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2117"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94201"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHC0"
FT                   /protein_id="AAL94201.1"
FT   gene            complement(626377..627114)
FT                   /locus_tag="FN2118"
FT   CDS_pept        complement(626377..627114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2118"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2118"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94202"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB9"
FT                   /protein_id="AAL94202.1"
FT   gene            complement(627126..628142)
FT                   /locus_tag="FN2119"
FT   CDS_pept        complement(627126..628142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2119"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94203"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB8"
FT                   /protein_id="AAL94203.1"
FT   gene            complement(628451..629020)
FT                   /locus_tag="FN2120"
FT   CDS_pept        complement(628451..629020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2120"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2120"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94204"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB7"
FT                   /protein_id="AAL94204.1"
FT   gene            complement(629126..629818)
FT                   /locus_tag="FN2121"
FT   CDS_pept        complement(629126..629818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2121"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94205"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB6"
FT                   /protein_id="AAL94205.1"
FT                   NGQEIKAK"
FT   gene            complement(629888..632284)
FT                   /locus_tag="FN2122"
FT   CDS_pept        complement(629888..632284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2122"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94206"
FT                   /db_xref="GOA:Q8RHB5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHB5"
FT                   /protein_id="AAL94206.1"
FT   gene            complement(632298..633314)
FT                   /locus_tag="FN2123"
FT   CDS_pept        complement(632298..633314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2123"
FT                   /product="Phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2123"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94207"
FT                   /db_xref="GOA:Q8RHB4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHB4"
FT                   /protein_id="AAL94207.1"
FT   gene            complement(633341..633802)
FT                   /locus_tag="FN2124"
FT   CDS_pept        complement(633341..633802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2124"
FT                   /product="Hypothetical protein with Metallo-phosphoesterase
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:FN2124"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94208"
FT                   /db_xref="GOA:Q8RHB3"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB3"
FT                   /protein_id="AAL94208.1"
FT   gene            complement(633815..636250)
FT                   /locus_tag="FN2125"
FT   CDS_pept        complement(633815..636250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2125"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2125"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94209"
FT                   /db_xref="GOA:Q8RHB2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB2"
FT                   /protein_id="AAL94209.1"
FT   gene            complement(636396..638315)
FT                   /locus_tag="FN2126"
FT   CDS_pept        complement(636396..638315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2126"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN2126"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94210"
FT                   /db_xref="GOA:Q8RHB1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB1"
FT                   /protein_id="AAL94210.1"
FT                   NIDI"
FT   gene            complement(638316..638588)
FT                   /locus_tag="FN2127"
FT   CDS_pept        complement(638316..638588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2127"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN2127"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHB0"
FT                   /protein_id="AAL94211.1"
FT   gene            complement(638566..639675)
FT                   /locus_tag="FN2128"
FT   CDS_pept        complement(638566..639675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2128"
FT                   /product="RECF protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2128"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94212"
FT                   /db_xref="GOA:Q8RHA9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHA9"
FT                   /protein_id="AAL94212.1"
FT   gene            complement(639690..639905)
FT                   /locus_tag="FN2129"
FT   CDS_pept        complement(639690..639905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN2129"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN2129"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94213"
FT                   /db_xref="GOA:Q8RHA8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHA8"
FT                   /protein_id="AAL94213.1"
FT   gene            complement(639955..641868)
FT                   /locus_tag="FN0001"
FT   CDS_pept        complement(639955..641868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0001"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:FN0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94214"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHA7"
FT                   /protein_id="AAL94214.1"
FT                   DK"
FT   gene            642688..643023
FT                   /locus_tag="FN0002"
FT   CDS_pept        642688..643023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0002"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94215"
FT                   /db_xref="GOA:Q8RHA6"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHA6"
FT                   /protein_id="AAL94215.1"
FT                   FKNSKII"
FT   gene            643032..643280
FT                   /locus_tag="FN0003"
FT   CDS_pept        643032..643280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0003"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94216"
FT                   /db_xref="GOA:Q8RHA5"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHA5"
FT                   /protein_id="AAL94216.1"
FT   gene            643277..643894
FT                   /locus_tag="FN0004"
FT   CDS_pept        643277..643894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0004"
FT                   /product="Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94217"
FT                   /db_xref="GOA:Q8RHA4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHA4"
FT                   /protein_id="AAL94217.1"
FT   gene            644148..644639
FT                   /locus_tag="FN0005"
FT   CDS_pept        644148..644639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0005"
FT                   /product="Jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94218"
FT                   /db_xref="GOA:Q8RHA3"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHA3"
FT                   /protein_id="AAL94218.1"
FT                   "
FT   gene            644645..646012
FT                   /locus_tag="FN0006"
FT   CDS_pept        644645..646012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0006"
FT                   /product="Thiophene and furan oxidation protein THDF"
FT                   /db_xref="EnsemblGenomes-Gn:FN0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94219"
FT                   /db_xref="GOA:Q8RHA2"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHA2"
FT                   /protein_id="AAL94219.1"
FT   gene            646078..647964
FT                   /locus_tag="FN0007"
FT   CDS_pept        646078..647964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0007"
FT                   /product="Glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:FN0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94220"
FT                   /db_xref="GOA:Q8RHA1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RHA1"
FT                   /protein_id="AAL94220.1"
FT   gene            648150..649046
FT                   /locus_tag="FN0008"
FT   CDS_pept        648150..649046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0008"
FT                   /product="Quinolinate synthetase A"
FT                   /EC_number="4.1.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94221"
FT                   /db_xref="GOA:Q8R6C9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6C9"
FT                   /protein_id="AAL94221.1"
FT                   AKKALIPLEKMLELAGD"
FT   gene            649048..650355
FT                   /locus_tag="FN0009"
FT   CDS_pept        649048..650355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0009"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94222"
FT                   /db_xref="GOA:Q8RHA0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RHA0"
FT                   /protein_id="AAL94222.1"
FT   gene            650318..651178
FT                   /locus_tag="FN0010"
FT   CDS_pept        650318..651178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0010"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94223"
FT                   /db_xref="GOA:Q8RH99"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH99"
FT                   /protein_id="AAL94223.1"
FT                   RYVDD"
FT   gene            651171..651680
FT                   /locus_tag="FN0011"
FT   CDS_pept        651171..651680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0011"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FN0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94224"
FT                   /db_xref="GOA:Q8RH98"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH98"
FT                   /protein_id="AAL94224.1"
FT                   GILLEE"
FT   gene            complement(651707..652204)
FT                   /locus_tag="FN0012"
FT   CDS_pept        complement(651707..652204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0012"
FT                   /product="DNA topology modulation protein FLAR-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH97"
FT                   /protein_id="AAL94225.1"
FT                   EF"
FT   gene            652358..652699
FT                   /locus_tag="FN0013"
FT   CDS_pept        652358..652699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0013"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94226"
FT                   /db_xref="GOA:Q8RH96"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH96"
FT                   /protein_id="AAL94226.1"
FT                   FQQQLYFIV"
FT   gene            652705..652899
FT                   /locus_tag="FN0014"
FT   CDS_pept        652705..652899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0014"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94227"
FT                   /db_xref="GOA:Q8RH95"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH95"
FT                   /protein_id="AAL94227.1"
FT   gene            complement(653042..653590)
FT                   /locus_tag="FN0015"
FT   CDS_pept        complement(653042..653590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0015"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94228"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH94"
FT                   /protein_id="AAL94228.1"
FT   gene            653770..654426
FT                   /locus_tag="FN0016"
FT   CDS_pept        653770..654426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0016"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94229"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH93"
FT                   /protein_id="AAL94229.1"
FT   gene            654770..656017
FT                   /locus_tag="FN0017"
FT   CDS_pept        654770..656017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0017"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94230"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH92"
FT                   /protein_id="AAL94230.1"
FT                   QRPLTYTLSDKITDKL"
FT   gene            complement(656068..656538)
FT                   /locus_tag="FN0018"
FT   CDS_pept        complement(656068..656538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0018"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94231"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH91"
FT                   /protein_id="AAL94231.1"
FT   gene            656689..659634
FT                   /locus_tag="FN0019"
FT   CDS_pept        656689..659634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0019"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:FN0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94232"
FT                   /db_xref="GOA:Q8RH90"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH90"
FT                   /protein_id="AAL94232.1"
FT   gene            659750..660049
FT                   /locus_tag="FN0020"
FT   CDS_pept        659750..660049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0020"
FT                   /product="Heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:FN0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94233"
FT                   /db_xref="GOA:Q8RH89"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH89"
FT                   /protein_id="AAL94233.1"
FT   gene            660030..660914
FT                   /locus_tag="FN0021"
FT   CDS_pept        660030..660914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0021"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94234"
FT                   /db_xref="GOA:Q8R6C8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R6C8"
FT                   /protein_id="AAL94234.1"
FT                   VDNVKIIICKTIN"
FT   gene            660930..661211
FT                   /locus_tag="FN0022"
FT   CDS_pept        660930..661211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0022"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94235"
FT                   /db_xref="GOA:Q8RH88"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH88"
FT                   /protein_id="AAL94235.1"
FT   gene            661341..662840
FT                   /locus_tag="FN0023"
FT   CDS_pept        661341..662840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0023"
FT                   /product="Short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FN0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94236"
FT                   /db_xref="GOA:Q8RH87"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH87"
FT                   /protein_id="AAL94236.1"
FT   gene            663191..663877
FT                   /locus_tag="FN0024"
FT   CDS_pept        663191..663877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0024"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94237"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH86"
FT                   /protein_id="AAL94237.1"
FT                   NGKQVK"
FT   gene            663886..664386
FT                   /locus_tag="FN0025"
FT   CDS_pept        663886..664386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0025"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94238"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH85"
FT                   /protein_id="AAL94238.1"
FT                   QIK"
FT   gene            664425..664892
FT                   /locus_tag="FN0026"
FT   CDS_pept        664425..664892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0026"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94239"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH84"
FT                   /protein_id="AAL94239.1"
FT   gene            complement(664853..664981)
FT                   /locus_tag="FN0027"
FT   CDS_pept        complement(664853..664981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0027"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94240"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH83"
FT                   /protein_id="AAL94240.1"
FT   gene            665053..666528
FT                   /locus_tag="FN0028"
FT   CDS_pept        665053..666528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0028"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FN0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94241"
FT                   /db_xref="GOA:Q8RH82"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH82"
FT                   /protein_id="AAL94241.1"
FT   gene            complement(666686..667117)
FT                   /locus_tag="FN0029"
FT   CDS_pept        complement(666686..667117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0029"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FN0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94242"
FT                   /db_xref="GOA:Q8RH81"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH81"
FT                   /protein_id="AAL94242.1"
FT   gene            667260..667736
FT                   /locus_tag="FN0030"
FT   CDS_pept        667260..667736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0030"
FT                   /product="5-nitroimidazole antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94243"
FT                   /db_xref="GOA:Q8RH80"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH80"
FT                   /protein_id="AAL94243.1"
FT   gene            complement(667989..668804)
FT                   /locus_tag="FN0031"
FT   CDS_pept        complement(667989..668804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0031"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94244"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH79"
FT                   /protein_id="AAL94244.1"
FT   gene            complement(668879..669868)
FT                   /locus_tag="FN0032"
FT   CDS_pept        complement(668879..669868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0032"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94245"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH78"
FT                   /protein_id="AAL94245.1"
FT   gene            complement(670236..675059)
FT                   /locus_tag="FN0033"
FT   CDS_pept        complement(670236..675059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0033"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94246"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH77"
FT                   /protein_id="AAL94246.1"
FT   gene            complement(675529..676179)
FT                   /locus_tag="FN0034"
FT   CDS_pept        complement(675529..676179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0034"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH76"
FT                   /protein_id="AAL94247.1"
FT   gene            complement(676330..676992)
FT                   /locus_tag="FN0035"
FT   CDS_pept        complement(676330..676992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0035"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH75"
FT                   /protein_id="AAL94248.1"
FT   gene            complement(677067..677699)
FT                   /locus_tag="FN0036"
FT   CDS_pept        complement(677067..677699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0036"
FT                   /product="Hypothetical membrane-spanning Protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94249"
FT                   /db_xref="GOA:Q8RH74"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH74"
FT                   /protein_id="AAL94249.1"
FT   gene            complement(677699..678151)
FT                   /locus_tag="FN0037"
FT   CDS_pept        complement(677699..678151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0037"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94250"
FT                   /db_xref="GOA:Q8RH73"
FT                   /db_xref="InterPro:IPR021707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH73"
FT                   /protein_id="AAL94250.1"
FT   gene            complement(678287..678589)
FT                   /locus_tag="FN0038"
FT   CDS_pept        complement(678287..678589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0038"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94251"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH72"
FT                   /protein_id="AAL94251.1"
FT   gene            complement(678751..679302)
FT                   /locus_tag="FN0039"
FT   CDS_pept        complement(678751..679302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0039"
FT                   /product="DNA primase (bacterial type) and small
FT                   primase-like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:FN0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94252"
FT                   /db_xref="GOA:Q8RH71"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH71"
FT                   /protein_id="AAL94252.1"
FT   gene            complement(679314..680699)
FT                   /locus_tag="FN0040"
FT   CDS_pept        complement(679314..680699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0040"
FT                   /product="Asparaginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94253"
FT                   /db_xref="GOA:Q8RH70"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH70"
FT                   /protein_id="AAL94253.1"
FT                   AEF"
FT   gene            complement(680709..680897)
FT                   /locus_tag="FN0041"
FT   CDS_pept        complement(680709..680897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0041"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94254"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH69"
FT                   /protein_id="AAL94254.1"
FT                   KEHLDNIEIVDEKDFKN"
FT   gene            complement(680966..682219)
FT                   /locus_tag="FN0042"
FT   CDS_pept        complement(680966..682219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0042"
FT                   /product="Rod shape-determining protein rodA"
FT                   /db_xref="EnsemblGenomes-Gn:FN0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94255"
FT                   /db_xref="GOA:Q8RH68"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH68"
FT                   /protein_id="AAL94255.1"
FT                   ISIAMGLVIYVNNTQTLK"
FT   gene            682402..682878
FT                   /locus_tag="FN0043"
FT   CDS_pept        682402..682878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0043"
FT                   /product="Hypothetical exported 24-amino acid repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94256"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH67"
FT                   /protein_id="AAL94256.1"
FT   gene            682841..683101
FT                   /locus_tag="FN0044"
FT   CDS_pept        682841..683101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0044"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94257"
FT                   /db_xref="GOA:Q8RH66"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH66"
FT                   /protein_id="AAL94257.1"
FT   gene            683152..683901
FT                   /locus_tag="FN0045"
FT   CDS_pept        683152..683901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0045"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94258"
FT                   /db_xref="GOA:Q8RH65"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH65"
FT                   /protein_id="AAL94258.1"
FT   gene            683882..684325
FT                   /locus_tag="FN0046"
FT   CDS_pept        683882..684325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0046"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94259"
FT                   /db_xref="GOA:Q8RH64"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH64"
FT                   /protein_id="AAL94259.1"
FT   gene            684567..685328
FT                   /locus_tag="FN0047"
FT   CDS_pept        684567..685328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0047"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94260"
FT                   /db_xref="GOA:Q8RH63"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH63"
FT                   /protein_id="AAL94260.1"
FT   gene            complement(685375..686133)
FT                   /locus_tag="FN0048"
FT   CDS_pept        complement(685375..686133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0048"
FT                   /product="4-nitrophenylphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94261"
FT                   /db_xref="GOA:Q8RH62"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH62"
FT                   /protein_id="AAL94261.1"
FT   gene            686491..686979
FT                   /locus_tag="FN0049"
FT   CDS_pept        686491..686979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0049"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH61"
FT                   /protein_id="AAL94262.1"
FT   gene            687183..688859
FT                   /locus_tag="FN0050"
FT   CDS_pept        687183..688859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0050"
FT                   /product="Fumarate reductase flavoprotein subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94263"
FT                   /db_xref="GOA:Q8RH60"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH60"
FT                   /protein_id="AAL94263.1"
FT   gene            complement(688873..689019)
FT                   /locus_tag="FN0051"
FT   CDS_pept        complement(688873..689019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0051"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH59"
FT                   /protein_id="AAL94264.1"
FT                   LFI"
FT   gene            688989..689351
FT                   /locus_tag="FN0052"
FT   CDS_pept        688989..689351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0052"
FT                   /product="Arsenate reductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94265"
FT                   /db_xref="GOA:Q8R6C7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C7"
FT                   /protein_id="AAL94265.1"
FT                   ILNGFKEEEWKKLLKK"
FT   gene            689480..690754
FT                   /locus_tag="FN0053"
FT   CDS_pept        689480..690754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0053"
FT                   /product="Branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94266"
FT                   /db_xref="GOA:Q8RH58"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH58"
FT                   /protein_id="AAL94266.1"
FT   gene            690976..692196
FT                   /locus_tag="FN0054"
FT   CDS_pept        690976..692196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0054"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94267"
FT                   /db_xref="GOA:Q8RH57"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH57"
FT                   /protein_id="AAL94267.1"
FT                   FYNIVKK"
FT   gene            692298..692804
FT                   /locus_tag="FN0055"
FT   CDS_pept        692298..692804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0055"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94268"
FT                   /db_xref="GOA:Q8RH56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH56"
FT                   /protein_id="AAL94268.1"
FT                   YGLKI"
FT   gene            692832..693311
FT                   /locus_tag="FN0056"
FT   CDS_pept        692832..693311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0056"
FT                   /product="Acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94269"
FT                   /db_xref="GOA:Q8R6C6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C6"
FT                   /protein_id="AAL94269.1"
FT   gene            693355..693960
FT                   /locus_tag="FN0057"
FT   CDS_pept        693355..693960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0057"
FT                   /product="Endonuclease III"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94270"
FT                   /db_xref="GOA:Q8RH55"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH55"
FT                   /protein_id="AAL94270.1"
FT   gene            694047..695240
FT                   /locus_tag="FN0058"
FT   CDS_pept        694047..695240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0058"
FT                   /product="Cysteine desulfhydrase"
FT                   /EC_number="4.4.1.-"
FT                   /EC_number=""
FT                   /note="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:FN0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94271"
FT                   /db_xref="GOA:Q8R6C5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C5"
FT                   /protein_id="AAL94271.1"
FT   gene            695293..695679
FT                   /locus_tag="FN0059"
FT   CDS_pept        695293..695679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0059"
FT                   /product="NifU protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94272"
FT                   /db_xref="GOA:Q8RH54"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH54"
FT                   /protein_id="AAL94272.1"
FT   gene            695914..697020
FT                   /locus_tag="FN0060"
FT   CDS_pept        695914..697020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0060"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94273"
FT                   /db_xref="GOA:Q8RH53"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH53"
FT                   /protein_id="AAL94273.1"
FT   gene            697159..698649
FT                   /locus_tag="FN0061"
FT   CDS_pept        697159..698649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0061"
FT                   /product="Thermostable carboxypeptidase 1"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94274"
FT                   /db_xref="GOA:Q8RH52"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH52"
FT                   /protein_id="AAL94274.1"
FT   gene            698745..699035
FT                   /locus_tag="FN0062"
FT   CDS_pept        698745..699035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0062"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94275"
FT                   /db_xref="InterPro:IPR004238"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH51"
FT                   /protein_id="AAL94275.1"
FT   gene            699122..699454
FT                   /locus_tag="FN0063"
FT   CDS_pept        699122..699454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0063"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94276"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH50"
FT                   /protein_id="AAL94276.1"
FT                   KVEAKN"
FT   gene            699629..699982
FT                   /locus_tag="FN0064"
FT   CDS_pept        699629..699982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0064"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94277"
FT                   /db_xref="InterPro:IPR010767"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH49"
FT                   /protein_id="AAL94277.1"
FT                   VRKFGGSRFRNGV"
FT   gene            700073..702244
FT                   /locus_tag="FN0065"
FT   CDS_pept        700073..702244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0065"
FT                   /product="Transcription accessory protein (S1 RNA binding
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:FN0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94278"
FT                   /db_xref="GOA:Q8RH48"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH48"
FT                   /protein_id="AAL94278.1"
FT   gene            702467..704680
FT                   /locus_tag="FN0066"
FT   CDS_pept        702467..704680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0066"
FT                   /product="Two component system histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94279"
FT                   /db_xref="GOA:Q8R6C4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C4"
FT                   /protein_id="AAL94279.1"
FT   gene            704677..707478
FT                   /locus_tag="FN0067"
FT   CDS_pept        704677..707478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0067"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94280"
FT                   /db_xref="GOA:Q8RH47"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH47"
FT                   /protein_id="AAL94280.1"
FT                   VLK"
FT   gene            707448..707945
FT                   /locus_tag="FN0068"
FT   CDS_pept        707448..707945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0068"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94281"
FT                   /db_xref="GOA:Q8RH46"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH46"
FT                   /protein_id="AAL94281.1"
FT                   VK"
FT   gene            707949..708821
FT                   /locus_tag="FN0069"
FT   CDS_pept        707949..708821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0069"
FT                   /product="Glycyl-tRNA synthetase alpha chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94282"
FT                   /db_xref="GOA:Q8RH45"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH45"
FT                   /protein_id="AAL94282.1"
FT                   LGYPLLNKK"
FT   gene            709042..711102
FT                   /locus_tag="FN0070"
FT   CDS_pept        709042..711102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0070"
FT                   /product="Glycyl-tRNA synthetase beta chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94283"
FT                   /db_xref="GOA:Q8RH44"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH44"
FT                   /protein_id="AAL94283.1"
FT   gene            711102..711665
FT                   /locus_tag="FN0071"
FT   CDS_pept        711102..711665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0071"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94284"
FT                   /db_xref="GOA:Q8RH43"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH43"
FT                   /protein_id="AAL94284.1"
FT   gene            711855..712679
FT                   /locus_tag="FN0072"
FT   CDS_pept        711855..712679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0072"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FN0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94285"
FT                   /db_xref="GOA:Q8RH42"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH42"
FT                   /protein_id="AAL94285.1"
FT   gene            712660..713493
FT                   /locus_tag="FN0073"
FT   CDS_pept        712660..713493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0073"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94286"
FT                   /db_xref="GOA:Q8RH41"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH41"
FT                   /protein_id="AAL94286.1"
FT   gene            713468..713836
FT                   /locus_tag="FN0074"
FT   CDS_pept        713468..713836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0074"
FT                   /product="Ethanolamine utilization protein eutS"
FT                   /db_xref="EnsemblGenomes-Gn:FN0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94287"
FT                   /db_xref="GOA:Q8RH40"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH40"
FT                   /protein_id="AAL94287.1"
FT                   LEFLKETLKFYICEITRS"
FT   gene            713839..714276
FT                   /locus_tag="FN0075"
FT   CDS_pept        713839..714276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0075"
FT                   /product="Ethanolamine utilization protein eutP"
FT                   /db_xref="EnsemblGenomes-Gn:FN0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94288"
FT                   /db_xref="GOA:Q8RH39"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH39"
FT                   /protein_id="AAL94288.1"
FT   gene            714266..714844
FT                   /locus_tag="FN0076"
FT   CDS_pept        714266..714844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0076"
FT                   /product="Ethanolamine two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FN0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94289"
FT                   /db_xref="GOA:Q8RH38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH38"
FT                   /protein_id="AAL94289.1"
FT   gene            714844..716232
FT                   /locus_tag="FN0077"
FT   CDS_pept        714844..716232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0077"
FT                   /product="Ethanolamine two-component sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94290"
FT                   /db_xref="GOA:Q8R6C3"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C3"
FT                   /protein_id="AAL94290.1"
FT                   DFKN"
FT   gene            716345..717775
FT                   /locus_tag="FN0078"
FT   CDS_pept        716345..717775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0078"
FT                   /product="Ethanolamine utilization protein eutA"
FT                   /db_xref="EnsemblGenomes-Gn:FN0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94291"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH37"
FT                   /protein_id="AAL94291.1"
FT                   MGSVLPVVIKTLVLKNYR"
FT   gene            717802..719169
FT                   /locus_tag="FN0079"
FT   CDS_pept        717802..719169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0079"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94292"
FT                   /db_xref="GOA:Q8RH36"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH36"
FT                   /protein_id="AAL94292.1"
FT   gene            719181..720068
FT                   /locus_tag="FN0080"
FT   CDS_pept        719181..720068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0080"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94293"
FT                   /db_xref="GOA:Q8RH35"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RH35"
FT                   /protein_id="AAL94293.1"
FT                   KVLDAKASGQDLKL"
FT   gene            720175..720828
FT                   /locus_tag="FN0081"
FT   CDS_pept        720175..720828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0081"
FT                   /product="Ethanolamine utilization protein eutL"
FT                   /db_xref="EnsemblGenomes-Gn:FN0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94294"
FT                   /db_xref="GOA:Q8RH34"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH34"
FT                   /protein_id="AAL94294.1"
FT   gene            720839..721285
FT                   /locus_tag="FN0082"
FT   CDS_pept        720839..721285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0082"
FT                   /product="Ethanolamine utilization protein eutM"
FT                   /db_xref="EnsemblGenomes-Gn:FN0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94295"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH33"
FT                   /protein_id="AAL94295.1"
FT   gene            721320..721604
FT                   /locus_tag="FN0083"
FT   CDS_pept        721320..721604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0083"
FT                   /product="Ethanolamine utilization protein eutM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FN0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94296"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH32"
FT                   /protein_id="AAL94296.1"
FT   gene            721712..723154
FT                   /locus_tag="FN0084"
FT   CDS_pept        721712..723154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0084"
FT                   /product="Acetaldehyde dehydrogenase (acetylating)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94297"
FT                   /db_xref="GOA:Q8RH31"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH31"
FT                   /protein_id="AAL94297.1"
FT   gene            723410..724177
FT                   /locus_tag="FN0085"
FT   CDS_pept        723410..724177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0085"
FT                   /product="Ethanolamine utilization cobalamin
FT                   adenosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94298"
FT                   /db_xref="GOA:Q8RH30"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH30"
FT                   /protein_id="AAL94298.1"
FT   gene            724177..724764
FT                   /locus_tag="FN0086"
FT   CDS_pept        724177..724764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0086"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94299"
FT                   /db_xref="InterPro:IPR013372"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH29"
FT                   /protein_id="AAL94299.1"
FT   gene            724766..725014
FT                   /locus_tag="FN0087"
FT   CDS_pept        724766..725014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0087"
FT                   /product="Ethanolamine utilization protein eutN"
FT                   /db_xref="EnsemblGenomes-Gn:FN0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94300"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH28"
FT                   /protein_id="AAL94300.1"
FT   gene            725027..725362
FT                   /locus_tag="FN0088"
FT   CDS_pept        725027..725362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0088"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FN0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94301"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH27"
FT                   /protein_id="AAL94301.1"
FT                   IIKEVLK"
FT   gene            725362..726444
FT                   /locus_tag="FN0089"
FT   CDS_pept        725362..726444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0089"
FT                   /product="Ethanolamine permease"
FT                   /db_xref="EnsemblGenomes-Gn:FN0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94302"
FT                   /db_xref="GOA:Q8RH26"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH26"
FT                   /protein_id="AAL94302.1"
FT   gene            726455..726904
FT                   /locus_tag="FN0090"
FT   CDS_pept        726455..726904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0090"
FT                   /product="Ethanolamine utilization protein eutQ"
FT                   /db_xref="EnsemblGenomes-Gn:FN0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94303"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH25"
FT                   /protein_id="AAL94303.1"
FT   gene            726928..728028
FT                   /locus_tag="FN0091"
FT   CDS_pept        726928..728028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0091"
FT                   /product="Phosphoserine phosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94304"
FT                   /db_xref="GOA:Q8RH24"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH24"
FT                   /protein_id="AAL94304.1"
FT   gene            728048..729166
FT                   /locus_tag="FN0092"
FT   CDS_pept        728048..729166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0092"
FT                   /product="NADPH-dependent butanol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FN0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94305"
FT                   /db_xref="GOA:Q8R6C2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R6C2"
FT                   /protein_id="AAL94305.1"
FT   gene            729309..729620
FT                   /locus_tag="FN0093"
FT   CDS_pept        729309..729620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0093"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FN0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94306"
FT                   /db_xref="GOA:Q8RH23"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH23"
FT                   /protein_id="AAL94306.1"
FT   gene            complement(729606..729830)
FT                   /locus_tag="FN0094"
FT   CDS_pept        complement(729606..729830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0094"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:FN0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94307"
FT                   /db_xref="GOA:Q8RH22"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH22"
FT                   /protein_id="AAL94307.1"
FT   rRNA            729878..731379
FT                   /product="SSU Ribosomal RNA"
FT   rRNA            731537..734463
FT                   /product="LSU Ribosomal RNA"
FT   rRNA            734512..734627
FT                   /product="5S Ribosomal RNA"
FT   tRNA            734634..734709
FT                   /product="tRNA-Asn"
FT   gene            734822..735175
FT                   /locus_tag="FN0099"
FT   CDS_pept        734822..735175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0099"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:FN0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94308"
FT                   /db_xref="GOA:Q8RH21"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RH21"
FT                   /protein_id="AAL94308.1"
FT                   FQERFFKHKIIIE"
FT   gene            complement(735209..735856)
FT                   /locus_tag="FN0100"
FT   CDS_pept        complement(735209..735856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FN0100"
FT                   /product="Flavodoxins/hemoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:FN0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAL94309"
FT                   /db_xref="GOA:Q8RH20"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB