(data stored in ACNUC8465 zone)

EMBL: AE009952

ID   AE009952; SV 1; circular; genomic DNA; STD; PRO; 4600755 BP.
XX
AC   AE009952; AE013601-AE014015;
XX
PR   Project:PRJNA288;
XX
DT   03-MAY-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Yersinia pestis KIM10+, complete genome.
XX
KW   .
XX
OS   Yersinia pestis KIM10+
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4600755
RX   DOI; 10.1128/JB.184.16.4601-4611.2002.
RX   PUBMED; 12142430.
RA   Deng W., Burland V., Plunkett G.III., Boutin A., Mayhew G.F., Liss P.,
RA   Perna N.T., Rose D.J., Mau B., Zhou S., Schwartz D.C., Fetherston J.D.,
RA   Lindler L.E., Brubaker R.R., Plana G.V., Straley S.C., McDonough K.A.,
RA   Nilles M.L., Matson J.S., Blattner F.R., Perry R.D.;
RT   "Genome sequence of Yersinia pestis KIM";
RL   J. Bacteriol. 184(16):4601-4611(2002).
XX
RN   [2]
RP   1-4600755
RA   Deng W., Burland V., Plunkett G.III., Boutin A., Mayhew G.F., Liss P.,
RA   Perna N.T., Rose D.J., Mau B., Zhou S., Schwartz D.C., Fetherston J.D.,
RA   Lindler L.E., Brubaker R.R., Plana G.V., Straley S.C., McDonough K.A.,
RA   Nilles M.L., Matson J.S., Blattner F.R., Perry R.D.;
RT   ;
RL   Submitted (21-FEB-2002) to the INSDC.
RL   Genetics, University of Wisconsin, 445 Henry Mall, Madison, WI 53706, USA
XX
DR   MD5; 9a4bcf28aeabd3b1fbe1bd35f1007c5b.
DR   BioSample; SAMN02604093.
DR   EnsemblGenomes-Gn; EBG00001103492.
DR   EnsemblGenomes-Gn; EBG00001103493.
DR   EnsemblGenomes-Gn; EBG00001103494.
DR   EnsemblGenomes-Gn; EBG00001103495.
DR   EnsemblGenomes-Gn; EBG00001103496.
DR   EnsemblGenomes-Gn; EBG00001103497.
DR   EnsemblGenomes-Gn; EBG00001103498.
DR   EnsemblGenomes-Gn; EBG00001103499.
DR   EnsemblGenomes-Gn; EBG00001103500.
DR   EnsemblGenomes-Gn; EBG00001103501.
DR   EnsemblGenomes-Gn; EBG00001103502.
DR   EnsemblGenomes-Gn; EBG00001103503.
DR   EnsemblGenomes-Gn; EBG00001103504.
DR   EnsemblGenomes-Gn; EBG00001103505.
DR   EnsemblGenomes-Gn; EBG00001103506.
DR   EnsemblGenomes-Gn; EBG00001103507.
DR   EnsemblGenomes-Gn; EBG00001103508.
DR   EnsemblGenomes-Gn; EBG00001103509.
DR   EnsemblGenomes-Gn; EBG00001103510.
DR   EnsemblGenomes-Gn; EBG00001103511.
DR   EnsemblGenomes-Gn; EBG00001103512.
DR   EnsemblGenomes-Gn; EBG00001103513.
DR   EnsemblGenomes-Gn; EBG00001103514.
DR   EnsemblGenomes-Gn; EBG00001103515.
DR   EnsemblGenomes-Gn; EBG00001103516.
DR   EnsemblGenomes-Gn; EBG00001103517.
DR   EnsemblGenomes-Gn; EBG00001103518.
DR   EnsemblGenomes-Gn; EBG00001103519.
DR   EnsemblGenomes-Gn; EBG00001103520.
DR   EnsemblGenomes-Gn; EBG00001103521.
DR   EnsemblGenomes-Gn; EBG00001103522.
DR   EnsemblGenomes-Gn; EBG00001103523.
DR   EnsemblGenomes-Gn; EBG00001103524.
DR   EnsemblGenomes-Gn; EBG00001103525.
DR   EnsemblGenomes-Gn; EBG00001103526.
DR   EnsemblGenomes-Gn; EBG00001103527.
DR   EnsemblGenomes-Gn; EBG00001103528.
DR   EnsemblGenomes-Gn; EBG00001103529.
DR   EnsemblGenomes-Gn; EBG00001103530.
DR   EnsemblGenomes-Gn; EBG00001103531.
DR   EnsemblGenomes-Gn; EBG00001103532.
DR   EnsemblGenomes-Gn; EBG00001103533.
DR   EnsemblGenomes-Gn; EBG00001103534.
DR   EnsemblGenomes-Gn; EBG00001103535.
DR   EnsemblGenomes-Gn; EBG00001103536.
DR   EnsemblGenomes-Gn; EBG00001103537.
DR   EnsemblGenomes-Gn; EBG00001103538.
DR   EnsemblGenomes-Gn; EBG00001103539.
DR   EnsemblGenomes-Gn; EBG00001103540.
DR   EnsemblGenomes-Gn; EBG00001103541.
DR   EnsemblGenomes-Gn; EBG00001103542.
DR   EnsemblGenomes-Gn; EBG00001103543.
DR   EnsemblGenomes-Gn; EBG00001103544.
DR   EnsemblGenomes-Gn; EBG00001103545.
DR   EnsemblGenomes-Gn; EBG00001103546.
DR   EnsemblGenomes-Gn; EBG00001103547.
DR   EnsemblGenomes-Gn; EBG00001103548.
DR   EnsemblGenomes-Gn; EBG00001103549.
DR   EnsemblGenomes-Gn; EBG00001103550.
DR   EnsemblGenomes-Gn; EBG00001103551.
DR   EnsemblGenomes-Gn; EBG00001103552.
DR   EnsemblGenomes-Gn; EBG00001103553.
DR   EnsemblGenomes-Gn; EBG00001103554.
DR   EnsemblGenomes-Gn; EBG00001103555.
DR   EnsemblGenomes-Gn; EBG00001103556.
DR   EnsemblGenomes-Gn; EBG00001103557.
DR   EnsemblGenomes-Gn; EBG00001103558.
DR   EnsemblGenomes-Gn; EBG00001103559.
DR   EnsemblGenomes-Gn; EBG00001103560.
DR   EnsemblGenomes-Gn; EBG00001103561.
DR   EnsemblGenomes-Gn; EBG00001103562.
DR   EnsemblGenomes-Gn; EBG00001103563.
DR   EnsemblGenomes-Gn; EBG00001103564.
DR   EnsemblGenomes-Gn; EBG00001103565.
DR   EnsemblGenomes-Gn; EBG00001103566.
DR   EnsemblGenomes-Gn; EBG00001103567.
DR   EnsemblGenomes-Gn; EBG00001103568.
DR   EnsemblGenomes-Gn; EBG00001103569.
DR   EnsemblGenomes-Gn; EBG00001103570.
DR   EnsemblGenomes-Gn; EBG00001103571.
DR   EnsemblGenomes-Gn; EBG00001103572.
DR   EnsemblGenomes-Gn; EBG00001103573.
DR   EnsemblGenomes-Gn; EBG00001103574.
DR   EnsemblGenomes-Gn; EBG00001103575.
DR   EnsemblGenomes-Gn; EBG00001103576.
DR   EnsemblGenomes-Gn; EBG00001103577.
DR   EnsemblGenomes-Gn; EBG00001103578.
DR   EnsemblGenomes-Gn; EBG00001103579.
DR   EnsemblGenomes-Gn; EBG00001103580.
DR   EnsemblGenomes-Gn; EBG00001103581.
DR   EnsemblGenomes-Gn; EBG00001103582.
DR   EnsemblGenomes-Gn; EBG00001103583.
DR   EnsemblGenomes-Gn; EBG00001103584.
DR   EnsemblGenomes-Gn; EBG00001103585.
DR   EnsemblGenomes-Gn; EBG00001103586.
DR   EnsemblGenomes-Gn; EBG00001103587.
DR   EnsemblGenomes-Gn; EBG00001103588.
DR   EnsemblGenomes-Gn; EBG00001103589.
DR   EnsemblGenomes-Gn; EBG00001103590.
DR   EnsemblGenomes-Gn; EBG00001103591.
DR   EnsemblGenomes-Gn; EBG00001103592.
DR   EnsemblGenomes-Gn; EBG00001103593.
DR   EnsemblGenomes-Gn; EBG00001103594.
DR   EnsemblGenomes-Gn; EBG00001103595.
DR   EnsemblGenomes-Gn; EBG00001103596.
DR   EnsemblGenomes-Gn; EBG00001103597.
DR   EnsemblGenomes-Gn; EBG00001103598.
DR   EnsemblGenomes-Gn; EBG00001103599.
DR   EnsemblGenomes-Gn; EBG00001103600.
DR   EnsemblGenomes-Gn; EBG00001103601.
DR   EnsemblGenomes-Gn; EBG00001103602.
DR   EnsemblGenomes-Gn; EBG00001103603.
DR   EnsemblGenomes-Gn; EBG00001103604.
DR   EnsemblGenomes-Gn; EBG00001103605.
DR   EnsemblGenomes-Gn; EBG00001103606.
DR   EnsemblGenomes-Gn; EBG00001103607.
DR   EnsemblGenomes-Gn; EBG00001103608.
DR   EnsemblGenomes-Gn; EBG00001103609.
DR   EnsemblGenomes-Gn; EBG00001103610.
DR   EnsemblGenomes-Gn; EBG00001103611.
DR   EnsemblGenomes-Gn; EBG00001103612.
DR   EnsemblGenomes-Gn; EBG00001103613.
DR   EnsemblGenomes-Gn; EBG00001103614.
DR   EnsemblGenomes-Gn; EBG00001103615.
DR   EnsemblGenomes-Gn; EBG00001103616.
DR   EnsemblGenomes-Gn; EBG00001103617.
DR   EnsemblGenomes-Gn; EBG00001103618.
DR   EnsemblGenomes-Gn; EBG00001103619.
DR   EnsemblGenomes-Gn; EBG00001103620.
DR   EnsemblGenomes-Gn; EBG00001103621.
DR   EnsemblGenomes-Gn; EBG00001103622.
DR   EnsemblGenomes-Gn; EBG00001103623.
DR   EnsemblGenomes-Gn; EBG00001103624.
DR   EnsemblGenomes-Gn; EBG00001103625.
DR   EnsemblGenomes-Gn; EBG00001103626.
DR   EnsemblGenomes-Gn; EBG00001103627.
DR   EnsemblGenomes-Gn; EBG00001103628.
DR   EnsemblGenomes-Gn; EBG00001103629.
DR   EnsemblGenomes-Gn; EBG00001103630.
DR   EnsemblGenomes-Gn; EBG00001103631.
DR   EnsemblGenomes-Gn; EBG00001103632.
DR   EnsemblGenomes-Gn; EBG00001103633.
DR   EnsemblGenomes-Gn; EBG00001103634.
DR   EnsemblGenomes-Gn; EBG00001103635.
DR   EnsemblGenomes-Gn; EBG00001103636.
DR   EnsemblGenomes-Gn; EBG00001103637.
DR   EnsemblGenomes-Gn; EBG00001103638.
DR   EnsemblGenomes-Gn; EBG00001103639.
DR   EnsemblGenomes-Gn; EBG00001103640.
DR   EnsemblGenomes-Gn; EBG00001103641.
DR   EnsemblGenomes-Gn; EBG00001103642.
DR   EnsemblGenomes-Gn; EBG00001103643.
DR   EnsemblGenomes-Gn; EBG00001103644.
DR   EnsemblGenomes-Gn; EBG00001103645.
DR   EnsemblGenomes-Gn; EBG00001103646.
DR   EnsemblGenomes-Gn; EBG00001103647.
DR   EnsemblGenomes-Gn; EBG00001103648.
DR   EnsemblGenomes-Gn; EBG00001103649.
DR   EnsemblGenomes-Gn; EBG00001103650.
DR   EnsemblGenomes-Gn; EBG00001103651.
DR   EnsemblGenomes-Gn; EBG00001103652.
DR   EnsemblGenomes-Gn; EBG00001103653.
DR   EnsemblGenomes-Gn; EBG00001103654.
DR   EnsemblGenomes-Gn; EBG00001103655.
DR   EnsemblGenomes-Gn; EBG00001103656.
DR   EnsemblGenomes-Gn; EBG00001103657.
DR   EnsemblGenomes-Gn; EBG00001103658.
DR   EnsemblGenomes-Gn; EBG00001103659.
DR   EnsemblGenomes-Gn; EBG00001103660.
DR   EnsemblGenomes-Gn; EBG00001103661.
DR   EnsemblGenomes-Gn; EBG00001103662.
DR   EnsemblGenomes-Gn; EBG00001103663.
DR   EnsemblGenomes-Gn; EBG00001103664.
DR   EnsemblGenomes-Gn; EBG00001103665.
DR   EnsemblGenomes-Gn; EBG00001103666.
DR   EnsemblGenomes-Gn; EBG00001103667.
DR   EnsemblGenomes-Gn; EBG00001103668.
DR   EnsemblGenomes-Gn; EBG00001103669.
DR   EnsemblGenomes-Gn; EBG00001103670.
DR   EnsemblGenomes-Gn; EBG00001103671.
DR   EnsemblGenomes-Gn; EBG00001103672.
DR   EnsemblGenomes-Gn; EBG00001103673.
DR   EnsemblGenomes-Gn; EBG00001103674.
DR   EnsemblGenomes-Gn; EBG00001103675.
DR   EnsemblGenomes-Gn; EBG00001103676.
DR   EnsemblGenomes-Gn; EBG00001103677.
DR   EnsemblGenomes-Gn; EBG00001103678.
DR   EnsemblGenomes-Gn; EBG00001103679.
DR   EnsemblGenomes-Gn; EBG00001103680.
DR   EnsemblGenomes-Gn; EBG00001103681.
DR   EnsemblGenomes-Gn; EBG00001103682.
DR   EnsemblGenomes-Gn; EBG00001103683.
DR   EnsemblGenomes-Gn; EBG00001103684.
DR   EnsemblGenomes-Gn; EBG00001103685.
DR   EnsemblGenomes-Gn; EBG00001103686.
DR   EnsemblGenomes-Gn; EBG00001103687.
DR   EnsemblGenomes-Gn; EBG00001103688.
DR   EnsemblGenomes-Gn; EBG00001103689.
DR   EnsemblGenomes-Gn; EBG00001103690.
DR   EnsemblGenomes-Gn; EBG00001103691.
DR   EnsemblGenomes-Gn; EBG00001103692.
DR   EnsemblGenomes-Gn; EBG00001103693.
DR   EnsemblGenomes-Gn; EBG00001103694.
DR   EnsemblGenomes-Gn; EBG00001103695.
DR   EnsemblGenomes-Gn; EBG00001103696.
DR   EnsemblGenomes-Gn; EBG00001103697.
DR   EnsemblGenomes-Gn; EBG00001103698.
DR   EnsemblGenomes-Gn; EBG00001103699.
DR   EnsemblGenomes-Gn; EBG00001103700.
DR   EnsemblGenomes-Gn; EBG00001103701.
DR   EnsemblGenomes-Gn; EBG00001103702.
DR   EnsemblGenomes-Gn; EBG00001103703.
DR   EnsemblGenomes-Gn; EBG00001103704.
DR   EnsemblGenomes-Gn; EBG00001103705.
DR   EnsemblGenomes-Gn; EBG00001103706.
DR   EnsemblGenomes-Gn; EBG00001103707.
DR   EnsemblGenomes-Gn; EBG00001103708.
DR   EnsemblGenomes-Gn; EBG00001103709.
DR   EnsemblGenomes-Gn; EBG00001103710.
DR   EnsemblGenomes-Gn; yr001.
DR   EnsemblGenomes-Gn; yr002.
DR   EnsemblGenomes-Gn; yr003.
DR   EnsemblGenomes-Gn; yr004.
DR   EnsemblGenomes-Gn; yr005.
DR   EnsemblGenomes-Gn; yr006.
DR   EnsemblGenomes-Gn; yr007.
DR   EnsemblGenomes-Gn; yr008.
DR   EnsemblGenomes-Gn; yr009.
DR   EnsemblGenomes-Gn; yr010.
DR   EnsemblGenomes-Gn; yr011.
DR   EnsemblGenomes-Gn; yr012.
DR   EnsemblGenomes-Gn; yr013.
DR   EnsemblGenomes-Gn; yr014.
DR   EnsemblGenomes-Gn; yr015.
DR   EnsemblGenomes-Gn; yr016.
DR   EnsemblGenomes-Gn; yr017.
DR   EnsemblGenomes-Gn; yr018.
DR   EnsemblGenomes-Gn; yr019.
DR   EnsemblGenomes-Gn; yr020.
DR   EnsemblGenomes-Gn; yr021.
DR   EnsemblGenomes-Gn; yr022.
DR   EnsemblGenomes-Gn; yr023.
DR   EnsemblGenomes-Gn; yr024.
DR   EnsemblGenomes-Gn; yt001.
DR   EnsemblGenomes-Gn; yt002.
DR   EnsemblGenomes-Gn; yt003.
DR   EnsemblGenomes-Gn; yt004.
DR   EnsemblGenomes-Gn; yt005.
DR   EnsemblGenomes-Gn; yt006.
DR   EnsemblGenomes-Gn; yt007.
DR   EnsemblGenomes-Gn; yt008.
DR   EnsemblGenomes-Gn; yt009.
DR   EnsemblGenomes-Gn; yt010.
DR   EnsemblGenomes-Gn; yt011.
DR   EnsemblGenomes-Gn; yt012.
DR   EnsemblGenomes-Gn; yt013.
DR   EnsemblGenomes-Gn; yt014.
DR   EnsemblGenomes-Gn; yt015.
DR   EnsemblGenomes-Gn; yt016.
DR   EnsemblGenomes-Gn; yt017.
DR   EnsemblGenomes-Gn; yt018.
DR   EnsemblGenomes-Gn; yt019.
DR   EnsemblGenomes-Gn; yt020.
DR   EnsemblGenomes-Gn; yt021.
DR   EnsemblGenomes-Gn; yt022.
DR   EnsemblGenomes-Gn; yt023.
DR   EnsemblGenomes-Gn; yt024.
DR   EnsemblGenomes-Gn; yt025.
DR   EnsemblGenomes-Gn; yt026.
DR   EnsemblGenomes-Gn; yt027.
DR   EnsemblGenomes-Gn; yt028.
DR   EnsemblGenomes-Gn; yt029.
DR   EnsemblGenomes-Gn; yt030.
DR   EnsemblGenomes-Gn; yt031.
DR   EnsemblGenomes-Gn; yt032.
DR   EnsemblGenomes-Gn; yt033.
DR   EnsemblGenomes-Gn; yt034.
DR   EnsemblGenomes-Gn; yt035.
DR   EnsemblGenomes-Gn; yt036.
DR   EnsemblGenomes-Gn; yt037.
DR   EnsemblGenomes-Gn; yt038.
DR   EnsemblGenomes-Gn; yt039.
DR   EnsemblGenomes-Gn; yt040.
DR   EnsemblGenomes-Gn; yt041.
DR   EnsemblGenomes-Gn; yt042.
DR   EnsemblGenomes-Gn; yt043.
DR   EnsemblGenomes-Gn; yt044.
DR   EnsemblGenomes-Gn; yt045.
DR   EnsemblGenomes-Gn; yt046.
DR   EnsemblGenomes-Gn; yt047.
DR   EnsemblGenomes-Gn; yt048.
DR   EnsemblGenomes-Gn; yt049.
DR   EnsemblGenomes-Gn; yt050.
DR   EnsemblGenomes-Gn; yt051.
DR   EnsemblGenomes-Gn; yt052.
DR   EnsemblGenomes-Gn; yt053.
DR   EnsemblGenomes-Gn; yt054.
DR   EnsemblGenomes-Gn; yt055.
DR   EnsemblGenomes-Gn; yt056.
DR   EnsemblGenomes-Gn; yt057.
DR   EnsemblGenomes-Gn; yt058.
DR   EnsemblGenomes-Gn; yt059.
DR   EnsemblGenomes-Gn; yt060.
DR   EnsemblGenomes-Gn; yt061.
DR   EnsemblGenomes-Gn; yt062.
DR   EnsemblGenomes-Gn; yt063.
DR   EnsemblGenomes-Gn; yt064.
DR   EnsemblGenomes-Gn; yt065.
DR   EnsemblGenomes-Gn; yt066.
DR   EnsemblGenomes-Gn; yt067.
DR   EnsemblGenomes-Gn; yt068.
DR   EnsemblGenomes-Gn; yt069.
DR   EnsemblGenomes-Gn; yt070.
DR   EnsemblGenomes-Gn; yt071.
DR   EnsemblGenomes-Gn; yt072.
DR   EnsemblGenomes-Gn; yt073.
DR   EnsemblGenomes-Tr; EBT00001694616.
DR   EnsemblGenomes-Tr; EBT00001694617.
DR   EnsemblGenomes-Tr; EBT00001694618.
DR   EnsemblGenomes-Tr; EBT00001694619.
DR   EnsemblGenomes-Tr; EBT00001694620.
DR   EnsemblGenomes-Tr; EBT00001694621.
DR   EnsemblGenomes-Tr; EBT00001694622.
DR   EnsemblGenomes-Tr; EBT00001694623.
DR   EnsemblGenomes-Tr; EBT00001694624.
DR   EnsemblGenomes-Tr; EBT00001694625.
DR   EnsemblGenomes-Tr; EBT00001694626.
DR   EnsemblGenomes-Tr; EBT00001694627.
DR   EnsemblGenomes-Tr; EBT00001694628.
DR   EnsemblGenomes-Tr; EBT00001694629.
DR   EnsemblGenomes-Tr; EBT00001694630.
DR   EnsemblGenomes-Tr; EBT00001694631.
DR   EnsemblGenomes-Tr; EBT00001694632.
DR   EnsemblGenomes-Tr; EBT00001694633.
DR   EnsemblGenomes-Tr; EBT00001694634.
DR   EnsemblGenomes-Tr; EBT00001694635.
DR   EnsemblGenomes-Tr; EBT00001694636.
DR   EnsemblGenomes-Tr; EBT00001694637.
DR   EnsemblGenomes-Tr; EBT00001694638.
DR   EnsemblGenomes-Tr; EBT00001694639.
DR   EnsemblGenomes-Tr; EBT00001694640.
DR   EnsemblGenomes-Tr; EBT00001694641.
DR   EnsemblGenomes-Tr; EBT00001694642.
DR   EnsemblGenomes-Tr; EBT00001694643.
DR   EnsemblGenomes-Tr; EBT00001694644.
DR   EnsemblGenomes-Tr; EBT00001694645.
DR   EnsemblGenomes-Tr; EBT00001694646.
DR   EnsemblGenomes-Tr; EBT00001694647.
DR   EnsemblGenomes-Tr; EBT00001694648.
DR   EnsemblGenomes-Tr; EBT00001694649.
DR   EnsemblGenomes-Tr; EBT00001694650.
DR   EnsemblGenomes-Tr; EBT00001694651.
DR   EnsemblGenomes-Tr; EBT00001694652.
DR   EnsemblGenomes-Tr; EBT00001694653.
DR   EnsemblGenomes-Tr; EBT00001694654.
DR   EnsemblGenomes-Tr; EBT00001694655.
DR   EnsemblGenomes-Tr; EBT00001694656.
DR   EnsemblGenomes-Tr; EBT00001694657.
DR   EnsemblGenomes-Tr; EBT00001694658.
DR   EnsemblGenomes-Tr; EBT00001694659.
DR   EnsemblGenomes-Tr; EBT00001694660.
DR   EnsemblGenomes-Tr; EBT00001694661.
DR   EnsemblGenomes-Tr; EBT00001694662.
DR   EnsemblGenomes-Tr; EBT00001694663.
DR   EnsemblGenomes-Tr; EBT00001694664.
DR   EnsemblGenomes-Tr; EBT00001694665.
DR   EnsemblGenomes-Tr; EBT00001694666.
DR   EnsemblGenomes-Tr; EBT00001694667.
DR   EnsemblGenomes-Tr; EBT00001694668.
DR   EnsemblGenomes-Tr; EBT00001694669.
DR   EnsemblGenomes-Tr; EBT00001694670.
DR   EnsemblGenomes-Tr; EBT00001694671.
DR   EnsemblGenomes-Tr; EBT00001694672.
DR   EnsemblGenomes-Tr; EBT00001694673.
DR   EnsemblGenomes-Tr; EBT00001694674.
DR   EnsemblGenomes-Tr; EBT00001694675.
DR   EnsemblGenomes-Tr; EBT00001694676.
DR   EnsemblGenomes-Tr; EBT00001694677.
DR   EnsemblGenomes-Tr; EBT00001694678.
DR   EnsemblGenomes-Tr; EBT00001694679.
DR   EnsemblGenomes-Tr; EBT00001694680.
DR   EnsemblGenomes-Tr; EBT00001694681.
DR   EnsemblGenomes-Tr; EBT00001694682.
DR   EnsemblGenomes-Tr; EBT00001694683.
DR   EnsemblGenomes-Tr; EBT00001694684.
DR   EnsemblGenomes-Tr; EBT00001694685.
DR   EnsemblGenomes-Tr; EBT00001694686.
DR   EnsemblGenomes-Tr; EBT00001694687.
DR   EnsemblGenomes-Tr; EBT00001694688.
DR   EnsemblGenomes-Tr; EBT00001694689.
DR   EnsemblGenomes-Tr; EBT00001694690.
DR   EnsemblGenomes-Tr; EBT00001694691.
DR   EnsemblGenomes-Tr; EBT00001694692.
DR   EnsemblGenomes-Tr; EBT00001694693.
DR   EnsemblGenomes-Tr; EBT00001694694.
DR   EnsemblGenomes-Tr; EBT00001694695.
DR   EnsemblGenomes-Tr; EBT00001694696.
DR   EnsemblGenomes-Tr; EBT00001694697.
DR   EnsemblGenomes-Tr; EBT00001694698.
DR   EnsemblGenomes-Tr; EBT00001694699.
DR   EnsemblGenomes-Tr; EBT00001694700.
DR   EnsemblGenomes-Tr; EBT00001694701.
DR   EnsemblGenomes-Tr; EBT00001694702.
DR   EnsemblGenomes-Tr; EBT00001694703.
DR   EnsemblGenomes-Tr; EBT00001694704.
DR   EnsemblGenomes-Tr; EBT00001694705.
DR   EnsemblGenomes-Tr; EBT00001694706.
DR   EnsemblGenomes-Tr; EBT00001694707.
DR   EnsemblGenomes-Tr; EBT00001694708.
DR   EnsemblGenomes-Tr; EBT00001694709.
DR   EnsemblGenomes-Tr; EBT00001694710.
DR   EnsemblGenomes-Tr; EBT00001694711.
DR   EnsemblGenomes-Tr; EBT00001694712.
DR   EnsemblGenomes-Tr; EBT00001694713.
DR   EnsemblGenomes-Tr; EBT00001694714.
DR   EnsemblGenomes-Tr; EBT00001694715.
DR   EnsemblGenomes-Tr; EBT00001694716.
DR   EnsemblGenomes-Tr; EBT00001694717.
DR   EnsemblGenomes-Tr; EBT00001694718.
DR   EnsemblGenomes-Tr; EBT00001694719.
DR   EnsemblGenomes-Tr; EBT00001694720.
DR   EnsemblGenomes-Tr; EBT00001694721.
DR   EnsemblGenomes-Tr; EBT00001694722.
DR   EnsemblGenomes-Tr; EBT00001694723.
DR   EnsemblGenomes-Tr; EBT00001694724.
DR   EnsemblGenomes-Tr; EBT00001694725.
DR   EnsemblGenomes-Tr; EBT00001694726.
DR   EnsemblGenomes-Tr; EBT00001694727.
DR   EnsemblGenomes-Tr; EBT00001694728.
DR   EnsemblGenomes-Tr; EBT00001694729.
DR   EnsemblGenomes-Tr; EBT00001694730.
DR   EnsemblGenomes-Tr; EBT00001694731.
DR   EnsemblGenomes-Tr; EBT00001694732.
DR   EnsemblGenomes-Tr; EBT00001694733.
DR   EnsemblGenomes-Tr; EBT00001694734.
DR   EnsemblGenomes-Tr; EBT00001694736.
DR   EnsemblGenomes-Tr; EBT00001694738.
DR   EnsemblGenomes-Tr; EBT00001694739.
DR   EnsemblGenomes-Tr; EBT00001694741.
DR   EnsemblGenomes-Tr; EBT00001694743.
DR   EnsemblGenomes-Tr; EBT00001694745.
DR   EnsemblGenomes-Tr; EBT00001694746.
DR   EnsemblGenomes-Tr; EBT00001694748.
DR   EnsemblGenomes-Tr; EBT00001694750.
DR   EnsemblGenomes-Tr; EBT00001694752.
DR   EnsemblGenomes-Tr; EBT00001694753.
DR   EnsemblGenomes-Tr; EBT00001694755.
DR   EnsemblGenomes-Tr; EBT00001694757.
DR   EnsemblGenomes-Tr; EBT00001694758.
DR   EnsemblGenomes-Tr; EBT00001694759.
DR   EnsemblGenomes-Tr; EBT00001694761.
DR   EnsemblGenomes-Tr; EBT00001694763.
DR   EnsemblGenomes-Tr; EBT00001694765.
DR   EnsemblGenomes-Tr; EBT00001694766.
DR   EnsemblGenomes-Tr; EBT00001694768.
DR   EnsemblGenomes-Tr; EBT00001694770.
DR   EnsemblGenomes-Tr; EBT00001694772.
DR   EnsemblGenomes-Tr; EBT00001694774.
DR   EnsemblGenomes-Tr; EBT00001694776.
DR   EnsemblGenomes-Tr; EBT00001694778.
DR   EnsemblGenomes-Tr; EBT00001694780.
DR   EnsemblGenomes-Tr; EBT00001694782.
DR   EnsemblGenomes-Tr; EBT00001694783.
DR   EnsemblGenomes-Tr; EBT00001694786.
DR   EnsemblGenomes-Tr; EBT00001694787.
DR   EnsemblGenomes-Tr; EBT00001694789.
DR   EnsemblGenomes-Tr; EBT00001694791.
DR   EnsemblGenomes-Tr; EBT00001694792.
DR   EnsemblGenomes-Tr; EBT00001694794.
DR   EnsemblGenomes-Tr; EBT00001694796.
DR   EnsemblGenomes-Tr; EBT00001694798.
DR   EnsemblGenomes-Tr; EBT00001694799.
DR   EnsemblGenomes-Tr; EBT00001694801.
DR   EnsemblGenomes-Tr; EBT00001694803.
DR   EnsemblGenomes-Tr; EBT00001694805.
DR   EnsemblGenomes-Tr; EBT00001694806.
DR   EnsemblGenomes-Tr; EBT00001694808.
DR   EnsemblGenomes-Tr; EBT00001694810.
DR   EnsemblGenomes-Tr; EBT00001694812.
DR   EnsemblGenomes-Tr; EBT00001694814.
DR   EnsemblGenomes-Tr; EBT00001694816.
DR   EnsemblGenomes-Tr; EBT00001694818.
DR   EnsemblGenomes-Tr; EBT00001694820.
DR   EnsemblGenomes-Tr; EBT00001694822.
DR   EnsemblGenomes-Tr; EBT00001694824.
DR   EnsemblGenomes-Tr; EBT00001694826.
DR   EnsemblGenomes-Tr; EBT00001694828.
DR   EnsemblGenomes-Tr; EBT00001694830.
DR   EnsemblGenomes-Tr; EBT00001694832.
DR   EnsemblGenomes-Tr; EBT00001694833.
DR   EnsemblGenomes-Tr; EBT00001694835.
DR   EnsemblGenomes-Tr; EBT00001694837.
DR   EnsemblGenomes-Tr; EBT00001694838.
DR   EnsemblGenomes-Tr; EBT00001694840.
DR   EnsemblGenomes-Tr; EBT00001694842.
DR   EnsemblGenomes-Tr; EBT00001694844.
DR   EnsemblGenomes-Tr; EBT00001694845.
DR   EnsemblGenomes-Tr; EBT00001694847.
DR   EnsemblGenomes-Tr; EBT00001694849.
DR   EnsemblGenomes-Tr; EBT00001694850.
DR   EnsemblGenomes-Tr; EBT00001694852.
DR   EnsemblGenomes-Tr; EBT00001694854.
DR   EnsemblGenomes-Tr; EBT00001694856.
DR   EnsemblGenomes-Tr; EBT00001694858.
DR   EnsemblGenomes-Tr; EBT00001694859.
DR   EnsemblGenomes-Tr; EBT00001694861.
DR   EnsemblGenomes-Tr; EBT00001694863.
DR   EnsemblGenomes-Tr; EBT00001694865.
DR   EnsemblGenomes-Tr; EBT00001694866.
DR   EnsemblGenomes-Tr; EBT00001694868.
DR   EnsemblGenomes-Tr; EBT00001694870.
DR   EnsemblGenomes-Tr; EBT00001694872.
DR   EnsemblGenomes-Tr; EBT00001694874.
DR   EnsemblGenomes-Tr; EBT00001694876.
DR   EnsemblGenomes-Tr; EBT00001694877.
DR   EnsemblGenomes-Tr; EBT00001694879.
DR   EnsemblGenomes-Tr; EBT00001694881.
DR   EnsemblGenomes-Tr; EBT00001694883.
DR   EnsemblGenomes-Tr; EBT00001694884.
DR   EnsemblGenomes-Tr; EBT00001694885.
DR   EnsemblGenomes-Tr; EBT00001694886.
DR   EnsemblGenomes-Tr; EBT00001694887.
DR   EnsemblGenomes-Tr; EBT00001694888.
DR   EnsemblGenomes-Tr; EBT00001694889.
DR   EnsemblGenomes-Tr; EBT00001694890.
DR   EnsemblGenomes-Tr; EBT00001694891.
DR   EnsemblGenomes-Tr; EBT00001694892.
DR   EnsemblGenomes-Tr; EBT00001694893.
DR   EnsemblGenomes-Tr; EBT00001694894.
DR   EnsemblGenomes-Tr; EBT00001694895.
DR   EnsemblGenomes-Tr; EBT00001694896.
DR   EnsemblGenomes-Tr; EBT00001694897.
DR   EnsemblGenomes-Tr; EBT00001694898.
DR   EnsemblGenomes-Tr; EBT00001694899.
DR   EnsemblGenomes-Tr; EBT00001694900.
DR   EnsemblGenomes-Tr; yr001-1.
DR   EnsemblGenomes-Tr; yr002-1.
DR   EnsemblGenomes-Tr; yr003-1.
DR   EnsemblGenomes-Tr; yr004-1.
DR   EnsemblGenomes-Tr; yr005-1.
DR   EnsemblGenomes-Tr; yr006-1.
DR   EnsemblGenomes-Tr; yr007-1.
DR   EnsemblGenomes-Tr; yr008-1.
DR   EnsemblGenomes-Tr; yr009-1.
DR   EnsemblGenomes-Tr; yr010-1.
DR   EnsemblGenomes-Tr; yr011-1.
DR   EnsemblGenomes-Tr; yr012-1.
DR   EnsemblGenomes-Tr; yr013-1.
DR   EnsemblGenomes-Tr; yr014-1.
DR   EnsemblGenomes-Tr; yr015-1.
DR   EnsemblGenomes-Tr; yr016-1.
DR   EnsemblGenomes-Tr; yr017-1.
DR   EnsemblGenomes-Tr; yr018-1.
DR   EnsemblGenomes-Tr; yr019-1.
DR   EnsemblGenomes-Tr; yr020-1.
DR   EnsemblGenomes-Tr; yr021-1.
DR   EnsemblGenomes-Tr; yr022-1.
DR   EnsemblGenomes-Tr; yr023-1.
DR   EnsemblGenomes-Tr; yr024-1.
DR   EnsemblGenomes-Tr; yt001-1.
DR   EnsemblGenomes-Tr; yt002-1.
DR   EnsemblGenomes-Tr; yt003-1.
DR   EnsemblGenomes-Tr; yt004-1.
DR   EnsemblGenomes-Tr; yt005-1.
DR   EnsemblGenomes-Tr; yt006-1.
DR   EnsemblGenomes-Tr; yt007-1.
DR   EnsemblGenomes-Tr; yt008-1.
DR   EnsemblGenomes-Tr; yt009-1.
DR   EnsemblGenomes-Tr; yt010-1.
DR   EnsemblGenomes-Tr; yt011-1.
DR   EnsemblGenomes-Tr; yt012-1.
DR   EnsemblGenomes-Tr; yt013-1.
DR   EnsemblGenomes-Tr; yt014-1.
DR   EnsemblGenomes-Tr; yt015-1.
DR   EnsemblGenomes-Tr; yt016-1.
DR   EnsemblGenomes-Tr; yt017-1.
DR   EnsemblGenomes-Tr; yt018-1.
DR   EnsemblGenomes-Tr; yt019-1.
DR   EnsemblGenomes-Tr; yt020-1.
DR   EnsemblGenomes-Tr; yt021-1.
DR   EnsemblGenomes-Tr; yt022-1.
DR   EnsemblGenomes-Tr; yt023-1.
DR   EnsemblGenomes-Tr; yt024-1.
DR   EnsemblGenomes-Tr; yt025-1.
DR   EnsemblGenomes-Tr; yt026-1.
DR   EnsemblGenomes-Tr; yt027-1.
DR   EnsemblGenomes-Tr; yt028-1.
DR   EnsemblGenomes-Tr; yt029-1.
DR   EnsemblGenomes-Tr; yt030-1.
DR   EnsemblGenomes-Tr; yt031-1.
DR   EnsemblGenomes-Tr; yt032-1.
DR   EnsemblGenomes-Tr; yt033-1.
DR   EnsemblGenomes-Tr; yt034-1.
DR   EnsemblGenomes-Tr; yt035-1.
DR   EnsemblGenomes-Tr; yt036-1.
DR   EnsemblGenomes-Tr; yt037-1.
DR   EnsemblGenomes-Tr; yt038-1.
DR   EnsemblGenomes-Tr; yt039-1.
DR   EnsemblGenomes-Tr; yt040-1.
DR   EnsemblGenomes-Tr; yt041-1.
DR   EnsemblGenomes-Tr; yt042-1.
DR   EnsemblGenomes-Tr; yt043-1.
DR   EnsemblGenomes-Tr; yt044-1.
DR   EnsemblGenomes-Tr; yt045-1.
DR   EnsemblGenomes-Tr; yt046-1.
DR   EnsemblGenomes-Tr; yt047-1.
DR   EnsemblGenomes-Tr; yt048-1.
DR   EnsemblGenomes-Tr; yt049-1.
DR   EnsemblGenomes-Tr; yt050-1.
DR   EnsemblGenomes-Tr; yt051-1.
DR   EnsemblGenomes-Tr; yt052-1.
DR   EnsemblGenomes-Tr; yt053-1.
DR   EnsemblGenomes-Tr; yt054-1.
DR   EnsemblGenomes-Tr; yt055-1.
DR   EnsemblGenomes-Tr; yt056-1.
DR   EnsemblGenomes-Tr; yt057-1.
DR   EnsemblGenomes-Tr; yt058-1.
DR   EnsemblGenomes-Tr; yt059-1.
DR   EnsemblGenomes-Tr; yt060-1.
DR   EnsemblGenomes-Tr; yt061-1.
DR   EnsemblGenomes-Tr; yt062-1.
DR   EnsemblGenomes-Tr; yt063-1.
DR   EnsemblGenomes-Tr; yt064-1.
DR   EnsemblGenomes-Tr; yt065-1.
DR   EnsemblGenomes-Tr; yt066-1.
DR   EnsemblGenomes-Tr; yt067-1.
DR   EnsemblGenomes-Tr; yt068-1.
DR   EnsemblGenomes-Tr; yt069-1.
DR   EnsemblGenomes-Tr; yt070-1.
DR   EnsemblGenomes-Tr; yt071-1.
DR   EnsemblGenomes-Tr; yt072-1.
DR   EnsemblGenomes-Tr; yt073-1.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC128149; 12117929.
DR   EuropePMC; PMC135232; 12142430.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC275418; 14592990.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC2889952; 20509911.
DR   EuropePMC; PMC2937462; 20566693.
DR   EuropePMC; PMC2951374; 20949072.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC4054137; 24727277.
DR   EuropePMC; PMC4807491; 26831468.
DR   GOA; P61475.
DR   GOA; Q74PY8.
DR   GOA; Q74R94.
DR   GOA; Q74U12.
DR   GOA; Q74VT6.
DR   GOA; Q8ZB82.
DR   GOA; Q8ZC86.
DR   GOA; Q8ZDC6.
DR   GOA; Q8ZDW7.
DR   GOA; Q8ZDZ6.
DR   GOA; Q8ZEG6.
DR   GOA; Q8ZEG7.
DR   GOA; Q8ZGC3.
DR   GOA; Q8ZJ91.
DR   GOA; Q8ZJA3.
DR   GOA; Q8ZJA8.
DR   GOA; Q8ZJP2.
DR   GOA; Q9ZFR5.
DR   InterPro; IPR000053; Thymidine/pyrmidine_PPase.
DR   InterPro; IPR000266; Ribosomal_S17/S11.
DR   InterPro; IPR000312; Glycosyl_Trfase_fam3.
DR   InterPro; IPR000473; Ribosomal_L36.
DR   InterPro; IPR001383; Ribosomal_L28.
DR   InterPro; IPR001706; Ribosomal_L35_non-mt.
DR   InterPro; IPR002222; Ribosomal_S19.
DR   InterPro; IPR002669; UreD.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR004465; RNR_NrdI.
DR   InterPro; IPR004671; Na+/H+_antiporter_NhaB.
DR   InterPro; IPR005651; Trm112-like.
DR   InterPro; IPR005732; Ribosomal_S19_bac-type.
DR   InterPro; IPR005940; Anthranilate_Pribosyl_Tfrase.
DR   InterPro; IPR006817; Lipoprotein_leucine-zipper_dom.
DR   InterPro; IPR013102; PYNP_C.
DR   InterPro; IPR013465; Thymidine_Pase.
DR   InterPro; IPR016367; Murein-lipoprotein.
DR   InterPro; IPR017459; Glycosyl_Trfase_fam3_N_dom.
DR   InterPro; IPR017872; Pyrmidine_PPase_CS.
DR   InterPro; IPR018090; Pyrmidine_PPas_bac/euk.
DR   InterPro; IPR018265; Ribosomal_L35_CS.
DR   InterPro; IPR019979; Ribosomal_S17_CS.
DR   InterPro; IPR019984; Ribosomal_S17.
DR   InterPro; IPR020852; RNR_Ib_NrdI_bac.
DR   InterPro; IPR020934; Ribosomal_S19_CS.
DR   InterPro; IPR021137; Ribosomal_L35.
DR   InterPro; IPR022371; Exopolyphosphatase.
DR   InterPro; IPR023575; Ribosomal_S19_SF.
DR   InterPro; IPR023646; Prisomal_replication_PriB.
DR   InterPro; IPR023709; Guo-5TP_3DP_PyrP.
DR   InterPro; IPR023745; MFS_YcaD.
DR   InterPro; IPR026569; Ribo_L28/L24.
DR   InterPro; IPR034704; L28p-like.
DR   InterPro; IPR035902; Nuc_phospho_transferase.
DR   InterPro; IPR035977; Ribosomal_L36_sp.
DR   InterPro; IPR036320; Glycosyl_Trfase_fam3_N_dom)sf.
DR   InterPro; IPR036566; PYNP-like_C_sf.
DR   InterPro; IPR037147; Ribo_L28/L24_sf.
DR   InterPro; IPR037229; Ribosomal_L35_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; AE009952.
DR   SILVA-SSU; AE009952.
DR   UniProtKB/Swiss-Prot; P61475; YIDD_YERPE.
DR   UniProtKB/Swiss-Prot; Q74PY8; TYPH_YERPE.
DR   UniProtKB/Swiss-Prot; Q74R94; GPPA_YERPE.
DR   UniProtKB/Swiss-Prot; Q74U12; NHAB_YERPE.
DR   UniProtKB/Swiss-Prot; Q74VT6; Y1399_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZB82; PRIB_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZC86; RL362_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZDC6; NRDI_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZDW7; RL35_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZDZ6; LPP_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZEG6; TRPG_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZEG7; TRPD_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZGC3; Y1380_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZJ91; RL361_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZJA3; RS17_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZJA8; RS19_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZJP2; RL28_YERPE.
DR   UniProtKB/Swiss-Prot; Q9ZFR5; URED_YERPE.
XX
CC   On or before May 2, 2006 this sequence version replaced
CC   gi:21956656, gi:21956667, gi:21956674, gi:21956680, gi:21956691,
CC   gi:21956705, gi:21956717, gi:21956732, gi:21956743, gi:21956757,
CC   gi:21956769, gi:21956778, gi:21956792, gi:21956799, gi:21956813,
CC   gi:21956829, gi:21956840, gi:21956852, gi:21956857, gi:21956868,
CC   gi:21956880, gi:21956892, gi:21956905, gi:21956914, gi:21956925,
CC   gi:21956938, gi:21956949, gi:21956964, gi:21956977, gi:21956986,
CC   gi:21956994, gi:21957003, gi:21957010, gi:21957020, gi:21957029,
CC   gi:21957037, gi:21957046, gi:21957059, gi:21957069, gi:21957080,
CC   gi:21957091, gi:21957100, gi:21957113, gi:21957124, gi:21957136,
CC   gi:21957145, gi:21957159, gi:21957165, gi:21957178, gi:21957184,
CC   gi:21957197, gi:21957202, gi:21957212, gi:21957224, gi:21957237,
CC   gi:21957247, gi:21957258, gi:21957269, gi:21957274, gi:21957284,
CC   gi:21957296, gi:21957307, gi:21957316, gi:21957328, gi:21957335,
CC   gi:21957345, gi:21957353, gi:21957368, gi:21957378, gi:21957392,
CC   gi:21957403, gi:21957413, gi:21957424, gi:21957437, gi:21957454,
CC   gi:21957462, gi:21957471, gi:21957482, gi:21957491, gi:21957497,
CC   gi:21957510, gi:21957522, gi:21957529, gi:21957541, gi:21957550,
CC   gi:21957562, gi:21957573, gi:21957582, gi:21957593, gi:21957603,
CC   gi:21957611, gi:21957622, gi:21957636, gi:21957648, gi:21957652,
CC   gi:21957662, gi:21957676, gi:21957683, gi:21957696, gi:21957703,
CC   gi:21957715, gi:21957722, gi:21957732, gi:21957746, gi:21957761,
CC   gi:21957770, gi:21957778, gi:21957788, gi:21957799, gi:21957814,
CC   gi:21957826, gi:21957834, gi:21957843, gi:21957857, gi:21957872,
CC   gi:21957884, gi:21957894, gi:21957899, gi:21957903, gi:21957915,
CC   gi:21957932, gi:21957942, gi:21957954, gi:21957963, gi:21957971,
CC   gi:21957982, gi:21957996, gi:21958007, gi:21958020, gi:21958030,
CC   gi:21958045, gi:21958059, gi:21958071, gi:21958078, gi:21958087,
CC   gi:21958099, gi:21958114, gi:21958120, gi:21958132, gi:21958147,
CC   gi:21958153, gi:21958159, gi:21958170, gi:21958180, gi:21958192,
CC   gi:21958205, gi:21958216, gi:21958225, gi:21958235, gi:21958249,
CC   gi:21958258, gi:21958270, gi:21958281, gi:21958291, gi:21958305,
CC   gi:21958314, gi:21958324, gi:21958333, gi:21958340, gi:21958354,
CC   gi:21958367, gi:21958379, gi:21958388, gi:21958399, gi:21958412,
CC   gi:21958422, gi:21958429, gi:21958438, gi:21958451, gi:21958463,
CC   gi:21958475, gi:21958489, gi:21958495, gi:21958500, gi:21958514,
CC   gi:21958526, gi:21958537, gi:21958551, gi:21958564, gi:21958575,
CC   gi:21958589, gi:21958600, gi:21958612, gi:21958624, gi:21958631,
CC   gi:21958640, gi:21958649, gi:21958661, gi:21958671, gi:21958680,
CC   gi:21958691, gi:21958703, gi:21958716, gi:21958732, gi:21958744,
CC   gi:21958752, gi:21958761, gi:21958770, gi:21958783, gi:21958794,
CC   gi:21958803, gi:21958816, gi:21958827, gi:21958839, gi:21958850,
CC   gi:21958861, gi:21958872, gi:21958884, gi:21958894, gi:21958906,
CC   gi:21958917, gi:21958927, gi:21958936, gi:21958945, gi:21958955,
CC   gi:21958965, gi:21958973, gi:21958983, gi:21958992, gi:21959005,
CC   gi:21959014, gi:21959022, gi:21959031, gi:21959041, gi:21959057,
CC   gi:21959073, gi:21959085, gi:21959096, gi:21959108, gi:21959117,
CC   gi:21959127, gi:21959141, gi:21959154, gi:21959168, gi:21959177,
CC   gi:21959190, gi:21959198, gi:21959206, gi:21959215, gi:21959227,
CC   gi:21959235, gi:21959246, gi:21959257, gi:21959260, gi:21959263,
CC   gi:21959274, gi:21959296, gi:21959307, gi:21959317, gi:21959327,
CC   gi:21959338, gi:21959349, gi:21959364, gi:21959377, gi:21959389,
CC   gi:21959401, gi:21959417, gi:21959427, gi:21959437, gi:21959453,
CC   gi:21959463, gi:21959476, gi:21959488, gi:21959496, gi:21959508,
CC   gi:21959515, gi:21959523, gi:21959533, gi:21959543, gi:21959554,
CC   gi:21959567, gi:21959575, gi:21959584, gi:21959593, gi:21959605,
CC   gi:21959617, gi:21959628, gi:21959640, gi:21959648, gi:21959659,
CC   gi:21959670, gi:21959680, gi:21959688, gi:21959696, gi:21959711,
CC   gi:21959720, gi:21959739, gi:21959751, gi:21959763, gi:21959774,
CC   gi:21959782, gi:21959793, gi:21959805, gi:21959818, gi:21959832,
CC   gi:21959847, gi:21959860, gi:21959874, gi:21959881, gi:21959890,
CC   gi:21959899, gi:21959913, gi:21959925, gi:21959939, gi:21959948,
CC   gi:21959961, gi:21959972, gi:21959984, gi:21959997, gi:21960007,
CC   gi:21960019, gi:21960027, gi:21960042, gi:21960053, gi:21960065,
CC   gi:21960078, gi:21960088, gi:21960093, gi:21960105, gi:21960115,
CC   gi:21960129, gi:21960140, gi:21960147, gi:21960160, gi:21960168,
CC   gi:21960177, gi:21960188, gi:21960202, gi:21960215, gi:21960228,
CC   gi:21960237, gi:21960248, gi:21960255, gi:21960270, gi:21960277,
CC   gi:21960291, gi:21960300, gi:21960309, gi:21960321, gi:21960333,
CC   gi:21960343, gi:21960347, gi:21960356, gi:21960365, gi:21960376,
CC   gi:21960382, gi:21960387, gi:21960399, gi:21960414, gi:21960424,
CC   gi:21960435, gi:21960444, gi:21960456, gi:21960469, gi:21960480,
CC   gi:21960490, gi:21960501, gi:21960520, gi:21960532, gi:21960540,
CC   gi:21960548, gi:21960558, gi:21960569, gi:21960587, gi:21960597,
CC   gi:21960608, gi:21960616, gi:21960625, gi:21960632, gi:21960645,
CC   gi:21960654, gi:21960664, gi:21960673, gi:21960685, gi:21960695,
CC   gi:21960707, gi:21960717, gi:21960725, gi:21960738, gi:21960747,
CC   gi:21960761, gi:21960774, gi:21960789, gi:21960797, gi:21960806,
CC   gi:21960814, gi:21960823, gi:21960833, gi:21960841, gi:21960851,
CC   gi:21960862, gi:21960875, gi:21960881, gi:21960888, gi:21960899,
CC   gi:21960910, gi:21960921, gi:21960933, gi:21960947, gi:21960955,
CC   gi:21960971, gi:21960988, gi:21961004, gi:21961025, gi:21961042,
CC   gi:21961051, gi:21961062, gi:21961073, gi:21961086, gi:21961093,
CC   gi:21961103, gi:21961114, gi:21961127, gi:21961139, gi:21961149.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4600755
FT                   /organism="Yersinia pestis KIM10+"
FT                   /strain="KIM"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:187410"
FT   gene            complement(21..461)
FT                   /gene="mioC"
FT                   /locus_tag="y0001"
FT   CDS_pept        complement(21..461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="y0001"
FT                   /product="initiation of chromosome replication"
FT                   /function="factor; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 1 to 146 of 146 are 67.12 pct identical to
FT                   residues 1 to 146 of 147 from E. coli K12 : B3742; residues
FT                   1 to 146 of 146 are 68.49 pct identical to residues 1 to
FT                   146 of 147 from GenPept : >gb|AAL22733.1| (AE008881)
FT                   initiation of chromosome replication [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83597"
FT                   /db_xref="GOA:A0A3N4AXF4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXF4"
FT                   /protein_id="AAM83597.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   gene            complement(554..1015)
FT                   /gene="asnC"
FT                   /locus_tag="y0002"
FT   CDS_pept        complement(554..1015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="y0002"
FT                   /product="regulator for asnA, asnC and gidA"
FT                   /function="regulator; amino acid biosynthesis: Asparagine"
FT                   /note="residues 3 to 153 of 153 are 84.76 pct identical to
FT                   residues 2 to 152 of 152 from E. coli K12 : B3743; residues
FT                   3 to 153 of 153 are 86.09 pct identical to residues 2 to
FT                   152 of 152 from GenPept : >emb|CAD03119.1| (AL627280)
FT                   regulatory protein [Salmonella enterica subsp. enterica
FT                   serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83598"
FT                   /db_xref="GOA:A0A3N4B0K9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0K9"
FT                   /protein_id="AAM83598.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   gene            1185..2177
FT                   /gene="asnA"
FT                   /locus_tag="y0003"
FT   CDS_pept        1185..2177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="y0003"
FT                   /product="asparagine synthetase A"
FT                   /function="enzyme; amino acid biosynthesis: Asparagine"
FT                   /note="residues 1 to 330 of 330 are 78.48 pct identical to
FT                   residues 1 to 330 of 330 from E. coli K12 : B3744"
FT                   /db_xref="EnsemblGenomes-Gn:y0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83599"
FT                   /db_xref="GOA:Q8ZJT3"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT3"
FT                   /protein_id="AAM83599.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   gene            complement(2276..3742)
FT                   /locus_tag="y0004"
FT   CDS_pept        complement(2276..3742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0004"
FT                   /product="hypothetical protein"
FT                   /note="residues 57 to 488 of 488 are 65.04 pct identical to
FT                   residues 1 to 427 of 427 from E. coli K12 : B3745; residues
FT                   1 to 488 of 488 are 64.34 pct identical to residues 1 to
FT                   483 of 483 from GenPept : >dbj|BAB38110.1| (AP002566)
FT                   hypothetical protein [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83600"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT2"
FT                   /protein_id="AAM83600.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   gene            complement(3746..5299)
FT                   /locus_tag="y0005"
FT   CDS_pept        complement(3746..5299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0005"
FT                   /product="putative 2-component regulator"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 496 of 517 are 67.54 pct identical to
FT                   residues 9 to 504 of 506 from E. coli K12 : B3746"
FT                   /db_xref="EnsemblGenomes-Gn:y0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83601"
FT                   /db_xref="GOA:Q8ZJT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT1"
FT                   /protein_id="AAM83601.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKI
FT                   TLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVK
FT                   QSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRA
FT                   KLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQIQFQQRKFQQQKHSGH
FT                   "
FT   gene            5573..7441
FT                   /gene="kup"
FT                   /locus_tag="y0006"
FT   CDS_pept        5573..7441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="y0006"
FT                   /product="low affinity potassium transport system"
FT                   /function="transport; transport of small molecules;
FT                   cations"
FT                   /note="residues 1 to 505 of 622 are 83.96 pct identical to
FT                   residues 1 to 505 of 519 from E. coli K12 : B3747; residues
FT                   1 to 622 of 622 are 84.72 pct identical to residues 1 to
FT                   622 of 622 from GenPept : >gb|AAL22738.1| (AE008881) KUP
FT                   family, potassium transport system, low affinity
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83602"
FT                   /db_xref="GOA:Q8ZJT0"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT0"
FT                   /protein_id="AAM83602.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            7646..8065
FT                   /gene="rbsD"
FT                   /locus_tag="y0007"
FT   CDS_pept        7646..8065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="y0007"
FT                   /product="D-ribose high-affinity transport system;
FT                   membrane-associated protein"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 1 to 139 of 139 are 68.34 pct identical to
FT                   residues 13 to 151 of 151 from E. coli K12 : B3748"
FT                   /db_xref="EnsemblGenomes-Gn:y0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83603"
FT                   /db_xref="GOA:Q7CLE5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLE5"
FT                   /protein_id="AAM83603.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   gene            8116..9042
FT                   /gene="rbsK"
FT                   /locus_tag="y0008"
FT   CDS_pept        8116..9042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="y0008"
FT                   /product="ribokinase"
FT                   /function="enzyme; degradation of small molecules; Carbon
FT                   compounds"
FT                   /note="residues 4 to 307 of 308 are 71.38 pct identical to
FT                   residues 5 to 308 of 309 from E. coli K12 : B3752; residues
FT                   1 to 308 of 308 are 100.00 pct identical to residues 1 to
FT                   308 of 308 from GenPept : >emb|CAC88875.1| (AJ414141)
FT                   ribokinase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83604"
FT                   /db_xref="GOA:A0A3N4AW72"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW72"
FT                   /protein_id="AAM83604.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   gene            9062..9265
FT                   /locus_tag="y0009"
FT   CDS_pept        9062..9265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0009"
FT                   /product="hypothetical"
FT                   /note="residues 6 to 46 of 67 are 56.09 pct identical to
FT                   residues 194 to 234 of 330 from GenPept :
FT                   >gb|AAK16096.1|AF288084_2 (AF288084) NgrF [Photorhabdus
FT                   luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83605"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX5"
FT                   /protein_id="AAM83605.1"
FT                   /translation="MSPVWQGYRQAMARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNP
FT                   EAEPQVLPLTPELIERGSVSLR"
FT   gene            complement(9262..10686)
FT                   /locus_tag="y0010"
FT   CDS_pept        complement(9262..10686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0010"
FT                   /product="putative permease"
FT                   /function="putative transport"
FT                   /note="residues 3 to 465 of 474 are 73.43 pct identical to
FT                   residues 4 to 466 of 475 from E. coli K12 : B3754; residues
FT                   3 to 465 of 474 are 74.08 pct identical to residues 4 to
FT                   466 of 475 from GenPept : >gb|AAL22745.1| (AE008881)
FT                   putative MFS family tranport protein (1st mdule)
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83606"
FT                   /db_xref="GOA:A0A3N4AXG8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXG8"
FT                   /protein_id="AAM83606.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
FT   gene            complement(10766..11455)
FT                   /locus_tag="y0011"
FT   CDS_pept        complement(10766..11455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0011"
FT                   /product="hypothetical protein"
FT                   /note="residues 49 to 229 of 229 are 64.08 pct identical to
FT                   residues 1 to 180 of 181 from E. coli K12 : B3755; residues
FT                   1 to 229 of 229 are 67.68 pct identical to residues 1 to
FT                   229 of 230 from GenPept : >gb|AAG58958.1|AE005607_4
FT                   (AE005607) yieP gene product [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83607"
FT                   /db_xref="GOA:A0A3N4B0M4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0M4"
FT                   /protein_id="AAM83607.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQVM
FT                   QHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHKL
FT                   IYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFACQ
FT                   VLLKTVD"
FT   gene            12016..13600
FT                   /locus_tag="yr001"
FT   rRNA            12016..13600
FT                   /locus_tag="yr001"
FT                   /product="16S ribosomal RNA"
FT   gene            13694..13766
FT                   /locus_tag="yt001"
FT   tRNA            13694..13766
FT                   /locus_tag="yt001"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: TTC"
FT   gene            14022..16928
FT                   /locus_tag="yr002"
FT   rRNA            14022..16928
FT                   /locus_tag="yr002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(17019..17426)
FT                   /locus_tag="y0012"
FT   CDS_pept        complement(17019..17426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0012"
FT                   /product="hypothetical"
FT                   /note="residues 48 to 120 of 135 are 30.00 pct identical to
FT                   residues 84 to 159 of 443 from GenPept :
FT                   >gb|AAD36903.1|AE001821_3 (AE001821) hypothetical protein
FT                   [Thermotoga maritima]"
FT                   /db_xref="EnsemblGenomes-Gn:y0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83608"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX4"
FT                   /protein_id="AAM83608.1"
FT                   /translation="MDGLSVYLIPGSVLLSHGETPHYHRRYGVSLLSSAWGQVGPPRYC
FT                   RQVNSFLLLPNLIHVTGADTQSRTGDLTLTKGALYQLSHISTTKFDAWQCPTLAWGDPT
FT                   LPSALRRFTSEFGMGSGGTTALWPPGKFCFN"
FT   gene            17036..17155
FT                   /locus_tag="yr003"
FT   rRNA            17036..17155
FT                   /locus_tag="yr003"
FT                   /product="5S ribosomal RNA"
FT   gene            17169..17241
FT                   /locus_tag="yt002"
FT   tRNA            17169..17241
FT                   /locus_tag="yt002"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: GGT"
FT   gene            17285..17399
FT                   /locus_tag="yr004"
FT   rRNA            17285..17399
FT                   /locus_tag="yr004"
FT                   /product="5S ribosomal RNA"
FT   gene            18140..19069
FT                   /gene="metA"
FT                   /locus_tag="y0013"
FT   CDS_pept        18140..19069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="y0013"
FT                   /product="homoserine transsuccinylase"
FT                   /function="enzyme; amino acid biosynthesis: Methionine"
FT                   /note="residues 1 to 309 of 309 are 79.61 pct identical to
FT                   residues 1 to 309 of 309 from E. coli K12 : B4013; residues
FT                   1 to 309 of 309 are 79.61 pct identical to residues 1 to
FT                   309 of 309 from GenPept : >gb|AAG59205.1|AE005633_2
FT                   (AE005633) homoserine transsuccinylase [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83609"
FT                   /db_xref="GOA:Q8ZAR4"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAR4"
FT                   /protein_id="AAM83609.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLI
FT                   VTGAPLGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVK
FT                   LSGIYQHQTLEPLALLTRGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLF
FT                   ASKDKRVAFVTGHPEYDVDTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            complement(19262..19411)
FT                   /locus_tag="y0014"
FT   CDS_pept        complement(19262..19411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0014"
FT                   /product="hypothetical"
FT                   /note="residues 7 to 48 of 49 are 33.33 pct identical to
FT                   residues 512 to 553 of 1005 from GenPept :
FT                   >gb|AAK39925.1|AF165818_133 (AF165818) hypothetical protein
FT                   [Guillardia theta]"
FT                   /db_xref="EnsemblGenomes-Gn:y0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83610"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX3"
FT                   /protein_id="AAM83610.1"
FT                   /translation="MSLPVKKAEFYGYFSPDRNKNNQLIHKIKNDFHFYGNIFLIFIYH
FT                   IVNI"
FT   gene            19456..21087
FT                   /gene="aceB"
FT                   /locus_tag="y0015"
FT   CDS_pept        19456..21087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="y0015"
FT                   /product="malate synthase A"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Glyoxylate bypass"
FT                   /note="residues 12 to 543 of 543 are 79.54 pct identical to
FT                   residues 1 to 533 of 533 from E. coli K12 : B4014"
FT                   /db_xref="EnsemblGenomes-Gn:y0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83611"
FT                   /db_xref="GOA:Q8D1U4"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1U4"
FT                   /protein_id="AAM83611.1"
FT                   /translation="MAAVTLGRGIAMRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTE
FT                   LVVKFSESRNQLLATRASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEI
FT                   TGPVERKMVINALNANVKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKV
FT                   YQLKPNPAVLIARVRGLHLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFY
FT                   LPKMQSYQEAAWWSDVFNFTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVG
FT                   LNCGRWDYIFSYIKTLKNHPDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGM
FT                   AAFIPDKDAEKNKLVLDKVRADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQ
FT                   LEVSREQDKPITAAELLEPCSGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDA
FT                   ATAEISRTSIWQWIHHQKSLSNGQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEA
FT                   ARLMERITTQDELIDFLTLPGYALLA"
FT   gene            21134..22441
FT                   /gene="aceA"
FT                   /locus_tag="y0016"
FT   CDS_pept        21134..22441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="y0016"
FT                   /product="isocitrate lyase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Glyoxylate bypass"
FT                   /note="residues 4 to 435 of 435 are 85.18 pct identical to
FT                   residues 3 to 434 of 434 from E. coli K12 : B4015; residues
FT                   1 to 435 of 435 are 100.00 pct identical to residues 1 to
FT                   435 of 435 from GenPept : >emb|CAC93193.1| (AJ414158)
FT                   isocitrate lyase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83612"
FT                   /db_xref="GOA:A0A3N4BJ73"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJ73"
FT                   /protein_id="AAM83612.1"
FT                   /translation="MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECT
FT                   FAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAAD
FT                   VLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYA
FT                   PYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFAS
FT                   HQQEVGTGYFDKVTNIIQGGASSVTALTGSTEEQQF"
FT   gene            22514..24241
FT                   /gene="aceK"
FT                   /locus_tag="y0018"
FT   CDS_pept        22514..24241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="y0018"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Glyoxylate bypass"
FT                   /note="residues 5 to 572 of 575 are 75.52 pct identical to
FT                   residues 5 to 572 of 578 from E. coli K12 : B4016; residues
FT                   5 to 572 of 575 are 75.88 pct identical to residues 5 to
FT                   572 of 578 from GenPept : >gb|AAG59208.1|AE005633_5
FT                   (AE005633) isocitrate dehydrogenase kinase/phosphatase
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83613"
FT                   /db_xref="GOA:Q8ZAR7"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAR7"
FT                   /protein_id="AAM83613.1"
FT                   /translation="MVAKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQ
FT                   AMKKRIHLYDHHVGLVVEQLKYITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFN
FT                   SVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLR
FT                   LHWENLSRDIDYIVMAIRQAFTDEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPF
FT                   LLPIHHNESGELFIDTCLTSKAEASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTA
FT                   ELYTAIGCQKHGKTESYREYLAFIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKD
FT                   QFAPQKEVTQARVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPE
FT                   KLEDLGDKIVIKHLYMERRMTPLNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEE
FT                   FRHFLCSDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
FT   gene            complement(24077..24214)
FT                   /locus_tag="y0017"
FT   CDS_pept        complement(24077..24214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0017"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 39 of 45 are 35.89 pct identical to
FT                   residues 160 to 198 of 460 from GenPept : >gb|AAF52902.1|
FT                   (AE003628) CG13138 gene product [Drosophila melanogaster]"
FT                   /db_xref="EnsemblGenomes-Gn:y0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83614"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX2"
FT                   /protein_id="AAM83614.1"
FT                   /translation="MLSSISKNILHMPIPDTLLQAAPITGLEQIAVHLLKKVPDFPVTA
FT                   "
FT   gene            complement(24361..24954)
FT                   /gene="iclR"
FT                   /locus_tag="y0019"
FT   CDS_pept        complement(24361..24954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="y0019"
FT                   /product="repressor of aceBA operon"
FT                   /function="regulator; central intermediary metabolism:
FT                   Glyoxylate bypass"
FT                   /note="residues 5 to 192 of 197 are 78.19 pct identical to
FT                   residues 98 to 285 of 287 from E. coli K12 : B4018"
FT                   /db_xref="EnsemblGenomes-Gn:y0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83615"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1U3"
FT                   /protein_id="AAM83615.1"
FT                   /translation="MDHGGPHAFIVGSSFLQSRNLLAMVHPMLRRLMDESGETVNLAVL
FT                   DHSDYQAIIIDQVQCTALMRMSAPIGGKLPMHASGAGKAFLSTLPDDQLVQLLHKKGLH
FT                   AYTQHTRTNPTSLKENLALIRKQGYSFDDEEHALGLRCIAACLFDEHHEAFAAISISGP
FT                   ISRITDDRVTELGALVIHAAKEITQSYGGGTGVK"
FT   gene            25420..29115
FT                   /gene="metH"
FT                   /locus_tag="y0020"
FT   CDS_pept        25420..29115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="y0020"
FT                   /product="B12-dependent
FT                   homocysteine-N5-methyltetrahydrofolate transmethylase,
FT                   repressor of metE and metF"
FT                   /function="enzyme; amino acid biosynthesis: Methionine"
FT                   /note="residues 6 to 1231 of 1231 are 85.90 pct identical
FT                   to residues 1 to 1227 of 1227 from E. coli K12 : B4019;
FT                   residues 6 to 1231 of 1231 are 86.14 pct identical to
FT                   residues 30 to 1256 of 1256 from GenPept : >gb|AAL23012.1|
FT                   (AE008895) B12-dependent
FT                   homocysteine-N5-methyltetrahydrofolate transmethylase,
FT                   repressor of metE and metF [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83616"
FT                   /db_xref="GOA:A0A3N4AW58"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW58"
FT                   /protein_id="AAM83616.1"
FT                   /translation="MVDTVIDNKVKELHQQLAQRILVLDGGMGTMIQSYRLEEADYRGA
FT                   RFADWASDLKGNNDLLVLSKPEVITAIHNAYLEAGADILETNTFNSTSIAMADYQMASL
FT                   SAEINYEAARLARICADEWSARTPEKPRYVAGVLGPTNRTASISPKVNDPAFRNVSFDQ
FT                   LVEAYRESTRALIEGGVDLIMIETVFDTLNAKAATFAVESEFEVMGVLLPVMISGTITD
FT                   ASGRTLSGQTTEAFYNSLRHVKPLSFGLNCALGPDELRQYVAELSRISEYYVSAHPNAG
FT                   LPNAFGEYDLEAKEMAEQIGEWARAGFLNIVGGCCGTTPRHIAAMVNAVAGVPPRPLPD
FT                   IPVACRLAGLEPLTIDANTLFVNVGERTNVTGSARFKRLIKEEKYGEALDVARQQVESG
FT                   AQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSRWDVIEKGLKCIQGKGI
FT                   VNSISMKEGVDAFIHHAKLVRRYGAAMVVMAFDETGQADTRARKIEICRRAYKILTETV
FT                   GFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEACADIKAELPHALISGGVSNVSFSFRG
FT                   NDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLSDELRDAVEDVILNRRDDSTER
FT                   LLDLAEKYRDSKSGEVAIQQAEWRGWPVVKRLEYSLVKGITEFIELDTEEARQQADRPI
FT                   EVIEGPLMSGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPYIEASKQKGTTAGKI
FT                   LLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPTEKILRTAREEKVDIIGLSGLIT
FT                   PSLDEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGSTTYVSNASRSVGVV
FT                   SALLSDTQREAFVAKTRKEYETVRIQHARKKPRTPPVSLQAARNNPTVIDWENYTPPVA
FT                   HKLGVQVVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLLADANALLD
FT                   KLSAEDLLHPKGVVGLFPANSVGDDIEIYRDERRDEVLAISYHLRQQTEKTDFPNYCLA
FT                   DYVAPKSSGKADYFGAFAVTGGLEEDALADAYDAQHDDYNKIMIKALSDRLAEAFAEYL
FT                   HERVRKVYWGFAPNENLSNEELVRENYQGIRPAPGYPACPEHTEKGQIWQLLDVETHTG
FT                   MKLTESYAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVEDYAARKGMPTAEVERWLAPN
FT                   LGYDAD"
FT   gene            complement(29211..34175)
FT                   /gene="hylA"
FT                   /locus_tag="y0021"
FT   CDS_pept        complement(29211..34175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hylA"
FT                   /locus_tag="y0021"
FT                   /product="hemolysin precursor"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 20 to 1651 of 1654 are 42.08 pct identical
FT                   to residues 1 to 1604 of 1608 from GenPept :
FT                   >gb|AAA50323.1| (M22618) hemolysin [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83617"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1U2"
FT                   /protein_id="AAM83617.1"
FT                   /translation="MRTPCYSYQEISPQNGDVKMKKHTFKLSPAGKLAAAVTIISVSVA
FT                   TCYAAGIVGAGDSAHKPDVSSVNGTSVINIVQPSASGLSHNQFQDFNVGEKGAVLNNAT
FT                   SAGNSILAGQLAANQNLNGQAASIILNEVISRNPSLLLGQQEIFGMTADYILANPNGIT
FT                   CNGCGFMNTNRESLVVGNPLIEQGSLKGFETFNNNNWLIIQDKGLTANKILDLIAPRIE
FT                   VTGMVTSTEAINALSGNNQISTDGQILESRQEDHPNRPTSLGGWFSSLFSSESEESIDG
FT                   KYLGSMQSGRINLVSTREGSGVKIAGSLNGSEEINATIKGKLQLEAAKLGGNDININAN
FT                   SIQAFGNLHKNEDNGGVTQSLERTQLKGKNIAIVANKKNQLSAVKIDADNVTLRGGELV
FT                   LDERILTKTEQESSSDGGNGVLGLGKWNWSENKEEKQQTSIGTTITAKNNASLESTQDD
FT                   IKLSAATITAGKNLAIKAKKDLHIDGAIEENSIHDYGHNYKHMVKDESWNNKTTKQTLN
FT                   KTTLEAGKNLGLTAENKITTQGIKASAGGDVVIDANDVKIGVQKTSNQETTDGKHERNL
FT                   GLGGVDHNNNDKYAETSHSSEITADGNILISVKDDVAITGSKVKATKDGFVQAKEGGIK
FT                   IDNAISTTTNKVDERTGVAFDITGSSKKANNSEEKSTGSEVVSEANLKIISKKDVDVIG
FT                   SLVKSAGELGIETLGDINVAAAQEKQKIDEQKTLLTIDGFTSDDGKNQYQAGLKVEHTS
FT                   ESEKTEKVINHGSTLEGGTVKLEADKDVTFTGSQLNTTKGDADITAENVSFVAAQDTTT
FT                   SNKEKETVGVNAHYTGGMDKAGSGAGVSYEETKTDSEKSTAVVSHTDVKGDLNLNAKQE
FT                   ITNQGTDHNVEGSYAANATNVNNLAAENSETTTTTTNTVDVKYGGNIAYDGVTRPVEKT
FT                   IESGKKLDVGGVIENVGNVAPDSVNAGVDLSVNVGEKENKSSNSQAVVTSIKSGDISIT
FT                   AKEDVKDQGTHYQADKGGIKIDAANHTFESAVNRAEESEKVVSGGVDMRIYTTTGEDIN
FT                   VDAKGKGENKQQEVKAEQAQTGSMKAVGDIIINVQENARYQGTDLDSGDGKIAITAGEE
FT                   IKFEQATSHLSENHNKIDANAKANFGTKPNSKDFGGGLGGGHSQGSTSADIAQVSHLHG
FT                   KQGIELNAGKDLTLQGTEFGSKNAATGDVQLTAGGKVDFQAAQSQSSKQDMTWSASVKA
FT                   GKSKSNSTSENDDGTKTHTNNKGFSAGAEANVKNTDETSLTHQGGIINSNGAVTIKADG
FT                   KDQQAIHLQNTNIISQETILNADNGGIVMESAQDKEHKNNWNVNTNLNGSQKNTIKSDD
FT                   QGVVDKDSAKKIHNAAIKLDGGVDKLDSVTQQNTHINSDKVTLNSAKNTELAGAVLQAN
FT                   QISGQIGGDLNVISRENRLNKVNVSAALGGSHSNAKQDSLISQVANASPIMSDKIKNKL
FT                   EEKSTKIFDKVENKFNTLGKEKDDSVQTISYTKDGQTVKISEADEKKETKDKWWQKGAK
FT                   SVGKKIKSAVQDEQVVGGNGSVKANVEVVESQGVEEQSAIRGTQNVDLTVKGKTDLVGG
FT                   KISSKNSDVKLKTNGLETQDINGKYTEGGARLNASSSVMDMISDGAKDVMDGKAPLVSG
FT                   HGKSEQKNATGGITRE"
FT   gene            complement(34188..35964)
FT                   /pseudo
FT                   /locus_tag="y0022"
FT                   /note="hylB; disrupted by frameshift"
FT   gene            complement(36445..37830)
FT                   /gene="lysC"
FT                   /locus_tag="y0023"
FT   CDS_pept        complement(36445..37830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="y0023"
FT                   /product="aspartokinase III, lysine sensitive"
FT                   /function="enzyme; amino acid biosynthesis: Lysine"
FT                   /note="residues 14 to 461 of 461 are 81.47 pct identical to
FT                   residues 2 to 449 of 449 from E. coli K12 : B4024; residues
FT                   14 to 461 of 461 are 81.47 pct identical to residues 2 to
FT                   449 of 449 from GenPept : >gb|AAG59223.1|AE005635_3
FT                   (AE005635) aspartokinase III, lysine sensitive [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83618"
FT                   /db_xref="GOA:A0A3N4BA44"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA44"
FT                   /protein_id="AAM83618.1"
FT                   /translation="MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDV
FT                   RLVILSASAGITNLLVALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRML
FT                   ENIAMLSEAASLATSPALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDR
FT                   FGRAEPDTSALAELAQTLLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGE
FT                   ALNVSRIDIWTDVPGIYTTDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVR
FT                   SDIPMFVGSSKDPAAGGTLVCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEV
FT                   FNILARHSISVDLITTSEVSVALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLA
FT                   LVAIIGNNLSQACGVGKEVFGVLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYN
FT                   LFE"
FT   gene            38200..39846
FT                   /gene="pgi"
FT                   /locus_tag="y0024"
FT   CDS_pept        38200..39846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="y0024"
FT                   /product="glucosephosphate isomerase"
FT                   /function="enzyme; energy metabolism, carbon: Glycolysis"
FT                   /note="residues 1 to 548 of 548 are 87.40 pct identical to
FT                   residues 1 to 548 of 549 from E. coli K12 : B4025; residues
FT                   1 to 548 of 548 are 87.40 pct identical to residues 1 to
FT                   548 of 549 from GenPept : >gb|AAG59224.1|AE005635_4
FT                   (AE005635) glucosephosphate isomerase [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83619"
FT                   /db_xref="GOA:Q8ZAS2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAS2"
FT                   /protein_id="AAM83619.1"
FT                   /translation="MKNINPSQTAAWKALQQHFEQMKDVTISSLFAKDDQRFNRFSATF
FT                   DDQMLVDFSKNRITSETLEKLQDLAKETDLAGAIKSMFSGEKINRTEDRAVLHIALRNR
FT                   SNTPIVVDGKDVMPEVNAVLAKMKQFCDRVISGDWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEALKPLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLSAAGDPAHVAKHFAALSTNAKAVGEFGIDTNNMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSVGFEHFEQLLSGAHAMDKHFAETPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGHPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLSDHHAKLLSNFFAQTEALAFGKSLEDVEAEFAAAGKTPEQVAHVA
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIYTFDQWGVELGKQLA
FT                   NRILPELADDQEVTSHDSSTNALINRFKNWR"
FT   gene            39981..40388
FT                   /locus_tag="y0025"
FT   CDS_pept        39981..40388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0025"
FT                   /product="hypothetical protein"
FT                   /note="residues 6 to 135 of 135 are 67.69 pct identical to
FT                   residues 8 to 136 of 136 from E. coli K12 : B4030"
FT                   /db_xref="EnsemblGenomes-Gn:y0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83620"
FT                   /db_xref="GOA:Q8ZAS3"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAS3"
FT                   /protein_id="AAM83620.1"
FT                   /translation="MAKNSRSQWIAKNLQRLLNVGLIMLAAILVVFLVKETIHLGKVLF
FT                   LSNQETSSYMLIEGIVIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ENPIDTLIYSGSILVLVVTLYLANTERLKRE"
FT   gene            complement(40531..41442)
FT                   /gene="malG"
FT                   /locus_tag="y0026"
FT   CDS_pept        complement(40531..41442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="y0026"
FT                   /product="inner membrane permease of maltose/maltodextran
FT                   ABC transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 8 to 303 of 303 are 88.17 pct identical to
FT                   residues 1 to 296 of 296 from E. coli K12 : B4032; residues
FT                   8 to 303 of 303 are 90.87 pct identical to residues 1 to
FT                   296 of 296 from GenPept : >gb|AAL23051.1| (AE008897) ABC
FT                   superfamily (membrane), maltose transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83621"
FT                   /db_xref="GOA:Q74RF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74RF8"
FT                   /protein_id="AAM83621.1"
FT                   /translation="MTKEEMQMAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAIS
FT                   LRPGNFATGSLIPDQISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAM
FT                   GIVALSTTCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGL
FT                   NTHGGVIFAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPIL
FT                   AVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPI
FT                   TTVFLLAQRWLVGGLTAGGVKG"
FT   gene            complement(41435..43027)
FT                   /gene="malF"
FT                   /locus_tag="y0027"
FT   CDS_pept        complement(41435..43027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="y0027"
FT                   /product="inner membrane permease of maltose ABC
FT                   transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 18 to 530 of 530 are 75.43 pct identical to
FT                   residues 5 to 514 of 514 from E. coli K12 : B4033"
FT                   /db_xref="EnsemblGenomes-Gn:y0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83622"
FT                   /db_xref="GOA:Q74RF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74RF9"
FT                   /protein_id="AAM83622.1"
FT                   /translation="MKGNIMQLSHTELQSRKKKIAWWQSDALKWLVISLLSLFTCYLIV
FT                   LMYAQGEYLFAIVTLILVSLGLYVFANRRAYAWRYVYPGVAGMGLFVLFPLICTIAIAF
FT                   TNYSSTNQLTFERAQSVLLDRQFQTGKTFTFGLYPSDNQWRLQLTNPDDGSLFISEPFS
FT                   FEATGEQKVMVAPTNTAQTSEPASLRIITQSRQALSSLVAILPDGAELRMSSLRQFSGT
FT                   KPLYTLGADGKELINQQTGVKYWPNPSTGFYQAVNADGQWENEKLSPGFTVSIGWKNFL
FT                   RVLHDEGIQKPFISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILP
FT                   YAVPSFISILIFKGLFNQSFGEINLMLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPY
FT                   MMILCMGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMIASFAFNFNNFV
FT                   LIQLLTNGGPDMIGTSTPAGYTDLLVNYTYRVAFEGEGGQDFGLAAAIATLIFILVGAL
FT                   AILNLKASKMNFD"
FT   gene            complement(43199..44410)
FT                   /gene="malE"
FT                   /locus_tag="y0028"
FT   CDS_pept        complement(43199..44410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="y0028"
FT                   /product="periplasmic maltose-binding protein"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="substrate recognition for ABC transporter and
FT                   chemotaxis; residues 14 to 403 of 403 are 84.61 pct
FT                   identical to residues 7 to 396 of 396 from E. coli K12 :
FT                   B4034; residues 7 to 403 of 403 are 84.13 pct identical to
FT                   residues 4 to 396 of 396 from GenPept : >emb|CAD09213.1|
FT                   (AL627282) periplasmic maltose-binding protein [Salmonella
FT                   enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83623"
FT                   /db_xref="GOA:A0A3N4BJ83"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJ83"
FT                   /protein_id="AAM83623.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITGRQTVEAALNDAAT
FT                   RITK"
FT   gene            44888..45250
FT                   /locus_tag="y0030"
FT   CDS_pept        44888..45250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0030"
FT                   /product="hypothetical"
FT                   /note="residues 9 to 49 of 120 are 36.58 pct identical to
FT                   residues 24 to 64 of 604 from GenPept :
FT                   >gb|AAK27723.1|AF358444_1 (AF358444) alpha-glucosidase
FT                   [Bifidobacterium adolescentis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83624"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX1"
FT                   /protein_id="AAM83624.1"
FT                   /translation="MLSARSIPNPALYRIHPVSFRDGQGNGVGDYRGLNGVCDSLLPCW
FT                   ISMLRRCSTCSPILRPRRRPGQPCHWLGGTARSERVIRALGVINGSCRGLLPLFFFIQI
FT                   HMKSCLRKQRSNAWLM"
FT   gene            44998..45234
FT                   /locus_tag="y0029"
FT   CDS_pept        44998..45234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0029"
FT                   /product="hypothetical"
FT                   /note="residues 33 to 76 of 78 are 34.78 pct identical to
FT                   residues 399 to 444 of 933 from GenPept :
FT                   >gb|AAG51093.1|AC025295_1 (AC025295) auxin response factor
FT                   6 (ARF6) [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW88"
FT                   /protein_id="AAM83625.1"
FT                   /translation="MRLIITLLDQYVEALFNVQPYTQAATPSGATLPLAWRHGAQRESH
FT                   QGTGGNQWVMPGFASTVFLHSDSYEKLFAQAKE"
FT   gene            45238..46347
FT                   /gene="malK"
FT                   /locus_tag="y0031"
FT   CDS_pept        45238..46347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="y0031"
FT                   /product="ATP-binding component of ABC transport system for
FT                   maltose"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 1 to 369 of 369 are 84.90 pct identical to
FT                   residues 1 to 371 of 371 from E. coli K12 : B4035; residues
FT                   1 to 369 of 369 are 84.55 pct identical to residues 1 to
FT                   369 of 369 from GenPept : >gb|AAL23054.1| (AE008897)
FT                   bifunctional: ABC superfamily (atp_bind), maltose
FT                   transportprotein; phenotypic repressor of mal operon
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83626"
FT                   /db_xref="GOA:Q8ZAS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAS8"
FT                   /protein_id="AAM83626.1"
FT                   /translation="MANVTLSSVYKAFGEAVISRDINLEIDDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELLIGGKRMNEVPPSERGIGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   VKKAEIYQRVNQVAEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVSEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLERTMIYVTHDQVEAMTLADKIVVLDAGNIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAAEPRQVQIELPNHQRVWLPVEGDQVQVGANMSL
FT                   GIRPEHLLPSSASEVTLEGEIQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FSIGLPPHRCHLFREDGTACKRLYQELGV"
FT   gene            46250..47689
FT                   /gene="lamB"
FT                   /locus_tag="y0032"
FT   CDS_pept        46250..47689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lamB"
FT                   /locus_tag="y0032"
FT                   /product="maltose high-affinity receptor"
FT                   /function="transport of small molecules; carbohydrates,
FT                   organic acids, alcohols"
FT                   /note="defective for phage lambda uptake; residues 83 to
FT                   475 of 479 are 87.96 pct identical to residues 2 to 400 of
FT                   400 from GenPept : >gb|AAA70348.1| (U16150) maltoporin
FT                   [Yersinia enterocolitica]"
FT                   /db_xref="EnsemblGenomes-Gn:y0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83627"
FT                   /db_xref="GOA:Q8ZAS9"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAS9"
FT                   /protein_id="AAM83627.1"
FT                   /translation="MQHSPSVCHRIGVTSSVRMALHVSGCTKNWASSYGDAWLQRMKAR
FT                   MPTGKYNRRLLMITLRKLPIALAVAAGVLSTQAMAVDFHGYARSGIGWTASGGEQQCFQ
FT                   TTGAQSKYRLGNECETYAELKLGQELWKEGDKSFYLDTNVAYSVSQRDDWESTDPAFRE
FT                   ANVQGKNLIESLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLETIDLGFGKLSVA
FT                   ATRNSESGGSSAWIDNQRENAKYTINNVYDVRLAGLETNPGGSLELGVDYGRADTQEGY
FT                   SLAPNASKDGVMLTAEHTQSLMGGFNKFVVQYATDSMTSYNTGHSQGTSVNNNGHLLRV
FT                   IDHGAINLAEKWDMMYVALYQDIDLDNNNGNTWYSVGVRPMYKWTPIMSTLLEAGYDNV
FT                   KSQHTGERNGQYKLTLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYSDTTGVAQDGTI
FT                   GTNSRGKNNEVTFGAQFEAWW"
FT   gene            47912..48841
FT                   /gene="malM"
FT                   /locus_tag="y0033"
FT   CDS_pept        47912..48841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /locus_tag="y0033"
FT                   /product="periplasmic protein of mal regulon"
FT                   /function="phenotype; degradation of small molecules;
FT                   Carbon compounds"
FT                   /note="residues 7 to 309 of 309 are 51.80 pct identical to
FT                   residues 3 to 306 of 306 from E. coli K12 : B4037; residues
FT                   7 to 309 of 309 are 50.98 pct identical to residues 3 to
FT                   305 of 305 from GenPept : >gb|AAL23056.1| (AE008898)
FT                   periplasmic protein of mal regulon [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83628"
FT                   /db_xref="GOA:A0A0H2W7X3"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W7X3"
FT                   /protein_id="AAM83628.1"
FT                   /translation="MYEGITMKKNLLSLCLVLALGGTAPLAVQAASTISPANVSIAPTI
FT                   STTTLQQLPWQPLVPPVTQDIQLTAGSPHISQGEVEGAVAAFALPADRGSLEVTLSSLL
FT                   TDKQLFTPSVLVLDEQMRPAAYYPSSYFTYEKAGIMINDRLQGVMKLTPALGQKQIYLL
FT                   VYTTRDDLKKTTQLLDPAKAYAQGVGNAVPDIPDPIVNHSPTGTLRIKVTSEQGMGNIM
FT                   IGLIQSAPTSAPVVVGSSIQPVAAPQSEPAKPAAPMLGETENYFNQAIKDAVKAGDVDK
FT                   ALKLLNEAEHLGSTSARKTFIGSVKGKG"
FT   gene            complement(49078..49236)
FT                   /locus_tag="y0034"
FT   CDS_pept        complement(49078..49236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0034"
FT                   /product="hypothetical"
FT                   /note="residues 5 to 52 of 52 are 34.00 pct identical to
FT                   residues 508 to 557 of 597 from GenPept :
FT                   >gb|AAF30492.1|AE002108_5 (AE002108) DNA polymerase III
FT                   gamma-tau subunits [Ureaplasma urealyticum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX0"
FT                   /protein_id="AAM83629.1"
FT                   /translation="MTKKVAIIGVVNLFIDVTHLCINKYCKSFSLCSQIIPIERKPNLN
FT                   VILNKKE"
FT   gene            49240..49590
FT                   /locus_tag="y0035"
FT   CDS_pept        49240..49590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0035"
FT                   /product="hypothetical"
FT                   /note="residues 37 to 95 of 116 are 39.39 pct identical to
FT                   residues 12 to 74 of 476 from GenPept : >emb|CAC05244.1|
FT                   (AL391604) DNAJ domain protein similar to human
FT                   tetratricopeptide repeat protein and protein kinase
FT                   inhibitors [Schizosaccharomyces pombe]"
FT                   /db_xref="EnsemblGenomes-Gn:y0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW9"
FT                   /protein_id="AAM83630.1"
FT                   /translation="MTLNMTGSSLVVEKNPVGNFLKFAMNFPNLLLLFSDGTLIKQVER
FT                   ELKTHLICNEFVKNKSKIVTVYITLGNDALLLIYYSNRVFYKKSYIKCGDIACMNYTVN
FT                   EGYLTTEIILWR"
FT   gene            complement(49742..50260)
FT                   /locus_tag="y0036"
FT   CDS_pept        complement(49742..50260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0036"
FT                   /product="hemolysin co-regulated protein"
FT                   /note="residues 1 to 172 of 172 are 80.23 pct identical to
FT                   residues 1 to 172 of 172 from GenPept :
FT                   >gb|AAG54535.1|AE005199_5 (AE005199) Z0266 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83631"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LA41"
FT                   /protein_id="AAM83631.1"
FT                   /translation="MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFE
FT                   HIVTVPTDPQSGQPSGQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGA
FT                   DDWRAPIEA"
FT   gene            50781..51281
FT                   /locus_tag="y0037"
FT   CDS_pept        50781..51281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="residues 2 to 166 of 166 are 62.65 pct identical to
FT                   residues 1 to 166 of 166 from GenPept :
FT                   >gb|AAG54533.1|AE005199_3 (AE005199) Z0264 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83632"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T9"
FT                   /protein_id="AAM83632.1"
FT                   /translation="MMSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKG
FT                   VREETSIEERQVVSVNKNNFNSVMNEANISLSFNVPNRLEGDGEEDMPVALSIKGLDDF
FT                   SPDNVAKKVPELKKILELREALVALKGPLGNIPAFRSRLQDLLGNEDMREQLLKELDIL
FT                   NQK"
FT   gene            51349..52830
FT                   /locus_tag="y0038"
FT   CDS_pept        51349..52830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0038"
FT                   /product="hypothetical"
FT                   /note="residues 20 to 492 of 493 are 76.95 pct identical to
FT                   residues 19 to 491 of 492 from GenPept : >gb|AAF96022.1|
FT                   (AE004353) conserved hypothetical protein [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83633"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAI2"
FT                   /protein_id="AAM83633.1"
FT                   /translation="MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVA
FT                   AFISSILDTGTNEEPINKLLVDRMIIELDKKLSAQMDEILHANEFREIESSWRSLKLLV
FT                   DRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGFYKHVYSSGYGQFGGEPTAAIIGN
FT                   YAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAH
FT                   TKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAFL
FT                   LASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFEL
FT                   AEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRL
FT                   AHYIKVLQREQIGSWKERQDLERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDV
FT                   EGDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   gene            52837..53277
FT                   /locus_tag="y0039"
FT   CDS_pept        52837..53277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0039"
FT                   /product="hypothetical"
FT                   /note="residues 11 to 140 of 146 are 35.87 pct identical to
FT                   residues 8 to 134 of 137 from GenPept :
FT                   >gb|AAG54530.1|AE005198_11 (AE005198) Z0261 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83634"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFX3"
FT                   /protein_id="AAM83634.1"
FT                   /translation="MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNE
FT                   VLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLN
FT                   HGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET"
FT   gene            53277..54503
FT                   /locus_tag="y0040"
FT   CDS_pept        53277..54503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0040"
FT                   /product="hypothetical"
FT                   /note="residues 4 to 365 of 408 are 49.58 pct identical to
FT                   residues 5 to 367 of 616 from GenPept :
FT                   >gb|AAG54529.1|AE005198_10 (AE005198) Z0260 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83635"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW8"
FT                   /protein_id="AAM83635.1"
FT                   /translation="MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLREKIDDQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVK
FT                   RGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGIL
FT                   SIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDF
FT                   DFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSL
FT                   NLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
FT                   IFSVDRVDSWLSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVI
FT                   MDIFYNVTL"
FT   mobile_element  complement(54361..54622)
FT                   /mobile_element_type="insertion sequence:IS1661"
FT                   /note="insertion element; partial"
FT   gene            complement(54393..54650)
FT                   /locus_tag="y0041"
FT   CDS_pept        complement(54393..54650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0041"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1661 orfB; residues 5 to 84 of 85 are 60.49 pct
FT                   identical to residues 158 to 238 of 240 from GenPept :
FT                   >emb|CAA63547.1| (X92970) orfB [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83636"
FT                   /db_xref="GOA:Q8D1T8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T8"
FT                   /protein_id="AAM83636.1"
FT                   /translation="MDHFSSVVDRIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYD
FT                   SATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   mobile_element  complement(54623..56576)
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            complement(54689..55471)
FT                   /locus_tag="y0042"
FT   CDS_pept        complement(54689..55471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0042"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfB; residues 1 to 260 of 260 are 100.00 pct
FT                   identical to residues 1 to 260 of 260 from GenPept :
FT                   >gb|AAC69770.1| (AF074612) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83637"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM83637.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(55468..56490)
FT                   /locus_tag="y0043"
FT   CDS_pept        complement(55468..56490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0043"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 340 of 340 are 100.00 pct
FT                   identical to residues 1 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83638"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAM83638.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            56560..56985
FT                   /locus_tag="y0044"
FT   CDS_pept        56560..56985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0044"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 6 to 141 of 141 are 100.00 pct
FT                   identical to residues 17 to 152 of 152 from GenPept :
FT                   >gb|AAL27370.1|AF426171_1 (AF426171) transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83639"
FT                   /db_xref="GOA:Q8D1T7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T7"
FT                   /protein_id="AAM83639.1"
FT                   /translation="MHRSLHIVFAPKYRRQVFYREKRRAIGSILRKLCEWKNVNILEAE
FT                   YCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTV
FT                   GKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   mobile_element  56575..57091
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element; partial"
FT   gene            complement(57193..57432)
FT                   /locus_tag="y0045"
FT   CDS_pept        complement(57193..57432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0045"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 79 of 79 are 75.94 pct identical to
FT                   residues 3 to 81 of 81 from E. coli K12 : B3928; residues 1
FT                   to 79 of 79 are 77.21 pct identical to residues 1 to 79 of
FT                   79 from GenPept : >gb|AAL22928.1| (AE008891) putative
FT                   cytoplasmic protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83640"
FT                   /db_xref="GOA:Q7CLC9"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLC9"
FT                   /protein_id="AAM83640.1"
FT                   /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDAA
FT                   GSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
FT   gene            58060..58908
FT                   /gene="glpF"
FT                   /locus_tag="y0046"
FT   CDS_pept        58060..58908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="y0046"
FT                   /product="facilitator for glycerol uptake"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 1 to 282 of 282 are 82.62 pct identical to
FT                   residues 1 to 279 of 281 from E. coli K12 : B3927; residues
FT                   1 to 282 of 282 are 82.62 pct identical to residues 1 to
FT                   279 of 281 from GenPept : >gb|AAG59120.1|AE005623_11
FT                   (AE005623) facilitated diffusion of glycerol [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83641"
FT                   /db_xref="GOA:A0A3N4AWS2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWS2"
FT                   /protein_id="AAM83641.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCAAA
FT                   LVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYLAGWG
FT                   DIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTITTERK
FT                   A"
FT   gene            59085..60608
FT                   /gene="glpK"
FT                   /locus_tag="y0047"
FT   CDS_pept        59085..60608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="y0047"
FT                   /product="glycerol kinase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 7 to 507 of 507 are 84.63 pct identical to
FT                   residues 2 to 502 of 502 from E. coli K12 : B3926; residues
FT                   5 to 507 of 507 are 84.49 pct identical to residues 7 to
FT                   509 of 509 from GenPept : >gb|AAG59119.1|AE005623_10
FT                   (AE005623) glycerol kinase [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83642"
FT                   /db_xref="GOA:A0A0H2W035"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W035"
FT                   /protein_id="AAM83642.1"
FT                   /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIY
FT                   PKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVY
FT                   NAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAER
FT                   GELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPE
FT                   VRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNT
FT                   GEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFAT
FT                   KVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLD
FT                   AMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATG
FT                   FWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
FT   gene            60737..61855
FT                   /gene="glpX"
FT                   /locus_tag="y0048"
FT   CDS_pept        60737..61855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="y0048"
FT                   /product="hypothetical"
FT                   /function="phenotype; Not classified"
FT                   /note="unknown function in glycerol metabolism; residues 37
FT                   to 372 of 372 are 84.22 pct identical to residues 1 to 336
FT                   of 336 from E. coli K12 : B3925; residues 37 to 372 of 372
FT                   are 84.22 pct identical to residues 1 to 336 of 336 from
FT                   GenPept : >dbj|BAA09535.1| (D55718) GlpX [Klebsiella
FT                   aerogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:y0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83643"
FT                   /db_xref="GOA:Q8CLW7"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW7"
FT                   /protein_id="AAM83643.1"
FT                   /translation="MRVKRVQLTPLRLQVRKVIEFLPIFSFSIPQSTGLTMKRELAIEF
FT                   SRVTEAAALAGYKWLGRGDKNAADGAAVQAMRIMLNQVNIDGRIVIGEGEIDEAPMLFI
FT                   GEHVGTGQGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDQGTFLHAPDMYMEKLVVGP
FT                   AAKGAIDLNLPLEQNLCNIATALNKPLADLTVITLAKPRHDGIIAAMQQLGVKVFAIPD
FT                   GDVAASILTCMPESEVDVMYCIGGAPEGVISAAVIRALDGDMQGRLLPRHQVKGDSEDN
FT                   RRIGEQELLRCKSMGIEAGNVLQLGDMARNDNVIFSATGITKGDLLEGIYRKGNMATTE
FT                   TLLIRGKSRTIRRIRSTHFLDRKDPALHEFLL"
FT   gene            62010..62756
FT                   /gene="fpr"
FT                   /locus_tag="y0049"
FT   CDS_pept        62010..62756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="y0049"
FT                   /product="ferredoxin-NADP reductase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 1 to 248 of 248 are 74.19 pct identical to
FT                   residues 1 to 248 of 248 from E. coli K12 : B3924; residues
FT                   1 to 248 of 248 are 77.01 pct identical to residues 1 to
FT                   248 of 248 from GenPept : >gb|AAL22924.1| (AE008890)
FT                   ferredoxin-NADP reductase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83644"
FT                   /db_xref="GOA:A0A3N4BAQ9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAQ9"
FT                   /protein_id="AAM83644.1"
FT                   /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDING
FT                   ERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMVRDTQ
FT                   QLLKEQREMRKHLRRKPGHMTSEQYW"
FT   gene            complement(63097..63597)
FT                   /locus_tag="y0050"
FT   CDS_pept        complement(63097..63597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0050"
FT                   /product="hypothetical protein"
FT                   /note="residues 23 to 163 of 166 are 66.66 pct identical to
FT                   residues 1 to 141 of 146 from E. coli K12 : B3921"
FT                   /db_xref="EnsemblGenomes-Gn:y0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83645"
FT                   /db_xref="GOA:Q8D1T5"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T5"
FT                   /protein_id="AAM83645.1"
FT                   /translation="MVSCDLEVHFAEIMLGKWICSSMTIQQWCFSFKGRIGRREFWIWM
FT                   GLWLLAMLVIFTLAGKEWLPIQSASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLA
FT                   WMLMAGNWQMLTPIWQWGVGRFIPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFAD
FT                   KAK"
FT   gene            63700..64314
FT                   /locus_tag="y0051"
FT   CDS_pept        63700..64314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0051"
FT                   /product="hypothetical protein"
FT                   /note="residues 11 to 204 of 204 are 56.18 pct identical to
FT                   residues 10 to 193 of 199 from E. coli K12 : B3920;
FT                   residues 10 to 203 of 204 are 57.21 pct identical to
FT                   residues 7 to 192 of 198 from GenPept : >gb|AAL22922.1|
FT                   (AE008890) putative periplasmic protein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83646"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T4"
FT                   /protein_id="AAM83646.1"
FT                   /translation="MRIILLLAALLLITFMLITTINHAHADPTNDSSPPKEGAPPIAPY
FT                   LLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKINENLYASTA
FT                   LEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVVQSLANVQKLLT
FT                   EGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   gene            64443..65210
FT                   /gene="tpiA"
FT                   /locus_tag="y0052"
FT   CDS_pept        64443..65210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="y0052"
FT                   /product="triosephosphate isomerase"
FT                   /function="enzyme; energy metabolism, carbon: Glycolysis"
FT                   /note="residues 1 to 255 of 255 are 82.35 pct identical to
FT                   residues 1 to 255 of 255 from E. coli K12 : B3919; residues
FT                   1 to 255 of 255 are 84.70 pct identical to residues 1 to
FT                   255 of 255 from GenPept : >gb|AAD16183.1| (AF098509) triose
FT                   phosphate isomerase [Enterobacter cloacae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83647"
FT                   /db_xref="GOA:Q8ZJK9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJK9"
FT                   /protein_id="AAM83647.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQE
FT                   SDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
FT   gene            complement(65442..66737)
FT                   /locus_tag="y0053"
FT   CDS_pept        complement(65442..66737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0053"
FT                   /product="putative transcriptional regulator"
FT                   /function="regulator"
FT                   /note="residues 28 to 405 of 431 are 30.26 pct identical to
FT                   residues 4 to 358 of 383 from GenPept : >emb|CAB87565.1|
FT                   (AJ277295) FldY protein [Sphingomonas sp. LB126]"
FT                   /db_xref="EnsemblGenomes-Gn:y0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83648"
FT                   /db_xref="GOA:Q8D1T3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T3"
FT                   /protein_id="AAM83648.1"
FT                   /translation="MPKRQVLFKLKKLNKITRRNMQKKNDRNSIKIMQIRAFCMTAEQG
FT                   AASLAALNLFRTQSAITRSIRDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEEL
FT                   TRIPALLRRLQQRDDEGIEDLEPTWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVS
FT                   AALKVLEKGAGMYLFHRTPKGMLPTPAGHEIAPCISRALNALHHIPEEITAHRGDLTGS
FT                   VRVGALPLSRARLLPQAMIKLISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNE
FT                   KMLLDIHSEILFEEELILLARPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFC
FT                   KMGLASPQPVVESGDPAVVRALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRRE
FT                   IGLMTRQKALNSPATDALINCVREVIQSSNDK"
FT   gene            66730..67551
FT                   /locus_tag="y0054"
FT   CDS_pept        66730..67551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0054"
FT                   /product="hypothetical"
FT                   /note="residues 34 to 272 of 273 are 65.41 pct identical to
FT                   residues 3 to 238 of 244 from GenPept : >emb|CAC46343.1|
FT                   (AL591788) conserved hypothetical protein [Sinorhizobium
FT                   meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83649"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW6"
FT                   /protein_id="AAM83649.1"
FT                   /translation="MGNKTHYFPLIKPCQNPRQLKQQKKEKDMAMIPQKTALVVSAHSA
FT                   DFVWRAGGAIALHVEQGYQVHIVCLSYGERGESAKLWRKGDMTEERVKASRHTEAQAAA
FT                   NVLGASIEFFDMGDYPLRADKESLFRLADVFRRIQPHFVLTHSLADPYNYDHPLAANLA
FT                   QEARIIAQAEGYRPGEAIIGAPPVYCFEPHQPEQCGWKPDVLLDITSVWEKKYAAIQCM
FT                   AGQEHLWEYYTRVALQRGVQAKRNIGIASTKTIIHGEGYQSLFPRVTEDLS"
FT   gene            67548..68261
FT                   /locus_tag="y0055"
FT   CDS_pept        67548..68261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0055"
FT                   /product="hypothetical"
FT                   /note="residues 6 to 229 of 237 are 61.60 pct identical to
FT                   residues 1 to 224 of 224 from GenPept : >emb|CAB87566.1|
FT                   (AJ277295) FldZ protein [Sphingomonas sp. LB126]"
FT                   /db_xref="EnsemblGenomes-Gn:y0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83650"
FT                   /db_xref="GOA:A0A380PI68"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PI68"
FT                   /protein_id="AAM83650.1"
FT                   /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLDE
FT                   RIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDLLA
FT                   TSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAGQLV
FT                   NPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMRAPLA
FT                   KKGLRYVNSLNALKS"
FT   gene            68327..69754
FT                   /locus_tag="y0056"
FT   CDS_pept        68327..69754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0056"
FT                   /product="putative membrane pump protein"
FT                   /note="residues 2 to 471 of 475 are 52.20 pct identical to
FT                   residues 3 to 471 of 477 from E. coli K12 : B0770; residues
FT                   2 to 471 of 475 are 52.20 pct identical to residues 3 to
FT                   471 of 477 from GenPept : >gb|AAG55099.1|AE005254_11
FT                   (AE005254) putative membrane pump protein [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83651"
FT                   /db_xref="GOA:A0A3N4AWR9"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWR9"
FT                   /protein_id="AAM83651.1"
FT                   /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICGL
FT                   ILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGRRI
FT                   AFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEPGDT
FT                   AKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMVVPGL
FT                   LLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLGWALPS
FT                   LLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGIIGLASAL
FT                   SKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAMLPVFLTVG
FT                   KVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGAVIATVCFI
FT                   VTMTVGYVWWQFLGFVK"
FT   gene            69830..70648
FT                   /gene="modA"
FT                   /locus_tag="y0057"
FT   CDS_pept        69830..70648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="y0057"
FT                   /product="molybdate-binding periplasmic protein precursor"
FT                   /function="putative transport; transport of small
FT                   molecules; Other"
FT                   /note="residues 48 to 271 of 272 are 55.55 pct identical to
FT                   residues 5 to 229 of 230 from GenPept : >dbj|BAB21454.2|
FT                   (AB050935) ProX protein [Pseudomonas straminea]"
FT                   /db_xref="EnsemblGenomes-Gn:y0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83652"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T2"
FT                   /protein_id="AAM83652.1"
FT                   /translation="MACLLAQYNSGDILMKYSNVIVSGLCMSMVSLATAAPTEVPSDEP
FT                   VTLRIISSMATRQFLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDVVILSANA
FT                   IDKLIDSGKILPNSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPS
FT                   GVYLTEVFEHWGIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFLQLSELLHLKGIIILG
FT                   PLPTDIQIMTHFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEPI"
FT   gene            complement(70898..71920)
FT                   /gene="sbp"
FT                   /locus_tag="y0058"
FT   CDS_pept        complement(70898..71920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="y0058"
FT                   /product="periplasmic sulfate-binding protein of
FT                   sulfate/thiosulfate ABC transporter"
FT                   /function="transport; transport of small molecules; anions"
FT                   /note="residues 12 to 340 of 340 are 83.58 pct identical to
FT                   residues 1 to 329 of 329 from E. coli K12 : B3917"
FT                   /db_xref="EnsemblGenomes-Gn:y0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83653"
FT                   /db_xref="GOA:Q8D1T1"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T1"
FT                   /protein_id="AAM83653.1"
FT                   /translation="MITIIFLRSGSMRKWGVGLSLLVLASGAMAKDIQLLNVSYDPTRE
FT                   FYQEYNQAFSKYWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAE
FT                   RGRIDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGA
FT                   RWNYLAAWGYALEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAW
FT                   ENEALLAVNEVGNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTRDVADAYLKYLYSPEG
FT                   QTIAAKNYYRPRDPVVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR
FT                   "
FT   gene            complement(72108..73091)
FT                   /gene="pfkA"
FT                   /locus_tag="y0059"
FT   CDS_pept        complement(72108..73091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="y0059"
FT                   /product="6-phosphofructokinase I"
FT                   /function="enzyme; energy metabolism, carbon: Glycolysis"
FT                   /note="residues 1 to 327 of 327 are 77.06 pct identical to
FT                   residues 1 to 320 of 320 from E. coli K12 : B3916; residues
FT                   1 to 327 of 327 are 79.20 pct identical to residues 1 to
FT                   320 of 320 from GenPept : >gb|AAD16179.1| (AF098509)
FT                   phosphofructokinase [Enterobacter cloacae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83654"
FT                   /db_xref="GOA:Q8ZJL6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL6"
FT                   /protein_id="AAM83654.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGL
FT                   YENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAI
FT                   TEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDH
FT                   DYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   gene            complement(73309..74211)
FT                   /locus_tag="y0060"
FT   CDS_pept        complement(73309..74211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0060"
FT                   /product="putative efflux permease protein"
FT                   /function="putative transport"
FT                   /note="residues 1 to 293 of 300 are 78.49 pct identical to
FT                   residues 1 to 293 of 300 from E. coli K12 : B3915; residues
FT                   1 to 293 of 300 are 79.86 pct identical to residues 1 to
FT                   293 of 300 from GenPept : >gb|AAL22901.1| (AE008889)
FT                   putative CDF family transport protein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83655"
FT                   /db_xref="GOA:Q8ZJL7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL7"
FT                   /protein_id="AAM83655.1"
FT                   /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRH
FT                   LASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGA
FT                   ILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIV
FT                   TSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVL
FT                   IHQDPCSVVPKERHAHWEL"
FT   gene            74583..74705
FT                   /locus_tag="y0061"
FT   CDS_pept        74583..74705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0061"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="unidentified IS; residues 2 to 37 of 40 are 47.22
FT                   pct identical to residues 89 to 124 of 253 from GenPept :
FT                   >emb|CAC35348.1| (AJ277063) putative transposase [Vibrio
FT                   salmonicida]"
FT                   /db_xref="EnsemblGenomes-Gn:y0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T0"
FT                   /protein_id="AAM83656.1"
FT                   /translation="MIFIDDNIIRTHQHGTGAVSESDESIKKHRGVTRQKLISR"
FT   gene            complement(74773..75732)
FT                   /locus_tag="y0062"
FT   CDS_pept        complement(74773..75732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0062"
FT                   /product="hypothetical protein"
FT                   /note="residues 15 to 314 of 319 are 56.00 pct identical to
FT                   residues 4 to 287 of 292 from E. coli K12 : B3411; residues
FT                   16 to 319 of 319 are 62.01 pct identical to residues 6 to
FT                   313 of 313 from GenPept : >gb|AAL23539.1| (AE006471)
FT                   putative cytoplasmic protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83657"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKL8"
FT                   /protein_id="AAM83657.1"
FT                   /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLPP
FT                   ELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHMAF
FT                   RLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQLYCG
FT                   NFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTEDQLKS
FT                   AINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVEGRVEG
FT                   AQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
FT   gene            complement(75777..75953)
FT                   /locus_tag="y0063"
FT   CDS_pept        complement(75777..75953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0063"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83658"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW5"
FT                   /protein_id="AAM83658.1"
FT                   /translation="MPSLLASTLQISPLYECINVLTDAVTINNQETDIQQLVACKHYRV
FT                   ALMRTHAAPKSPQ"
FT   gene            75932..76039
FT                   /locus_tag="y0064"
FT   CDS_pept        75932..76039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0064"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 33 of 35 are 51.51 pct identical to
FT                   residues 230 to 262 of 326 from GenPept : >emb|CAB54522.1|
FT                   (AJ245959) Int protein [Bacteriophage WPhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83659"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW4"
FT                   /protein_id="AAM83659.1"
FT                   /translation="MKQEVKANASGKLFNMDYGKFGETQRNVKPDLPHG"
FT   gene            76049..76252
FT                   /locus_tag="y0065"
FT   CDS_pept        76049..76252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0065"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 56 of 67 are 80.35 pct identical to
FT                   residues 269 to 324 of 326 from GenPept : >emb|CAB54522.1|
FT                   (AJ245959) Int protein [Bacteriophage WPhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83660"
FT                   /db_xref="GOA:Q8CLW3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW3"
FT                   /protein_id="AAM83660.1"
FT                   /translation="MLRHTCASHFMMNSRNIIALQQILRHANIQPTMAYAHLAPDYLQN
FT                   TVILTPLKGGLAAETRPQSVHT"
FT   gene            complement(76410..76898)
FT                   /locus_tag="y0066"
FT   CDS_pept        complement(76410..76898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0066"
FT                   /product="putative solute-binding periplasmic protein of
FT                   ABC transpoter"
FT                   /note="residues 51 to 162 of 162 are 62.50 pct identical to
FT                   residues 1 to 112 of 122 from E. coli K12 : B3914; residues
FT                   1 to 162 of 162 are 52.46 pct identical to residues 1 to
FT                   156 of 166 from GenPept : >gb|AAL22900.1| (AE008889)
FT                   periplasmic repressor of cpx regulon by interaction with
FT                   CpxA, rescue from transitory stresses [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83661"
FT                   /db_xref="GOA:A0A3N4AZG7"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZG7"
FT                   /protein_id="AAM83661.1"
FT                   /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGD
FT                   RGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDREAMHKLITADKFDEAAVRAQ
FT                   AEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK"
FT   gene            77048..77770
FT                   /gene="cpxR"
FT                   /locus_tag="y0067"
FT   CDS_pept        77048..77770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="y0067"
FT                   /product="transcriptional regulator in 2-component system"
FT                   /function="putative regulator"
FT                   /note="residues 9 to 238 of 240 are 90.43 pct identical to
FT                   residues 1 to 230 of 232 from E. coli K12 : B3912"
FT                   /db_xref="EnsemblGenomes-Gn:y0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83662"
FT                   /db_xref="GOA:Q8D1S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S9"
FT                   /protein_id="AAM83662.1"
FT                   /translation="MRQRGEITMHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQA
FT                   LSQLDSSIDLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADD
FT                   YLAKPFNDRELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPL
FT                   ELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDG
FT                   LPWFKTLRGRGYLMVSET"
FT   gene            77767..79143
FT                   /gene="cpxA"
FT                   /locus_tag="y0069"
FT   CDS_pept        77767..79143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="y0069"
FT                   /product="probable sensor protein, histidine protein
FT                   kinase"
FT                   /function="putative regulator; global regulatory functions"
FT                   /note="acting on arcA; residues 1 to 454 of 458 are 80.83
FT                   pct identical to residues 1 to 454 of 457 from E. coli K12
FT                   : B3911"
FT                   /db_xref="EnsemblGenomes-Gn:y0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83663"
FT                   /db_xref="GOA:A0A380PI87"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PI87"
FT                   /protein_id="AAM83663.1"
FT                   /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQRQ
FT                   GTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQM
FT                   VRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGP
FT                   WPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
FT                   "
FT   gene            complement(78938..79090)
FT                   /locus_tag="y0068"
FT   CDS_pept        complement(78938..79090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0068"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83664"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW2"
FT                   /protein_id="AAM83664.1"
FT                   /translation="MGYLRLLPTLDADSPRFQQLPGPILFLPTPDLGLHLYDKMAGIFV
FT                   HGPLG"
FT   gene            complement(79192..80256)
FT                   /gene="ada"
FT                   /locus_tag="y0070"
FT   CDS_pept        complement(79192..80256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="y0070"
FT                   /product="O6-methylguanine-DNA methyltransferase;
FT                   transcription activator/repressor"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 6 to 350 of 354 are 52.75 pct identical to
FT                   residues 10 to 353 of 354 from E. coli K12 : B2213;
FT                   residues 6 to 345 of 354 are 65.58 pct identical to
FT                   residues 18 to 357 of 360 from GenPept : >emb|CAD16277.1|
FT                   (AL646070) probable ADA regulatory of adaptative response
FT                   contains: methylated-DNA--protein-cysteine
FT                   methyltransferase EC 2.1.1.63 O-6-methylguanine-DNA
FT                   transcription regulator[Ralstonia solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83665"
FT                   /db_xref="GOA:A0A3N4BK88"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BK88"
FT                   /protein_id="AAM83665.1"
FT                   /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKA
FT                   ENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNELAA
FT                   QLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSSRFY
FT                   AQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQ
FT                   LQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPI
FT                   GETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWGVERKRL
FT                   LLEREGVEKEAEDH"
FT   gene            80349..80933
FT                   /locus_tag="y0071"
FT   CDS_pept        80349..80933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0071"
FT                   /product="hypothetical protein"
FT                   /note="residues 33 to 194 of 194 are 80.24 pct identical to
FT                   residues 1 to 157 of 157 from E. coli K12 : B3606"
FT                   /db_xref="EnsemblGenomes-Gn:y0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83666"
FT                   /db_xref="GOA:Q8D1S8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S8"
FT                   /protein_id="AAM83666.1"
FT                   /translation="MLLNFCFTPPLLATAALNKGFWYPAPLIIGGHMLNIVLFEPEIPP
FT                   NTGNIIRLCANTGCQLHLIKPLGFTWDDKRLRRAGLDYHEFADIKHHHDYQAFLDSEKL
FT                   DSTQPARLFALTTKGTPAHSAVSYQANDYLLFGPETRGLPAYILDALPAQQKIRIPMQA
FT                   DSRSMNLSNAVSVVVYEAWRQLGYPGALLKE"
FT   gene            complement(81056..81880)
FT                   /gene="cysE"
FT                   /locus_tag="y0072"
FT   CDS_pept        complement(81056..81880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="y0072"
FT                   /product="serine acetyltransferase"
FT                   /function="enzyme; amino acid biosynthesis: Cysteine"
FT                   /note="residues 2 to 274 of 274 are 86.08 pct identical to
FT                   residues 1 to 273 of 273 from E. coli K12 : B3607"
FT                   /db_xref="EnsemblGenomes-Gn:y0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83667"
FT                   /db_xref="GOA:Q8D1S7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S7"
FT                   /protein_id="AAM83667.1"
FT                   /translation="MMSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSA
FT                   LSYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPLL
FT                   YLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGI
FT                   VIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIG
FT                   AGSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
FT   gene            complement(82143..83162)
FT                   /gene="gpsA"
FT                   /locus_tag="y0073"
FT   CDS_pept        complement(82143..83162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="y0073"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="enzyme; energy metabolism, carbon: Aerobic
FT                   respiration"
FT                   /note="residues 1 to 336 of 339 are 84.52 pct identical to
FT                   residues 1 to 336 of 339 from E. coli K12 : B3608"
FT                   /db_xref="EnsemblGenomes-Gn:y0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83668"
FT                   /db_xref="GOA:Q8ZJM6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM6"
FT                   /protein_id="AAM83668.1"
FT                   /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQLQ
FT                   QDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEAQDNIG
FT                   QVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKDEKIGI"
FT   gene            complement(83162..83638)
FT                   /gene="secB"
FT                   /locus_tag="y0074"
FT   CDS_pept        complement(83162..83638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="y0074"
FT                   /product="protein export; molecular chaperone"
FT                   /function="transport; protein, peptide secretion"
FT                   /note="may bind to signel sequence; residues 1 to 158 of
FT                   158 are 91.13 pct identical to residues 1 to 155 of 155
FT                   from E. coli K12 : B3609"
FT                   /db_xref="EnsemblGenomes-Gn:y0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83669"
FT                   /db_xref="GOA:Q8ZJM7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM7"
FT                   /protein_id="AAM83669.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
FT   gene            complement(83726..83974)
FT                   /gene="grxC"
FT                   /locus_tag="y0075"
FT   CDS_pept        complement(83726..83974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="y0075"
FT                   /product="glutaredoxin 3"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thioredoxin, glutaredoxin, glutathione"
FT                   /note="residues 1 to 82 of 82 are 78.04 pct identical to
FT                   residues 1 to 82 of 83 from E. coli K12 : B3610; residues 1
FT                   to 82 of 82 are 85.36 pct identical to residues 1 to 82 of
FT                   83 from GenPept : >gb|AAL22561.1| (AE008872) glutaredoxin 3
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83670"
FT                   /db_xref="GOA:A0A3N4AY38"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY38"
FT                   /protein_id="AAM83670.1"
FT                   /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMI
FT                   ARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
FT   gene            complement(84093..84527)
FT                   /locus_tag="y0076"
FT   CDS_pept        complement(84093..84527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0076"
FT                   /product="hypothetical protein"
FT                   /note="residues 2 to 144 of 144 are 65.73 pct identical to
FT                   residues 1 to 143 of 143 from E. coli K12 : B3611; residues
FT                   2 to 144 of 144 are 67.83 pct identical to residues 1 to
FT                   143 of 143 from GenPept : >gb|AAL22562.1| (AE008872)
FT                   putative Rhodanese-related sulfurtransferases [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83671"
FT                   /db_xref="GOA:A0A3N4AZG0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZG0"
FT                   /protein_id="AAM83671.1"
FT                   /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGE
FT                   ATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVCAM
FT                   GTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
FT   gene            84924..86471
FT                   /locus_tag="y0077"
FT   CDS_pept        84924..86471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0077"
FT                   /product="putative 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="residues 1 to 515 of 515 are 83.30 pct identical to
FT                   residues 1 to 514 of 514 from E. coli K12 : B3612; residues
FT                   1 to 515 of 515 are 83.88 pct identical to residues 1 to
FT                   514 of 514 from GenPept : >gb|AAL22563.1| (AE008872)
FT                   phosphoglyceromutase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83672"
FT                   /db_xref="GOA:Q8ZJN0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN0"
FT                   /protein_id="AAM83672.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAAVD
FT                   NAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   SSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVAG
FT                   LQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   gene            86481..87851
FT                   /locus_tag="y0078"
FT   CDS_pept        86481..87851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0078"
FT                   /product="putative membrane protein"
FT                   /function="putative membrane"
FT                   /note="residues 39 to 456 of 456 are 63.39 pct identical to
FT                   residues 24 to 427 of 427 from E. coli K12 : B3613;
FT                   residues 40 to 456 of 456 are 65.70 pct identical to
FT                   residues 25 to 427 of 427 from GenPept : >gb|AAL22564.1|
FT                   (AE008872) paral putative membrane protein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83673"
FT                   /db_xref="GOA:A0A3N4AWR1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWR1"
FT                   /protein_id="AAM83673.1"
FT                   /translation="MKDRELLAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVFC
FT                   AGVLLLPFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLKQQ
FT                   ENTISQTSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQGKH
FT                   SSLQLILSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQNQHKA
FT                   LLDEQKAQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKAEREAK
FT                   ARAEREAKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQALWPVR
FT                   GNVSHRFGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVVIEHGKGD
FT                   MSLYGYNQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   gene            87875..88809
FT                   /pseudo
FT                   /locus_tag="y0079"
FT                   /note="disrupted by frameshift"
FT   gene            complement(88947..89972)
FT                   /gene="tdh"
FT                   /locus_tag="y0080"
FT   CDS_pept        complement(88947..89972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="y0080"
FT                   /product="threonine dehydrogenase"
FT                   /function="enzyme; degradation of small molecules; amino
FT                   acids"
FT                   /note="residues 1 to 341 of 341 are 92.08 pct identical to
FT                   residues 1 to 341 of 341 from E. coli K12 : B3616"
FT                   /db_xref="EnsemblGenomes-Gn:y0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83674"
FT                   /db_xref="GOA:Q8ZJN2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN2"
FT                   /protein_id="AAM83674.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVNVSKENLND
FT                   VMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSGKVVLSW
FT                   D"
FT   gene            complement(89982..91223)
FT                   /gene="kbl"
FT                   /locus_tag="y0081"
FT   CDS_pept        complement(89982..91223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="y0081"
FT                   /product="2-amino-3-ketobutyrate CoA ligase (glycine
FT                   acetyltransferase)"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 20 to 413 of 413 are 84.77 pct identical to
FT                   residues 5 to 398 of 398 from E. coli K12 : B3617"
FT                   /db_xref="EnsemblGenomes-Gn:y0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83675"
FT                   /db_xref="GOA:Q8CWI4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWI4"
FT                   /protein_id="AAM83675.1"
FT                   /translation="MQLPILEITEMSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITS
FT                   AQQANIAVADGSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIH
FT                   KELEHKLASFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKA
FT                   KRYRYANNDMTELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALV
FT                   MVDDSHAVGVIGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQ
FT                   RSRPYLFSNSLAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADH
FT                   AIIPVMLGEAKLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAI
FT                   EAFVRIGKQLNVIA"
FT   gene            91394..92371
FT                   /gene="rfaD"
FT                   /locus_tag="y0083"
FT   CDS_pept        91394..92371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="y0083"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /function="enzyme; surface polysaccharides and antigens"
FT                   /note="residues 16 to 323 of 325 are 83.11 pct identical to
FT                   residues 1 to 308 of 310 from E. coli K12 : B3619"
FT                   /db_xref="EnsemblGenomes-Gn:y0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83676"
FT                   /db_xref="GOA:Q8ZJN4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN4"
FT                   /protein_id="AAM83676.1"
FT                   /translation="MGCGTQPRKLARVNTMIIVTGGAGFIGSNIVKALNNIGYKDILVV
FT                   DNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYM
FT                   MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFD
FT                   QYVREILPQADSQICGFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENF
FT                   KRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPE
FT                   KLKGRYQAYTQADLTKLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
FT   gene            92016..92243
FT                   /locus_tag="y0082"
FT   CDS_pept        92016..92243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0082"
FT                   /product="hypothetical"
FT                   /note="residues 5 to 33 of 75 are 48.27 pct identical to
FT                   residues 94 to 122 of 182 from GenPept : >dbj|BAA11839.1|
FT                   (D83187) delta 9-fatty acid desaturase [Yarrowia
FT                   lipolytica]"
FT                   /db_xref="EnsemblGenomes-Gn:y0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83677"
FT                   /db_xref="GOA:Q8CLW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW1"
FT                   /protein_id="AAM83677.1"
FT                   /translation="MQVKGLSYSRVAKTLNVISFMWVMLLTLICGSGKTAYPVFSTAVL
FT                   AGQSLSRLSLMQWWIITKVGQSNTSSSLKN"
FT   gene            92390..93466
FT                   /gene="rfaF"
FT                   /locus_tag="y0084"
FT   CDS_pept        92390..93466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="y0084"
FT                   /product="ADP-heptose--lps heptosyltransferase II"
FT                   /function="putative enzyme; macromolecule metabolism:
FT                   Lipopolysaccharide"
FT                   /note="lipopolysaccharide core biosynthesis; residues 5 to
FT                   351 of 358 are 73.77 pct identical to residues 1 to 347 of
FT                   348 from E. coli K12 : B3620; residues 5 to 351 of 358 are
FT                   78.38 pct identical to residues 1 to 347 of 348 from
FT                   GenPept : >gb|AAL23754.1| (U52844) heptosyltransferase II
FT                   WaaF [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83678"
FT                   /db_xref="GOA:Q8D1S4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S4"
FT                   /protein_id="AAM83678.1"
FT                   /translation="MINGMKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWC
FT                   RPLLARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFS
FT                   GIKRRIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQ
FT                   LQVRDEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVIL
FT                   FGSAKDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVAA
FT                   ALNKPLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEHVM
FT                   AALEKQLATQECSVKGGD"
FT   gene            93442..94431
FT                   /gene="rfaC"
FT                   /locus_tag="y0085"
FT   CDS_pept        93442..94431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="y0085"
FT                   /product="heptosyl transferase I"
FT                   /function="enzyme; macromolecule metabolism:
FT                   Lipopolysaccharide"
FT                   /note="lipopolysaccharide core biosynthesis; residues 9 to
FT                   327 of 329 are 68.33 pct identical to residues 1 to 319 of
FT                   319 from E. coli K12 : B3621; residues 9 to 329 of 329 are
FT                   81.30 pct identical to residues 1 to 321 of 321 from
FT                   GenPept : >gb|AAL23755.1| (U52844) heptosyltransferase I
FT                   WaaC [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83679"
FT                   /db_xref="GOA:Q8D1S3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S3"
FT                   /protein_id="AAM83679.1"
FT                   /translation="MLSQRGRLMHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVV
FT                   EEGFSQIPSWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGL
FT                   IKSAALITRIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYD
FT                   KPESYGDYAIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIK
FT                   LPWGAEHEHQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDR
FT                   PNITLFGPTDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
FT   gene            94743..96128
FT                   /gene="kdtA"
FT                   /locus_tag="y0086"
FT   CDS_pept        94743..96128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="y0086"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /function="enzyme; surface polysaccharides and antigens"
FT                   /note="residues 37 to 461 of 461 are 79.76 pct identical to
FT                   residues 1 to 425 of 425 from E. coli K12 : B3633; residues
FT                   37 to 461 of 461 are 88.47 pct identical to residues 1 to
FT                   425 of 425 from GenPept : >gb|AAC44432.1| (U52844)
FT                   3-deoxy-manno-octulosonic acid transferase [Serratia
FT                   marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83680"
FT                   /db_xref="GOA:Q8D1S2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S2"
FT                   /protein_id="AAM83680.1"
FT                   /translation="MNNHGSMWCSALLAGKSLFCPDMVLFLIIHINEIDRMLLRLYQVL
FT                   LYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGKVVAGGIMLHSVSVGETLAAIPLV
FT                   RALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHVYLPYDLPGSVNRFLDQVNPKLVI
FT                   IMETELWPNLINTLHRRKIPLVIANARLSARSAAGYKKIGSFIRTILQRITLIAAQNQE
FT                   DGDRFIELGLKRSQLTVTGSLKFDISVTPELAARAVTLRRQWAPHRPVWIATSTHDGEE
FT                   TILLEAHRQLLQQFPTLLLILVPRHPERFGKAVELTQKIGLSYTLRSKGEVPSSSTQVV
FT                   IGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAAAHAIPVLMGPHTFNFKDICAKLE
FT                   QAEGLITVTDTLSLVKEITVLLTDEDCRLYYGRHAVDVLHENQGALQRLLHLLEPYLPQ
FT                   RSH"
FT   gene            96129..96911
FT                   /locus_tag="y0087"
FT   CDS_pept        96129..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0087"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /function="enzyme"
FT                   /note="residues 1 to 256 of 260 are 75.78 pct identical to
FT                   residues 1 to 256 of 257 from GenPept : >gb|AAC44433.1|
FT                   (U52844) glucosyltransferase [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83681"
FT                   /db_xref="GOA:A0A3N4AY23"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY23"
FT                   /protein_id="AAM83681.1"
FT                   /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDETR
FT                   ALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLLAP
FT                   EEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKVIPL
FT                   AGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
FT   gene            96908..97387
FT                   /gene="kdtB"
FT                   /locus_tag="y0088"
FT   CDS_pept        96908..97387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="y0088"
FT                   /product="putative enzyme of lipopolysaccharide synthesis"
FT                   /note="residues 1 to 159 of 159 are 73.58 pct identical to
FT                   residues 1 to 159 of 159 from E. coli K12 : B3634; residues
FT                   1 to 159 of 159 are 82.38 pct identical to residues 1 to
FT                   159 of 161 from GenPept : >gb|AAD28804.1| (U52844)
FT                   phosphopantetheine adenylyltransferase CoaD [Serratia
FT                   marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83682"
FT                   /db_xref="GOA:Q8ZJN9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:3L92"
FT                   /db_xref="PDB:3L93"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN9"
FT                   /protein_id="AAM83682.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPM
FT                   FTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
FT   gene            complement(97393..98202)
FT                   /gene="mutM"
FT                   /locus_tag="y0090"
FT   CDS_pept        complement(97393..98202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="y0090"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 1 to 268 of 269 are 79.85 pct identical to
FT                   residues 1 to 268 of 269 from E. coli K12 : B3635; residues
FT                   1 to 268 of 269 are 83.70 pct identical to residues 1 to
FT                   270 of 271 from GenPept : >gb|AAD28805.2| (U52844) Fpg
FT                   [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83683"
FT                   /db_xref="GOA:Q8ZJP0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP0"
FT                   /protein_id="AAM83683.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTLS
FT                   DQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKV
FT                   VVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
FT   gene            97396..97554
FT                   /locus_tag="y0089"
FT   CDS_pept        97396..97554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0089"
FT                   /product="hypothetical"
FT                   /note="residues 25 to 43 of 52 are 57.89 pct identical to
FT                   residues 170 to 188 of 433 from GenPept : >emb|CAB86066.1|
FT                   (AL163002) putative protein [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83684"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW0"
FT                   /protein_id="AAM83684.1"
FT                   /translation="MLAVAAKERAALPVFRYFNGMPTLPTWFTRTPIDLQLLREIPWFT
FT                   IRLQKIT"
FT   gene            complement(98285..98452)
FT                   /gene="rpmG"
FT                   /locus_tag="y0091"
FT   CDS_pept        complement(98285..98452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="y0091"
FT                   /product="50S ribosomal subunit protein L33"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 1 to 55 of 55 are 96.36 pct identical to
FT                   residues 1 to 55 of 55 from E. coli K12 : B3636"
FT                   /db_xref="EnsemblGenomes-Gn:y0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83685"
FT                   /db_xref="GOA:Q8ZJP1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP1"
FT                   /protein_id="AAM83685.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   gene            complement(98963..99631)
FT                   /gene="radC"
FT                   /locus_tag="y0092"
FT   CDS_pept        complement(98963..99631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="y0092"
FT                   /product="DNA repair protein"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 10 to 222 of 222 are 58.21 pct identical to
FT                   residues 12 to 224 of 224 from E. coli K12 : B3638;
FT                   residues 7 to 222 of 222 are 59.72 pct identical to
FT                   residues 6 to 221 of 221 from GenPept : >gb|AAL22588.1|
FT                   (AE008873) putative DNA repair protein, associated with
FT                   replication forks [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83686"
FT                   /db_xref="GOA:Q8ZJP3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP3"
FT                   /protein_id="AAM83686.1"
FT                   /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMA
FT                   EYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNP
FT                   GITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   gene            99711..101042
FT                   /gene="dfp"
FT                   /locus_tag="y0093"
FT   CDS_pept        99711..101042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="y0093"
FT                   /product="flavoprotein affecting synthesis of DNA and
FT                   pantothenate metabolism"
FT                   /function="phenotype; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 39 to 442 of 443 are 75.18 pct identical to
FT                   residues 23 to 429 of 430 from E. coli K12 : B3639;
FT                   residues 40 to 442 of 443 are 75.12 pct identical to
FT                   residues 1 to 406 of 407 from GenPept : >gb|AAL22589.1|
FT                   (AE008873) flavoprotein affecting synthesis of DNA and
FT                   pantothenate metabolism [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83687"
FT                   /db_xref="GOA:Q8D1S1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S1"
FT                   /protein_id="AAM83687.1"
FT                   /translation="MRDVSQILRLVASESALIANLFNGYAKISPLTAFIRTIMMTGLSG
FT                   KHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHAAKAFIAPLTLQAVSGYPVSDDL
FT                   LDPAAEAAMGHIELGKWADLVIIAPATADLLARMAAGMANDLLTTVCLATAAPIAAVPA
FT                   MNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQACGDIGPGRMLDPQEIVALAYNHFSA
FT                   KQDLQHLSVMITAGPTREPLDPVRFISNQSSGKMGFAIAQALAARGSNVTLIAGPVNLS
FT                   TPEGVKRIDVITALEMQQAVQKIAQQQNIFISCAAVADYRAEHVSDEKIKKQGDEITLK
FT                   LVKNPDIVAGVASMAKNRPFVVGFAAETQNVEEYARQKLARKNLDLICANDVSLAEHGF
FT                   NSDTNALHLFWSTGEKRLPLSDKYLLSQRLIDEIVSRYDEKNRH"
FT   gene            101008..101478
FT                   /gene="dut"
FT                   /locus_tag="y0094"
FT   CDS_pept        101008..101478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="y0094"
FT                   /product="deoxyuridinetriphosphatase"
FT                   /function="enzyme; 2'-Deoxyribonucleotide metabolism"
FT                   /note="residues 6 to 156 of 156 are 84.76 pct identical to
FT                   residues 1 to 151 of 151 from E. coli K12 : B3640; residues
FT                   6 to 156 of 156 are 85.43 pct identical to residues 1 to
FT                   151 of 151 from GenPept : >gb|AAG58784.1|AE005591_8
FT                   (AE005591) deoxyuridinetriphosphatase [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83688"
FT                   /db_xref="GOA:Q8ZJP5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP5"
FT                   /protein_id="AAM83688.1"
FT                   /translation="MSAVMMKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAV
FT                   ELQPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVS
FT                   VWNRGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
FT   gene            101600..102196
FT                   /gene="ttk"
FT                   /locus_tag="y0095"
FT   CDS_pept        101600..102196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="y0095"
FT                   /product="putative transcriptional regulator"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 198 of 198 are 83.33 pct identical to
FT                   residues 15 to 212 of 212 from E. coli K12 : B3641;
FT                   residues 1 to 198 of 198 are 83.83 pct identical to
FT                   residues 1 to 198 of 198 from GenPept : >gb|AAL22591.1|
FT                   (AE008873) putative transcriptional regulator (TetR/ArcR
FT                   family) [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83689"
FT                   /db_xref="GOA:Q8ZJP6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP6"
FT                   /protein_id="AAM83689.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLATQLL
FT                   AFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
FT   gene            complement(102331..102978)
FT                   /gene="pyrE"
FT                   /locus_tag="y0096"
FT   CDS_pept        complement(102331..102978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="y0096"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="enzyme; pyrimidine ribonucleotide biosynthesis"
FT                   /note="residues 1 to 213 of 215 are 85.91 pct identical to
FT                   residues 1 to 213 of 213 from E. coli K12 : B3642; residues
FT                   1 to 213 of 215 are 85.91 pct identical to residues 1 to
FT                   213 of 213 from GenPept : >gb|AAL22592.1| (AE008873)
FT                   orotate phosphoribosyltransferase [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83690"
FT                   /db_xref="GOA:Q8ZJP7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP7"
FT                   /protein_id="AAM83690.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLD
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
FT   gene            complement(103145..103861)
FT                   /gene="rph"
FT                   /locus_tag="y0097"
FT   CDS_pept        complement(103145..103861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="y0097"
FT                   /product="RNase PH"
FT                   /function="enzyme; degradation of RNA"
FT                   /note="residues 1 to 223 of 238 are 88.78 pct identical to
FT                   residues 1 to 223 of 228 from E. coli K12 : B3643; residues
FT                   1 to 238 of 238 are 100.00 pct identical to residues 1 to
FT                   238 of 238 from GenPept : >emb|CAC88911.1| (AJ414141)
FT                   ribonuclease PH [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83691"
FT                   /db_xref="GOA:Q8ZJP8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP8"
FT                   /protein_id="AAM83691.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALLDLAR
FT                   GGIETIFQAQKAALES"
FT   gene            103988..104851
FT                   /locus_tag="y0098"
FT   CDS_pept        103988..104851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0098"
FT                   /product="putative alpha helix protein"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 1 to 287 of 287 are 87.45 pct identical to
FT                   residues 1 to 287 of 287 from E. coli K12 : B3644; residues
FT                   1 to 287 of 287 are 87.80 pct identical to residues 1 to
FT                   287 of 287 from GenPept : >gb|AAL22594.1| (AE008873)
FT                   putative stress-induced protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83692"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B149"
FT                   /protein_id="AAM83692.1"
FT                   /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRLEGV
FT                   SAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            105254..105877
FT                   /locus_tag="y0099"
FT   CDS_pept        105254..105877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0099"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 181 of 207 are 74.58 pct identical to
FT                   residues 19 to 199 of 223 from E. coli K12 : B3646;
FT                   residues 1 to 181 of 207 are 74.58 pct identical to
FT                   residues 19 to 199 of 223 from GenPept :
FT                   >gb|AAG58790.1|AE005592_1 (AE005592) orf, hypothetical
FT                   protein [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83693"
FT                   /db_xref="GOA:A0A3N4AY13"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY13"
FT                   /protein_id="AAM83693.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSIIG
FT                   AQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIYIAL
FT                   QYTPLSHNWVIIITLITGLALDYSPYDSGLACLYSNMSTQTIKL"
FT   gene            complement(105890..107593)
FT                   /locus_tag="y0100"
FT   CDS_pept        complement(105890..107593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0100"
FT                   /product="putative enzyme"
FT                   /note="residues 6 to 564 of 567 are 43.79 pct identical to
FT                   residues 3 to 561 of 562 from E. coli K12 : B3647"
FT                   /db_xref="EnsemblGenomes-Gn:y0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83694"
FT                   /db_xref="GOA:Q7CLB2"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLB2"
FT                   /protein_id="AAM83694.1"
FT                   /translation="MNILNLKIIMFLLISNTIVVGGAWATSTCPDWPATRIAVEINALE
FT                   QQLNKWSAAYHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHPVA
FT                   HTGLKKLKDETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQNWT
FT                   EKAPFISAIPQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKSPSPL
FT                   LAQVGVFIWAWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWFQAPLP
FT                   FVTDGVVVRQEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGKGTVVLE
FT                   VLPIKIDDKWIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRVHQRNTIT
FT                   APNWDKFHQLSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQELIHHELINDL
FT                   VGWLLLTPEQIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVVSVDAQWQVV
FT                   LRRSLSEWATMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELTE"
FT   gene            107994..108617
FT                   /gene="gmk"
FT                   /locus_tag="y0101"
FT   CDS_pept        107994..108617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="y0101"
FT                   /product="guanylate kinase"
FT                   /function="enzyme; purine ribonucleotide biosynthesis"
FT                   /note="residues 1 to 207 of 207 are 87.92 pct identical to
FT                   residues 1 to 207 of 207 from E. coli K12 : B3648"
FT                   /db_xref="EnsemblGenomes-Gn:y0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83695"
FT                   /db_xref="GOA:Q8ZJQ2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ2"
FT                   /protein_id="AAM83695.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
FT   gene            108672..108947
FT                   /gene="rpoZ"
FT                   /locus_tag="y0102"
FT   CDS_pept        108672..108947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="y0102"
FT                   /product="RNA polymerase, omega subunit"
FT                   /function="enzyme; RNA synthesis, modification, DNA
FT                   transcription"
FT                   /note="residues 1 to 91 of 91 are 92.30 pct identical to
FT                   residues 1 to 91 of 91 from E. coli K12 : B3649"
FT                   /db_xref="EnsemblGenomes-Gn:y0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83696"
FT                   /db_xref="GOA:Q8ZJQ3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ3"
FT                   /protein_id="AAM83696.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEENDK
FT                   VTVIALREIEEGLITNQILDVRERQEQQEQQAAEIQAVTAIAEGRR"
FT   gene            108967..111075
FT                   /gene="spoT"
FT                   /locus_tag="y0103"
FT   CDS_pept        108967..111075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="y0103"
FT                   /product="(p)ppGpp synthetase II"
FT                   /function="enzyme; global regulatory functions"
FT                   /note="residues 1 to 702 of 702 are 91.45 pct identical to
FT                   residues 1 to 702 of 702 from E. coli K12 : B3650; residues
FT                   1 to 702 of 702 are 91.89 pct identical to residues 1 to
FT                   703 of 703 from GenPept : >gb|AAL22601.1| (AE008874)
FT                   bifunctional : (p)ppGpp synthetase II; also
FT                   guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83697"
FT                   /db_xref="GOA:A0A3N4BK11"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BK11"
FT                   /protein_id="AAM83697.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENIKHELDRMKL
FT                   ATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGVLITFAKCCRP
FT                   IPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFN
FT                   QQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLANIMRKIRIMPDV
FT                   VKVSRNRN"
FT   gene            111081..111773
FT                   /gene="spoU"
FT                   /locus_tag="y0104"
FT   CDS_pept        111081..111773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="y0104"
FT                   /product="putative RNA methylase"
FT                   /note="residues 1 to 227 of 230 are 82.81 pct identical to
FT                   residues 1 to 227 of 229 from E. coli K12 : B3651"
FT                   /db_xref="EnsemblGenomes-Gn:y0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83698"
FT                   /db_xref="GOA:A0A3N4AWN1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWN1"
FT                   /protein_id="AAM83698.1"
FT                   /translation="MNPQRYARICDMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGI
FT                   HQVHAIWPTTQMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYKRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWW
FT                   SAMQATES"
FT   gene            111774..113855
FT                   /gene="recG"
FT                   /locus_tag="y0105"
FT   CDS_pept        111774..113855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="y0105"
FT                   /product="DNA helicase"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="resolution of Holliday junctions, branch migration;
FT                   residues 1 to 693 of 693 are 81.52 pct identical to
FT                   residues 1 to 693 of 693 from E. coli K12 : B3652; residues
FT                   1 to 693 of 693 are 81.24 pct identical to residues 1 to
FT                   693 of 693 from GenPept : >gb|AAL22603.1| (AE008874) DNA
FT                   helicase, resolution of Holliday junctions, branch
FT                   migration [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83699"
FT                   /db_xref="GOA:A0A2S9PHL0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PHL0"
FT                   /protein_id="AAM83699.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRVVAEIE
FT                   RDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHATTFRQW
FT                   LEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIERWLPERVRYTNA"
FT   gene            complement(114221..115435)
FT                   /gene="gltS"
FT                   /locus_tag="y0106"
FT   CDS_pept        complement(114221..115435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="y0106"
FT                   /product="sodium/glutamate symporter"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 1 to 399 of 404 are 82.45 pct identical to
FT                   residues 1 to 399 of 401 from E. coli K12 : B3653; residues
FT                   1 to 399 of 404 are 82.45 pct identical to residues 1 to
FT                   399 of 401 from GenPept : >emb|CAA06485.1| (AJ005339)
FT                   glutamate permease [synthetic construct]"
FT                   /db_xref="EnsemblGenomes-Gn:y0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83700"
FT                   /db_xref="GOA:A0A3N4BAK4"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAK4"
FT                   /protein_id="AAM83700.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVVGL
FT                   LLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLIETIA
FT                   MISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKLYLLLPIF
FT                   PAVTG"
FT   gene            115622..117058
FT                   /locus_tag="y0107"
FT   CDS_pept        115622..117058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0107"
FT                   /product="putative transport protein, symporter"
FT                   /function="putative transport"
FT                   /note="residues 18 to 478 of 478 are 83.98 pct identical to
FT                   residues 1 to 462 of 463 from E. coli K12 : B3654; residues
FT                   18 to 478 of 478 are 83.76 pct identical to residues 1 to
FT                   462 of 463 from GenPept : >gb|AAL22606.1| (AE008874)
FT                   putative NCS2 family, purine/xanthine transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83701"
FT                   /db_xref="GOA:Q8D1S0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S0"
FT                   /protein_id="AAM83701.1"
FT                   /translation="MSRIIKMPPLPIWKYHAMSTQSAELDTAPPSPAHPSELIYHLEDR
FT                   PPLPQTLFAACQHLLAMFVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIK
FT                   TWGPVGSGLLSIQGTSFNFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLS
FT                   HVLHLARRIITPLVSGIVVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVL
FT                   GVIILLNRQRNPYLRVASLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLS
FT                   FDWNLLIPLMLIFMVTSLETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSA
FT                   IFNTFPNSCFGQNNGVIQLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGA
FT                   TLVMFGTIAASGVRIVSRETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSS
FT                   GIAAGGITAIVLNLLFPQEK"
FT   gene            117206..118915
FT                   /locus_tag="y0108"
FT   CDS_pept        117206..118915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0108"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 563 of 569 are 49.02 pct identical to
FT                   residues 1 to 557 of 569 from E. coli K12 : B3655"
FT                   /db_xref="EnsemblGenomes-Gn:y0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2U2GVA8"
FT                   /protein_id="AAM83702.1"
FT                   /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSGY
FT                   HLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQLQ
FT                   NGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQPIPG
FT                   NSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNARQSA
FT                   DGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAVNDVDL
FT                   TLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFTTRWQDG
FT                   LLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGKLSANRNL
FT                   LIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDIRRPSLALN
FT                   ANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHNWGWPALPLQ
FT                   GLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGTAEQ"
FT   gene            complement(119050..119973)
FT                   /locus_tag="y0109"
FT   CDS_pept        complement(119050..119973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0109"
FT                   /product="putative acetyltransferase"
FT                   /note="residues 1 to 298 of 307 are 83.89 pct identical to
FT                   residues 17 to 314 of 329 from E. coli K12 : B3888"
FT                   /db_xref="EnsemblGenomes-Gn:y0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83703"
FT                   /db_xref="GOA:A0A3N4AZD2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZD2"
FT                   /protein_id="AAM83703.1"
FT                   /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAHH
FT                   QMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQLQQ
FT                   AWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQLNVNLF
FT                   GDENQGAVFEGTYMVLPVAAGDDMAN"
FT   mobile_element  120157..122106
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            120608..121261
FT                   /locus_tag="y0110"
FT   CDS_pept        120608..121261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0110"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 217 of 217 are 100.00 pct
FT                   identical to residues 124 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83704"
FT                   /db_xref="GOA:Q8D1R9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R9"
FT                   /protein_id="AAM83704.1"
FT                   /translation="MQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDTLETCH
FT                   RNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLCRPFRA
FT                   QTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKHETIQA
FT                   RPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA"
FT   gene            121258..122040
FT                   /locus_tag="y0111"
FT   CDS_pept        121258..122040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0111"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfB; residues 1 to 260 of 260 are 100.00 pct
FT                   identical to residues 1 to 260 of 260 from GenPept :
FT                   >gb|AAC69770.1| (AF074612) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83705"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM83705.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            122056..122991
FT                   /locus_tag="y0112"
FT   CDS_pept        122056..122991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0112"
FT                   /product="putative transferase"
FT                   /note="residues 18 to 310 of 311 are 77.81 pct identical to
FT                   residues 35 to 327 of 328 from E. coli K12 : B3102"
FT                   /db_xref="EnsemblGenomes-Gn:y0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83706"
FT                   /db_xref="GOA:Q8D1R8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R8"
FT                   /protein_id="AAM83706.1"
FT                   /translation="MGRWWRYKWITFHPSLTTTDGQAGPQGKGGFNAEAHRYHLYVSLA
FT                   CPWAHRALLMRTLKGLESLISVSVVHPLMQENGWTFSSDFPAATGDALYHLDYLYQLYL
FT                   RAAPDYSGRVTVPVLWDKQQQTVVSNESADIIRMFNNAFDDVGAKAGDYYPTALRNDID
FT                   DINGWVYDQVNNGVYKAGFATTQEAYDEAVGTLFSALDRLEQILGQHRYLTGNQLTEAD
FT                   LRLWTTLVRFDPVYVTHFKCDKRRISDYPNLYGFLRDIYQMPGIAETVDFAHIRTHYYR
FT                   SHGTINPYGIISIGPQQNLLEPHDRANRFV"
FT   gene            complement(123122..124015)
FT                   /locus_tag="y0113"
FT   CDS_pept        complement(123122..124015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0113"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 294 of 297 are 89.45 pct identical to
FT                   residues 1 to 294 of 298 from E. coli K12 : B3105"
FT                   /db_xref="EnsemblGenomes-Gn:y0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83707"
FT                   /db_xref="GOA:A0A3N4AWM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWM6"
FT                   /protein_id="AAM83707.1"
FT                   /translation="MARDRALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKL
FT                   EEELDVVLFDRSGHRTKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHITIVSE
FT                   ALSPAWKLFPLIDKLALKANTQVSILTEVLAGAWERLEQGRADIVIAPDMHFRASSEIN
FT                   SRKLYKVTSVYVASPDHPIHQEPEPLSELTRVKYRGIAVADTARERPVITVQLLDKQQR
FT                   LTVSTIEDKRRALLAGLGVATMPYEMVEKDIAAGRLRVIGPEYSREADIIMAWRRDSMG
FT                   EAKSWCLREIPKLLGK"
FT   gene            complement(124135..124284)
FT                   /locus_tag="y0114"
FT   CDS_pept        complement(124135..124284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0114"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83708"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV9"
FT                   /protein_id="AAM83708.1"
FT                   /translation="MIMTMITSYTGHLSSHRKESVGLSIGSPLQDCGNRFSTRLSFVGR
FT                   FPES"
FT   gene            124277..124981
FT                   /locus_tag="y0115"
FT   CDS_pept        124277..124981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0115"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 234 of 234 are 68.80 pct identical to
FT                   residues 1 to 233 of 233 from E. coli K12 : B3106; residues
FT                   1 to 234 of 234 are 71.79 pct identical to residues 1 to
FT                   233 of 233 from GenPept : >emb|CAD07760.1| (AL627278)
FT                   conserved hypothetical protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83709"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B012"
FT                   /protein_id="AAM83709.1"
FT                   /translation="MITCRTAEQCGQADFGWLQARYTFSFGHYFDPTLLGYASLRVLNQ
FT                   EVLAPGAAFQPRTYPQVDILNLILQGEAEYRDSLGNHVHAKTGDALLFSPQQGVSYSEH
FT                   NLSANKSLTRIQLWLNACPERESAPTQHQRLSTRPVQLLASPAGEQGSLQLRQQMWIHH
FT                   LALAAGEQQKMPLHGHRAYLQSIHGTVDATGPQTGTSQRLTCGDGAFVEEEQHLVIKAI
FT                   TPLRALLIDLPV"
FT   gene            complement(125522..125898)
FT                   /locus_tag="ys001"
FT   misc_RNA        complement(125522..125898)
FT                   /locus_tag="ys001"
FT                   /product="RNase P, RNA component"
FT                   /function="RNA; Macromolecule degradation: Degradation of
FT                   RNA"
FT                   /note="M1 RNA; processes tRNA"
FT   gene            125522..125890
FT                   /locus_tag="y0116"
FT   CDS_pept        125522..125890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0116"
FT                   /product="hypothetical"
FT                   /note="residues 82 to 114 of 122 are 48.48 pct identical to
FT                   residues 47 to 79 of 271 from GenPept : >dbj|BAB31852.1|
FT                   (AK019785) data source:SPTR, source key:Q9NQV8,
FT                   evidence:ISS; homolog to PR-domain containing protein 8
FT                   putative [Mus musculus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV8"
FT                   /protein_id="AAM83710.1"
FT                   /translation="MELTGKPGSVVDSHSSRPAIAHWLKQPTRVQYGPYHANPYLALLR
FT                   VEFTMPRTVASRAVRSYRTLSPLPDPTCVGHRRFALCCTCRRLAPPRRYLAPCPMEPGL
FT                   SSPPPVSPERDGSEAATV"
FT   gene            complement(125918..126817)
FT                   /locus_tag="y0117"
FT   CDS_pept        complement(125918..126817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0117"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 286 of 299 are 85.31 pct identical to
FT                   residues 1 to 285 of 286 from E. coli K12 : B3146"
FT                   /db_xref="EnsemblGenomes-Gn:y0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83711"
FT                   /db_xref="GOA:A0A3N4BAJ8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAJ8"
FT                   /protein_id="AAM83711.1"
FT                   /translation="MNQHDRAVISASTLYVVPTPIGNLGDITHRALEVLKGVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKADQLLAKLQEGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGLASDRFCYEGFLPAKTKGRKDTLQALIEEP
FT                   RTLIFYESTHRLLESLQDMVTVLGPQRYVVLARELTKTWESIHGAPVGELLAWVKEEET
FT                   RRRGEMVLIVEGHKVQSDDALPADALRTLALLQKELPLKKAAALAAEIHGVKKNALYKY
FT                   ALEQQQGDVETEEDDIQQ"
FT   gene            126784..128853
FT                   /locus_tag="y0118"
FT   CDS_pept        126784..128853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0118"
FT                   /product="putative glycosylase"
FT                   /note="residues 33 to 689 of 689 are 53.00 pct identical to
FT                   residues 1 to 678 of 678 from E. coli K12 : B3147; residues
FT                   33 to 687 of 689 are 55.99 pct identical to residues 1 to
FT                   678 of 680 from GenPept : >gb|AAL22136.1| (AE008850) paral
FT                   putative transglycosylase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83712"
FT                   /db_xref="GOA:Q8D1R7"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R7"
FT                   /protein_id="AAM83712.1"
FT                   /translation="MQKLLLDRVDSLFHPNYRFNIEHLEKNITGYSMLSSTFVRSKAGL
FT                   VPVILAALILAACTGDAPQTPPPVNIQDEASANSDYYLQQLQQSSDDNKADWQLLAIRA
FT                   LLREAKVPQAAEQLSTLPANLSDTQRQEQQLLAAELLIAQKNTPAAADILAKLEATQLS
FT                   ANQKVRYYQAQIAANQDKATLPLIRAFIAQEPLLTDKAHQDNIDGTWQSLSQLTPQELN
FT                   TMVINADENVLQGWLDLLRVYQDNKQDPELLKAGIKDWQTRYPQNPAAKNLPTALTQIS
FT                   NFSQASTAKIALLLPLSGPAQVFADAIQQGFTAAQNGSAVTASVPVTPNVTESSPTDTA
FT                   AVVSDDTPATLPAPVPPPVVTNAQVKIYDTNTQPLAALLAQAQQDGATLVVGPLLKPEV
FT                   EQLSATPSTLNILALNQPEASNNSPNICYFALSPEDEARDAAHHLWEQQKRMPLLLVPR
FT                   GALGERIAKAFADEWQKQGGQTVLQQNFGSTTELKQSINSGAGIRLTGTPVSVSNVAAA
FT                   PASVTIAGLTIPAPPIDAPVVSTSSSGNIDAVYIIATPSELTLIKPMIDMATSSRSKPA
FT                   LFASSRSYQAGAGPDYRLEMEGIQFSDIPLMAGSNPALLQQASAKYANDYSLVRLYAMG
FT                   IDAWALANHFSEMRQIPGFQVKGVTGDLTASSDCVITRKLPWLQYRQGMVVPLA"
FT   gene            128937..129290
FT                   /locus_tag="y0119"
FT   CDS_pept        128937..129290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0119"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 115 of 117 are 57.39 pct identical to
FT                   residues 14 to 128 of 131 from E. coli K12 : B3148;
FT                   residues 1 to 115 of 117 are 57.39 pct identical to
FT                   residues 14 to 128 of 131 from GenPept : >gb|AAL22137.1|
FT                   (AE008850) putative endonuclease [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83713"
FT                   /db_xref="GOA:Q8ZB75"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB75"
FT                   /protein_id="AAM83713.1"
FT                   /translation="MSQRDTGAHYENLARRHLERAGLVFQAANVAFRGGEIDLIMRDGD
FT                   AWVFVEVRFRRNDLFGGAAASITPRKQQRLHLAAAVWLAQRGASFATTSCRFDVVAITG
FT                   NQLEWLPNAFNTD"
FT   gene            complement(129011..129391)
FT                   /locus_tag="y0120"
FT   CDS_pept        complement(129011..129391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0120"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 49 of 126 are 37.99 pct identical to
FT                   residues 674 to 722 of 1684 from GenPept :
FT                   >gb|AAC27151.1|AAC27151 (AC004512) Similar to gb|U46691
FT                   putative chromatin structure regulator (SUPT6H) from Homo
FT                   sapiens. ESTs gb|T42908, gb|AA586170 and gb|AA395125 come
FT                   from this gene. [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83714"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV7"
FT                   /protein_id="AAM83714.1"
FT                   /translation="MLFKLVPDQFFSRLPSACNSNYLGIARYQLENKHQSVLKALGSHS
FT                   NWLPVIATTSKRQDVVAKLAPRCASQTAAARCSRCCLRGVILAAAPPNRSLRRKRTSTN
FT                   THASPSRIIRSISPPRKATLAA"
FT   gene            complement(129415..129501)
FT                   /locus_tag="y0121"
FT   CDS_pept        complement(129415..129501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0121"
FT                   /product="hypothetical"
FT                   /note="residues 2 to 25 of 28 are 50.00 pct identical to
FT                   residues 839 to 862 of 1165 from GenPept : >gb|AAD10500.2|
FT                   (U53471) receptor tyrosine kinase proto-oncogene
FT                   [Xiphophorus xiphidium]"
FT                   /db_xref="EnsemblGenomes-Gn:y0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83715"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV6"
FT                   /protein_id="AAM83715.1"
FT                   /translation="MVTLNNPNHLLVVDFKVSKLIGINEPYP"
FT   gene            129561..130151
FT                   /locus_tag="y0122"
FT   CDS_pept        129561..130151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0122"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 196 of 196 are 93.36 pct identical to
FT                   residues 1 to 196 of 196 from E. coli K12 : B3149"
FT                   /db_xref="EnsemblGenomes-Gn:y0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83716"
FT                   /db_xref="GOA:Q8ZB74"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB74"
FT                   /protein_id="AAM83716.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISCAAMALVQSLLNGNKIL
FT                   CCGNGTSAANAQHFAASMINRFETERPSLPAIALNADNVVLTAITNDRLHDEVYAKQVR
FT                   ALGQAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQLDVEIRI
FT                   PSHRGARVQELHMLTVNCLCDLIDNTLFPHQND"
FT   gene            130117..130737
FT                   /locus_tag="y0123"
FT   CDS_pept        130117..130737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0123"
FT                   /product="conserved putative exported protein"
FT                   /function="putative transport"
FT                   /note="residues 16 to 206 of 206 are 73.29 pct identical to
FT                   residues 1 to 191 of 191 from E. coli K12 : B3150; residues
FT                   16 to 206 of 206 are 73.82 pct identical to residues 1 to
FT                   191 of 191 from GenPept : >gb|AAL22139.1| (AE008850) paral
FT                   putative periplasmic protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83717"
FT                   /db_xref="GOA:Q8D1R6"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R6"
FT                   /protein_id="AAM83717.1"
FT                   /translation="MTTLYFLIRTIKGAPMKVGYIFAMLFSTLLLQGCVGAVVVGSAAV
FT                   ATKTATDPRTIGTQVDDGTLEARVVNALSKDKEIKSQTRFVVTAYQGKVLLTGQTPSAE
FT                   LSNRAKQIASGVDGVTEVYNEMRLGKPVDLSTASMDTWITTKVRSQLLTSDSVKSSNVK
FT                   VTTENGEVFLLGLVTQQEAQSAAQIASKVSGVKHVTTAFTIVK"
FT   gene            complement(130944..131669)
FT                   /gene="mtgA"
FT                   /locus_tag="y0124"
FT   CDS_pept        complement(130944..131669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="y0124"
FT                   /product="putative peptidoglycan enzyme"
FT                   /note="residues 17 to 241 of 241 are 72.44 pct identical to
FT                   residues 18 to 242 of 242 from E. coli K12 : B3208"
FT                   /db_xref="EnsemblGenomes-Gn:y0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83718"
FT                   /db_xref="GOA:Q8ZB72"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB72"
FT                   /protein_id="AAM83718.1"
FT                   /translation="MISVRRGFSQLWYWGKRGVIGIIALWMAGILIFAFLPVPFSMVMI
FT                   ERQLGAWLTGDFAYVAHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSH
FT                   NQRNQKRIRGASTLSQQTAKNVFLWDGRSWVRKGLEVGLTAGIELIWTKRRILTVYLNI
FT                   AEFGNGIFGVEAAARHFFNKPASKLSASEAALLAAVLPNPLRFKVNAPSGYVISRQQWI
FT                   LRQMHQLGGKTFLQENTLD"
FT   gene            complement(131666..132319)
FT                   /locus_tag="y0125"
FT   CDS_pept        complement(131666..132319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0125"
FT                   /product="sigma cross-reacting protein 27A (SCRP-27A)"
FT                   /function="putative factor"
FT                   /note="residues 1 to 217 of 217 are 63.59 pct identical to
FT                   residues 4 to 220 of 220 from E. coli K12 : B3209; residues
FT                   1 to 217 of 217 are 65.89 pct identical to residues 1 to
FT                   217 of 217 from GenPept : >emb|CAD07844.1| (AL627278)
FT                   conserved hypothetical protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83719"
FT                   /db_xref="GOA:A0A3N4BJZ6"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJZ6"
FT                   /protein_id="AAM83719.1"
FT                   /translation="MKTVGVVLSGCGVLDGAEIHESVLTMLALDRAGAEVLFFAPDKPQ
FT                   LHVINHITGEIVAEERNVLVESARIARGLITPLSAADPEVLDALIVPGGFGAAKNLCDF
FT                   AIKGGECSVEPDLYKLIQLMHKSGKPIGLMCISPVMLPKLLGKPIRLTIGNDPDTIDAI
FT                   EIMGGEHVICPADDVVIDLENKVVTTPAYMLAGSISEAAKGIDKLVTKVLDLTE"
FT   gene            complement(132561..134897)
FT                   /gene="arcB"
FT                   /locus_tag="y0126"
FT   CDS_pept        complement(132561..134897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="y0126"
FT                   /product="aerobic respiration sensor-response protein;
FT                   histidine protein kinase/phosphatase"
FT                   /function="enzyme; global regulatory functions"
FT                   /note="sensor for arcA; residues 1 to 778 of 778 are 75.92
FT                   pct identical to residues 1 to 776 of 776 from E. coli K12
FT                   : B3210; residues 1 to 778 of 778 are 77.33 pct identical
FT                   to residues 1 to 778 of 778 from GenPept : >gb|AAL22197.1|
FT                   (AE008853) sensory histidine kinase in two-component
FT                   regulatory system with ArcA, senses redox conditions
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83720"
FT                   /db_xref="GOA:A0A2S9PD71"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PD71"
FT                   /protein_id="AAM83720.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSLLLASALVLLAMVVQMAVTFV
FT                   LRGSVETLDLVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSRLVDKLEVMRHRDLEL
FT                   NKQLTENITQLNQEIVEREKAEKAHLQVVDKLKEEMGHREQAQIELGQQSALLRSFLDA
FT                   SPDLVYYRNEDNEFSGCNRAMELLTGKSEKQLVGLTPKDVYAPDIAEKVMETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELDAEQLKYLKTIHVSAITLGNIFNDIIE
FT                   MDKLERRKVQLDNQPVDFTGFMADLENLSGLLVQPKGLKFIMEPQLPLPEKVIADGTRL
FT                   RQILWNLIGNAVKFTQQGKIVVRVRREGNDRLIFEVEDSGMGIPEDEQDKIFAMYYQVK
FT                   DRNGGRPATGTGIGLAVSKRLAQSMGGDITVKSTQGVGSCFTLTIKAPAVQEASNAPSG
FT                   DDMPLPALHVLLVEDIELNVIVARSVLEKLGNSVDVAMNGHDALAMFNPEDFDLVLLDI
FT                   QLPDMSGLDIARQIRAEYGKQSLPPLVALTANVLKDKKEYLDAGMDDVLSKPLSVPALT
FT                   AMIKQFWDSKPSSAVQKQEHKVMQTHESLLDTTMLEQYIDLVGPQLIHQSLEMFEQMMP
FT                   GYLAVLDSNMTARDQKGITEEAHKIKGAAGSVGLRHIQQLAQQIQTPTLPAWWDNVQDW
FT                   VDELKLEWRNDVQVLREWAAEVEKK"
FT   gene            complement(135161..136150)
FT                   /locus_tag="y0127"
FT   CDS_pept        complement(135161..136150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0127"
FT                   /product="hypothetical protein"
FT                   /note="residues 23 to 323 of 329 are 78.73 pct identical to
FT                   residues 1 to 301 of 309 from E. coli K12 : B3211"
FT                   /db_xref="EnsemblGenomes-Gn:y0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83721"
FT                   /db_xref="GOA:Q8D1R5"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R5"
FT                   /protein_id="AAM83721.1"
FT                   /translation="MLLGRNANGFGYGLFLTGSAKIMQLQQLVNMFGADLQRRYGEKIH
FT                   KLTLHGGFSCPNRDGTLGRGGCTFCQVASFADEQMQQQSITQQLAIQAKKANRANRYLA
FT                   YFQAYTSTYAEVNALAAMYQQALCEADIVGLCVGTRPDCVPDAVLDLLSSYQQQGYEVW
FT                   LELGLQTANDKTLKRINRGHDFACYQQTARRARARGLKVCCHLIVGLPGEDRAQGRETL
FT                   EKVVTTGVDGIKLHPLHIVEGSTMAKAWRAGRLTALALEDYVLTAGEMIRHTPAEVVYH
FT                   RISASARRPTLLAPLWCENRWTGMNELNNYLLQHGVQGTAIGDAYCYR"
FT   gene            136757..141364
FT                   /gene="gltB"
FT                   /locus_tag="y0128"
FT   CDS_pept        136757..141364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="y0128"
FT                   /product="glutamate synthase, large subunit"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 43 to 1535 of 1535 are 87.55 pct identical
FT                   to residues 24 to 1517 of 1517 from E. coli K12 : B3212;
FT                   residues 51 to 1535 of 1535 are 89.23 pct identical to
FT                   residues 1 to 1486 of 1486 from GenPept : >gb|AAK94787.1|
FT                   (AY035435) glutamate synthase large subunit [Klebsiella
FT                   aerogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:y0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83722"
FT                   /db_xref="GOA:Q8D1R4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R4"
FT                   /protein_id="AAM83722.1"
FT                   /translation="MRTITRGHWRRAEKQICRKARVCQPTLSDINMSFTSWFVRVSQSL
FT                   GRFTDMLYDQSQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAILADGKTGDG
FT                   CGLLLQKPDHFFRMVAEERGWRLAKNYAVGMMFLSQDEELAKASRRIVEEELQNETLSI
FT                   VGWREVPTNPDVLGEIALSSLPRIEQIFVNAPAGWRSRDMERRLFVARRRIEKRISDKD
FT                   FYACSFSNLVTIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFSTNTVPRWPLAQPF
FT                   RYLAHNGEINTIAGNRQWAKARAYKFKTPLIPDLQDAAPFVNETGSDSSSLDNMLELFL
FT                   SGGMDLIRAMRLLVPPAWQNNPDMDTDLRAFFDFNSMHMEPWDGPAGIVMSDGRYAACN
FT                   LDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVIDTRSGKILHS
FT                   AETDNDLKSRHPYKEWMEKNVKRLVPFEDLPEEQVGSRQLDDSQLETYQKQFGYSNEEL
FT                   DQIIRVLGENGQEATGSMGDDTPFAVLSSGPRIIYDYFRQQFAQVTNPPIDPLREAHVM
FT                   SLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFQQLTTLEGEHYRADRLDLTFNPAE
FT                   NDLEQAVLSLCDEAERKVRDGAVMLVLSDRAIAPNRLPVPAPMAVGAIQTRLVDKSLRC
FT                   DANIIVETASARDPHHFAVLLGFGATAIYPYLAYESLAKLVDSQAIDKKYRDVMLNYRN
FT                   GINKGLYKIMSKMGISTVASYRCAKLFEAVGLHRDLSDLCFQGVVSRIGGASFSDFQQD
FT                   LQNLSKRAWLKRKPLDQGGLLKFVHNGEYHAYNPDVVSTLQKAVHSGEYSDYQAYAKLV
FT                   NERPIATLRDLLAIKPQGTPIPVDQVEPAESLFKRFDTAAMSIGALSPEAHESLAIAMN
FT                   SLGGFSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQIKVAQGAKPGE
FT                   GGQLPGDKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQVNPKAMISVK
FT                   LVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELGLVETQQALVA
FT                   NGLRHKIRLQVDGGLKTGVDIVKAAILGAESFGFGTGPMVALGCKYLRICHLNNCATGV
FT                   ATQDEKLRRDHYHGLPERVVNYFHFIARETREIMAELGVSQLVDLIGRTDMLLELDGIS
FT                   AKQNKLDLSPMLKTATPHPGKALYCTESNPPFDKGLLNKELLSQAEPYIEAKQSKTFYF
FT                   DIRNTDRSVGAALSGAIATKHGDQGLATDPIKAYFSGTAGQSFGVWNAGGVELMLTGDA
FT                   NDYVGKGMAGGRIAVRPPVGSNFRSHEASIIGNTCLYGATGGKLFAAGRAGERFAVRNS
FT                   GAITVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEFRKRVNPELV
FT                   EVLDVEQLAIHEEHLRGLITEHVQLTGSSRGEEILANWPEWVTKFALVKPKSSDVKALL
FT                   GHRSRSAAELRVQAQ"
FT   gene            141374..142792
FT                   /gene="gltD"
FT                   /locus_tag="y0129"
FT   CDS_pept        141374..142792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="y0129"
FT                   /product="glutamate synthase, small subunit"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 1 to 472 of 472 are 84.32 pct identical to
FT                   residues 1 to 472 of 472 from E. coli K12 : B3213; residues
FT                   1 to 472 of 472 are 84.74 pct identical to residues 1 to
FT                   472 of 472 from GenPept : >gb|AAK94788.1| (AY035435)
FT                   glutamate synthase small subunit [Klebsiella aerogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:y0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83723"
FT                   /db_xref="GOA:Q8D1R3"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R3"
FT                   /protein_id="AAM83723.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSETQAKAQAD
FT                   RCLSCGNPYCEWKCPVHNYIPNWLKLANEGRIMEAADLAHQTNSLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYISDKAIAMGWKPDMSHVHPTGKRVAVIGAGPAGLACAD
FT                   VLARNGVQAVVFDRHPEIGGLLTFGIPAFKLEKEVMIKRRKIFSEMGIEFQLNTEVGKD
FT                   ITMEALLKDYDPVFLGVGTYQSMRGGLENEEANGVYDALPFLIANTKQLMGYEATAHEP
FT                   YINMQGKRVVVLGGGDTAMDCVRSSIRQGATDVVCAYRRDEVNMPGSKREVKNAREEGV
FT                   EFKFNLQPLSIEVNSNGKVCGVRMVRTQLGAPDAQGRRMAEQIPGSEHVLPADAVVMAF
FT                   GFRPHSMEWLAAHDVKLDKQGRVIAPESTDNAFQTSNPKIFAGGDIVRGSDLVVTAIAE
FT                   GRKAADGIMNYLEV"
FT   gene            143233..143718
FT                   /locus_tag="y0130"
FT   CDS_pept        143233..143718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0130"
FT                   /product="hypothetical"
FT                   /note="residues 22 to 72 of 161 are 33.33 pct identical to
FT                   residues 2690 to 2740 of 3744 from GenPept :
FT                   >gb|AAB68923.1| (U00060) Tra1p [Saccharomyces cerevisiae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83724"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2U2GZM2"
FT                   /protein_id="AAM83724.1"
FT                   /translation="MKFHLPFIVGGLLAMSSSAFAMSLNYQEVGYNIEARGARAVVAEL
FT                   EKSGQLPAVENNIKLGDDNWIAMAPKLASAGNPKFTEGVKSALSSALIYNPAAVLKAVS
FT                   GSKILTLSDVCTAPIDVKDSEAKANFQQRASRTLLTIKNSDMAGPRDSCLAELKKLS"
FT   gene            complement(143871..144386)
FT                   /gene="sspB"
FT                   /locus_tag="y0131"
FT   CDS_pept        complement(143871..144386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="y0131"
FT                   /product="stringent starvation protein B"
FT                   /function="regulator; global regulatory functions"
FT                   /note="residues 1 to 171 of 171 are 72.51 pct identical to
FT                   residues 1 to 165 of 165 from E. coli K12 : B3228"
FT                   /db_xref="EnsemblGenomes-Gn:y0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83725"
FT                   /db_xref="GOA:A0A3N4AZB4"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZB4"
FT                   /protein_id="AAM83725.1"
FT                   /translation="MEMSDMSPRRPYLLRAFYEWLIDNQLTPHLVVDVTRPGVSVPMEF
FT                   ARDGQIVLNVAPRAVGNLELSNDDVRFNARFGGVPRQVTVPIAAVMAIYARENGSGTMF
FT                   EPEAAYDADADGNFEGIEGKENETAPTESLMLVTDDTRVEQDDDNSPDDKPPQPPRSGG
FT                   RPALRVVK"
FT   gene            complement(144392..145033)
FT                   /gene="sspA"
FT                   /locus_tag="y0132"
FT   CDS_pept        complement(144392..145033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="y0132"
FT                   /product="regulator of transcription; stringent starvation
FT                   protein A"
FT                   /function="regulator; global regulatory functions"
FT                   /note="residues 1 to 209 of 213 are 83.73 pct identical to
FT                   residues 1 to 209 of 212 from E. coli K12 : B3229; residues
FT                   1 to 213 of 213 are 100.00 pct identical to residues 1 to
FT                   213 of 213 from GenPept : >emb|CAC92790.1| (AJ414157)
FT                   putative stringent starvation protein A [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83726"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWJ8"
FT                   /protein_id="AAM83726.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMH
FT                   RIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAP
FT                   LLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHLKTRS"
FT   gene            complement(145407..145805)
FT                   /gene="rpsI"
FT                   /locus_tag="y0133"
FT   CDS_pept        complement(145407..145805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="y0133"
FT                   /product="30S ribosomal subunit protein S9"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 3 to 132 of 132 are 92.30 pct identical to
FT                   residues 1 to 130 of 130 from E. coli K12 : B3230; residues
FT                   3 to 132 of 132 are 93.07 pct identical to residues 1 to
FT                   130 of 130 from GenPept : >gb|AAL22213.1| (AE008854) 30S
FT                   ribosomal subunit protein S9 [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83727"
FT                   /db_xref="GOA:Q8ZB62"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB62"
FT                   /protein_id="AAM83727.1"
FT                   /translation="MAMAENQYYGTGRRKSSSARVFLKPGSGKIVINQRSLEVYFGRET
FT                   ARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAG
FT                   FVTRDAREVERKKVGLRKARRRPQFSKR"
FT   gene            complement(145814..146257)
FT                   /gene="rplM"
FT                   /locus_tag="y0134"
FT   CDS_pept        complement(145814..146257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="y0134"
FT                   /product="50S ribosomal subunit protein L13"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 6 to 147 of 147 are 95.07 pct identical to
FT                   residues 1 to 142 of 142 from E. coli K12 : B3231"
FT                   /db_xref="EnsemblGenomes-Gn:y0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83728"
FT                   /db_xref="GOA:Q0WB88"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WB88"
FT                   /protein_id="AAM83728.1"
FT                   /translation="MGKLLMKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKH
FT                   KAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYHHTGFVGGIKQATFEEMIARRPER
FT                   VIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQPQVLDI"
FT   gene            complement(146556..147695)
FT                   /locus_tag="y0135"
FT   CDS_pept        complement(146556..147695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0135"
FT                   /product="hypothetical protein"
FT                   /note="residues 5 to 378 of 379 are 64.97 pct identical to
FT                   residues 1 to 373 of 375 from E. coli K12 : B3232; residues
FT                   5 to 379 of 379 are 66.66 pct identical to residues 1 to
FT                   374 of 374 from GenPept : >gb|AAL22215.1| (AE008854)
FT                   putative ATPase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83729"
FT                   /db_xref="GOA:Q8D1R1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R1"
FT                   /protein_id="AAM83729.1"
FT                   /translation="MRINMQQSSPITLYQQALDAGGYQPDDVQRRAVARLETIYQALNQ
FT                   YQNVPAASASLRNRLGRLFGKPARRPPVSPVQGLYMWGGVGRGKTWLMDLFFHSLPGER
FT                   KLRLHFHRFMLRVHQELTELQGHENPLEIVADGFKAQTDVLCFDEFFVSDITDAMLLAT
FT                   LLEALFARGITLVATSNIPPDNLYHNGLQRGRFLPAIALIKQHCEVMNVDAGIDYRLRT
FT                   LTQANLYLTPLNSQTEQAMAAIFVKLAGKEGGKATVLEVNHRPLPAICVAEGVLAVDFH
FT                   TLCEEARSQLDYIALSKRYHTVLLHNVRCMAARDENTARRFLALVDEFYERRVKLIIAA
FT                   EASMFEIYSGERLKFEYQRCLSRLQEMQSEEYLSLPHLP"
FT   gene            147907..148311
FT                   /locus_tag="y0136"
FT   CDS_pept        147907..148311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0136"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 127 of 134 are 80.31 pct identical to
FT                   residues 3 to 128 of 134 from E. coli K12 : B3233; residues
FT                   1 to 127 of 134 are 80.31 pct identical to residues 3 to
FT                   128 of 134 from GenPept : >gb|AAL22216.1| (AE008854)
FT                   putative periplasmic protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83730"
FT                   /db_xref="GOA:A0A2S9PCX9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PCX9"
FT                   /protein_id="AAM83730.1"
FT                   /translation="MTWEYALIGLVVGVVIGAVAMRFGNRKLRQQQVLQNELEKSKTDL
FT                   EEYRQELVGHFARSAELLDNMARDYRQLYQHMAKSSNNLLPDLPLQDNPFRYRLTESEA
FT                   DNDQAPVKLPPRDYSEGASGLLRPEHQNRD"
FT   gene            148564..149955
FT                   /gene="degQ"
FT                   /locus_tag="y0137"
FT   CDS_pept        148564..149955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="y0137"
FT                   /product="serine endoprotease"
FT                   /function="enzyme; degradation of proteins, peptides,
FT                   glyco"
FT                   /note="residues 7 to 463 of 463 are 72.05 pct identical to
FT                   residues 1 to 455 of 455 from E. coli K12 : B3234; residues
FT                   7 to 463 of 463 are 72.92 pct identical to residues 1 to
FT                   455 of 455 from GenPept : >gb|AAL22217.1| (AE008854) serine
FT                   endoprotease [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83731"
FT                   /db_xref="GOA:Q8D1R0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1R0"
FT                   /protein_id="AAM83731.1"
FT                   /translation="MREFKSMKKTSLLLSALAISVGLGLASVPMVSAAALPAAVAGQTL
FT                   PSLAPMLEKVLPAVVSVHVSGSQAQQQRLPEEFKFFFGPNAPSGKESSRPFEGLGSGVI
FT                   INAEKGYILTNNHVINNADKIRVQLNDGREYDAKLLGRDEQTDIALLQLTDAKNLTAIK
FT                   IADSDNLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNS
FT                   GGALVNLDGELIGINTAILAPGGGNIGIGFAIPSNMAQNLSQQLIEFGEVKRGLLGIRG
FT                   SEMTADIAKAFNIDAQRGAFVSEVLPKSAAAKAGIKPGDVLISVDGKKISSFAELRAKV
FT                   GTTGPGKTIKIGLLREGKPLEVSVTLDNSSSTSTSAENLSPSLQGASLSNGELKDGSKG
FT                   IKVDSVTKGSPAAQSGLQKDDVIIAVNRERVKDIAELRKAIEAKPAVIALNIVRGEDNI
FT                   YLLIR"
FT   mobile_element  complement(149966..150675)
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            complement(150072..150581)
FT                   /locus_tag="y0138"
FT   CDS_pept        complement(150072..150581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0138"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 99.40 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83732"
FT                   /db_xref="GOA:A0A0H2W6E9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W6E9"
FT                   /protein_id="AAM83732.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            150756..151844
FT                   /gene="degS"
FT                   /locus_tag="y0139"
FT   CDS_pept        150756..151844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="y0139"
FT                   /product="protease"
FT                   /function="enzyme; degradation of proteins, peptides,
FT                   glyco"
FT                   /note="residues 1 to 349 of 362 are 71.22 pct identical to
FT                   residues 1 to 350 of 355 from E. coli K12 : B3235"
FT                   /db_xref="EnsemblGenomes-Gn:y0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83733"
FT                   /db_xref="GOA:A0A3N4B767"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B767"
FT                   /protein_id="AAM83733.1"
FT                   /translation="MFLKLLRSIILGLIVAGILLVALPMLRSPGYLFSGKSNNVNEEVP
FT                   TSYNQAVRRAAPAVVNVYNRSLSATQQGLAIRTLGSGVIMSDKGYILTNKHVINDAEQI
FT                   IVAMQNGRISEALLVGSDNLTDLAVLKIDATNLPVIPININRTPHIGDVVLAIGNPYNL
FT                   GQTVTQGIISATGRIGLSSSGRQNFLQTDASINQGNSGGALVNTLGELMGINTLSFDKS
FT                   NNGETPEGIGFAIPTALATKVMEKLIRDGRVIRGYIGITGEEYPPFNANDNGSDRVHGI
FT                   KVKKVSPDGPAAQAGIHVGDIILNVNNKPATSVIETMDQVAEVRPGTTIPVLLLRNGQQ
FT                   IAVQITITELDQNEMLTTQAAD"
FT   gene            complement(152025..153287)
FT                   /gene="murA"
FT                   /locus_tag="y0140"
FT   CDS_pept        complement(152025..153287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="y0140"
FT                   /product="UDP-N-glucosamine 1-carboxyvinyltransferase"
FT                   /function="enzyme; murein sacculus, peptidoglycan"
FT                   /note="first step in murein biosynthesis; residues 1 to 420
FT                   of 420 are 88.80 pct identical to residues 1 to 419 of 419
FT                   from E. coli K12 : B3189; residues 1 to 420 of 420 are
FT                   100.00 pct identical to residues 1 to 420 of 420 from
FT                   GenPept : >emb|CAC92798.1| (AJ414157)
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83734"
FT                   /db_xref="GOA:Q8ZB56"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB56"
FT                   /protein_id="AAM83734.1"
FT                   /translation="MDKFRVQGRTRLSGEVTISGAKNAALPILFAALLAEEPVELQNVP
FT                   KLKDIDTTIKLLSQLGTKIERNNGSVFVDASAVNEFCAPYDLVKTMRASIWALGPLVAR
FT                   FGQGQVSLPGGCAIGARPVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVS
FT                   VGATVTIMSAATLAEGTTVIENAAREPEIVDTANFLNTLGAKISGAGTDRITIEGVTRL
FT                   GGGVYRVLPDRIETGTFLVAAAISGGKVVCRQTRPDTLDAVLAKLREAGADIEVGDDWI
FT                   SLDMQGKRPKAITFRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELI
FT                   RMGAHAEIESNTVICYGVEQLSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRG
FT                   YERIEDKLRALGAKIERVKGE"
FT   gene            complement(153441..153704)
FT                   /locus_tag="y0141"
FT   CDS_pept        complement(153441..153704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0141"
FT                   /product="hypothetical protein"
FT                   /note="residues 4 to 87 of 87 are 80.95 pct identical to
FT                   residues 6 to 89 of 89 from E. coli K12 : B3190; residues 4
FT                   to 87 of 87 are 80.95 pct identical to residues 6 to 89 of
FT                   89 from GenPept : >gb|AAG58324.1|AE005547_10 (AE005547)
FT                   orf, hypothetical protein [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83735"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WB81"
FT                   /protein_id="AAM83735.1"
FT                   /translation="MNLMDTNEIKDVLMNALALQEAHVTGDGSHFQVIVVGELFADMNR
FT                   VKKQQAVYAPLMEYIADNRIHALSIKAYTPQEWQRDRKLNGF"
FT   gene            complement(153842..154144)
FT                   /locus_tag="y0142"
FT   CDS_pept        complement(153842..154144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0142"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 90 of 100 are 43.33 pct identical to
FT                   residues 33 to 122 of 129 from E. coli K12 : B3191;
FT                   residues 1 to 90 of 100 are 43.33 pct identical to residues
FT                   33 to 122 of 129 from GenPept : >gb|AAG58325.1|AE005547_11
FT                   (AE005547) yrbB gene product [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83736"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWI9"
FT                   /protein_id="AAM83736.1"
FT                   /translation="MAGELSWQSLQETLVLQGELDRETLLPLWQQRETLLADKSRIDVS
FT                   QLQRVDSSGLALLVHFRELQSQRGHSLEIIGISNRLATLIELYNLQQIIPVETAS"
FT   gene            complement(154180..154803)
FT                   /locus_tag="y0143"
FT   CDS_pept        complement(154180..154803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0143"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 207 of 207 are 77.51 pct identical to
FT                   residues 1 to 209 of 211 from E. coli K12 : B3192; residues
FT                   1 to 207 of 207 are 77.51 pct identical to residues 1 to
FT                   209 of 211 from GenPept : >gb|AAL22179.1| (AE008852)
FT                   putative ABC superfamily (atp and memb), transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83737"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWK8"
FT                   /protein_id="AAM83737.1"
FT                   /translation="MFKRLFMVALLAIAPLVHAVDQSNPYRLMDEAAKKTFTRLKNEQP
FT                   KIKQNPDYLRTIVREELLPFVQIKYAGALVLGSYYKDATPAQREAYFNAFGKYLEQAYG
FT                   QALALYHGQTYDVAPDQPLGDANIVAIRVTILDPSGRPPVRLDFQWRKNSQTGNWQAYD
FT                   MIAEGVSMISTKQNEWASILRQKGVDGLTQQLLSAAKQPITLDK"
FT   gene            complement(154816..155388)
FT                   /locus_tag="y0144"
FT   CDS_pept        complement(154816..155388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0144"
FT                   /product="hypothetical protein"
FT                   /note="residues 6 to 178 of 190 are 71.67 pct identical to
FT                   residues 1 to 170 of 183 from E. coli K12 : B3193; residues
FT                   6 to 184 of 190 are 67.59 pct identical to residues 1 to
FT                   179 of 183 from GenPept : >gb|AAL22180.1| (AE008852)
FT                   putative ABC superfamily (bind_prot) transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83738"
FT                   /db_xref="GOA:Q8D1Q9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q9"
FT                   /protein_id="AAM83738.1"
FT                   /translation="MGTESMQTKKSEVWVGMFILIAILAVIFLCLKVADIKSVGNQPTY
FT                   RIYANFDNIGGLKNHSPVKIGGVVVGRVAEITLDTKNYTPRVAIDIQQRYNHIPDTSSL
FT                   AVRTSGLLGEQFLALNVGFEDPEMGTSILKDGGTIQDTKSALVLEDLIGQFLYKSSGDS
FT                   PAVSETAPATETAAPQAAVPSLPAQHP"
FT   gene            complement(155378..156160)
FT                   /locus_tag="y0145"
FT   CDS_pept        complement(155378..156160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0145"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 260 of 260 are 82.69 pct identical to
FT                   residues 1 to 260 of 260 from E. coli K12 : B3194"
FT                   /db_xref="EnsemblGenomes-Gn:y0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83739"
FT                   /db_xref="GOA:A0A3N4AWJ1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWJ1"
FT                   /protein_id="AAM83739.1"
FT                   /translation="MLVKSLASLGRRGINVCASFGRAGLMLFNALVGRPEPRKQWPLLI
FT                   KQLYSVGVQSLLIIVVSGLFIGMVLGLQGFLILTTYSAEASLGMMVSLSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQISSLEMMAIDPLRRVVAPRFWAGLISMPLLTAIFV
FT                   AVGIWGGSVVGVDWKGIDSGFFWSAMQNAVEWRTDLLNCLIKSLVFALTVTWIALFNGY
FT                   DAVPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   gene            complement(156378..157196)
FT                   /locus_tag="y0146"
FT   CDS_pept        complement(156378..157196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0146"
FT                   /product="putative ATP-binding component of ABC transport
FT                   system"
FT                   /function="putative transport"
FT                   /note="residues 4 to 269 of 272 are 78.19 pct identical to
FT                   residues 1 to 266 of 269 from E. coli K12 : B3195"
FT                   /db_xref="EnsemblGenomes-Gn:y0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83740"
FT                   /db_xref="GOA:A0A2S9PIR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PIR8"
FT                   /protein_id="AAM83740.1"
FT                   /translation="MKQLASNVMNLIEIRGMSFTRGERLIFADINMTVPRGKVTAIMGP
FT                   SGIGKTTLLRLIGGQLAPDTGEIWFDGDNIPALSRQRLYDVRKKMSMLFQSGALFTDLT
FT                   VFENVAFPLREHSRLPEELLHSTVMMKLEAVGLRGAANLMPAELSGGMARRAALARAIA
FT                   LDPELIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCVVVSHDVPEVLSIADYAYIVA
FT                   DQHVIAEGTPEQLQTNSDMRVRQFLDGIADGPVPFRFPAGDYKTELLYPK"
FT   gene            157461..158435
FT                   /locus_tag="y0147"
FT   CDS_pept        157461..158435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0147"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 318 of 324 are 60.69 pct identical to
FT                   residues 1 to 318 of 325 from E. coli K12 : B3196; residues
FT                   1 to 318 of 324 are 63.52 pct identical to residues 1 to
FT                   318 of 325 from GenPept : >emb|CAD07831.1| (AL627278)
FT                   putative membrane protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83741"
FT                   /db_xref="GOA:A0A3N4AZY0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZY0"
FT                   /protein_id="AAM83741.1"
FT                   /translation="MFLAITLLIIGLVLLVYGADRLVYGAAVLSRSFGVPPLIIGMTIV
FT                   GIGTSLPELIVSVTAALNGQTDMAVGNVLGSNITNLLLIVGGAALIRPLIVRSEILRRE
FT                   LPLMLVVTALCGFLLADNHLSRGDGVILLLAAAAFIVLMLKIARLAHAEGNDILTREQL
FT                   SELPQDSSTTVALLWLVLAFIILPLSAKMIIDNATVIARVAGVSELVIGLTVIAIGTSL
FT                   PELATFIAGALKGENDIAVGNIIGSNIFNIVIVLGVPALLSPGEINPEAFQRDYWVMLA
FT                   VSVVFTLLCLGRKHRIGHLAGALLLCGFITYLAVLFFAPISAL"
FT   gene            158459..159532
FT                   /locus_tag="y0149"
FT   CDS_pept        158459..159532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0149"
FT                   /product="putative isomerase"
FT                   /note="residues 30 to 357 of 357 are 77.43 pct identical to
FT                   residues 1 to 328 of 328 from E. coli K12 : B3197; residues
FT                   30 to 357 of 357 are 78.65 pct identical to residues 1 to
FT                   328 of 328 from GenPept : >gb|AAL22184.1| (AE008852)
FT                   putative polysialic acid capsule expression protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83742"
FT                   /db_xref="GOA:Q8D1Q8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1Q8"
FT                   /protein_id="AAM83742.1"
FT                   /translation="MLRKAWSESNQHTYSVKDDGNTNIGRILSMSTFDLQPGVDFQQAG
FT                   KQVLQIEREGLAQLDQYINEDFSRACEAIFRCHGKVVVMGMGKSGHIGCKIAATFASTG
FT                   TPAFFVHPGEASHGDLGMITPQDIVLAISNSGESNEILTLIPVLKRQKILLICMSSNPE
FT                   STMGKAADIHLCINVPQEACPLGLAPTTSTTATLVMGDALAVALLKARGFTQEDFALSH
FT                   PGGALGRKLLLRISDIMHTGTEIPTVSPDASLRDALLEITRKSLGLTVICDDSMRIKGI
FT                   FTDGDLRRVFDMGIDLNNAKIADVMTRGGIRVPPNILAVDALNLMESRHITALLVADGD
FT                   QLLGVVHMHDMLRAGVV"
FT   gene            complement(159121..159408)
FT                   /locus_tag="y0148"
FT   CDS_pept        complement(159121..159408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0148"
FT                   /product="hypothetical"
FT                   /note="residues 18 to 78 of 95 are 32.78 pct identical to
FT                   residues 645 to 704 of 918 from GenPept : >gb|AAA33114.1|
FT                   (M33154) nitrate reductase [Cucurbita maxima]"
FT                   /db_xref="EnsemblGenomes-Gn:y0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV4"
FT                   /protein_id="AAM83743.1"
FT                   /translation="MFGGTRIPPRVMTSAIFALFRSMPISNTRRKSPSVKIPLILIESS
FT                   QITVKPRLFRVISSKASRNDASGLTVGISVPVCIISLIRSSNLRPSAPPG"
FT   gene            159781..160344
FT                   /locus_tag="y0150"
FT   CDS_pept        159781..160344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0150"
FT                   /product="hypothetical protein"
FT                   /note="residues 5 to 187 of 187 are 77.04 pct identical to
FT                   residues 6 to 188 of 188 from E. coli K12 : B3198"
FT                   /db_xref="EnsemblGenomes-Gn:y0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83744"
FT                   /db_xref="GOA:Q8ZB47"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:3IJ5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB47"
FT                   /protein_id="AAM83744.1"
FT                   /translation="MSNTAYIDTCYGPVADDVIQRAANIRLLICDVDGVMSDGLIYMGN
FT                   QGEELKAFNVRDGYGIRCLITSDIDVAIITGRRAKLLEDRANTLGITHLYQGQSDKLVA
FT                   YHELLATLQCQPEQVAYIGDDLIDWPVMAQVGLSVAVADAHPLLLPKAHYVTRIKGGRG
FT                   AVREVCDLILLAQDKLEGATGLSI"
FT   gene            160341..160904
FT                   /locus_tag="y0151"
FT   CDS_pept        160341..160904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0151"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 186 of 187 are 55.91 pct identical to
FT                   residues 1 to 185 of 191 from E. coli K12 : B3199"
FT                   /db_xref="EnsemblGenomes-Gn:y0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83745"
FT                   /db_xref="GOA:A0A3N4B106"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B106"
FT                   /protein_id="AAM83745.1"
FT                   /translation="MSKTRRWITLVLALIALALIGWNMSGFNQQGAPVVADDNEPSSQS
FT                   QHTVTTVFNPVGQLNYKLVAEEVQNFSAKELTWFTKPVMTLFGDNAVATWTVRADRAKL
FT                   TDDKMLYLYGHVEVDSLTADAQLKKIRTDNAQVNLITQDVASDDEVTLFGIGFTSEGMR
FT                   IRGNLRDKTAELIEKVKTSYEIQK"
FT   gene            160867..161433
FT                   /locus_tag="y0152"
FT   CDS_pept        160867..161433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0152"
FT                   /product="hypothetical protein"
FT                   /note="residues 8 to 177 of 188 are 69.76 pct identical to
FT                   residues 1 to 172 of 185 from E. coli K12 : B3200; residues
FT                   8 to 187 of 188 are 69.94 pct identical to residues 1 to
FT                   183 of 184 from GenPept : >gb|AAL22187.1| (AE008852)
FT                   putative ABC superfamily (bind_prot) transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83746"
FT                   /db_xref="GOA:Q8D1Q7"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q7"
FT                   /protein_id="AAM83746.1"
FT                   /translation="MKRLKPLMKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKS
FT                   DKQTLDMETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQ
FT                   DSGKPVKGHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGK
FT                   RVTTVLLPSQLQDKGPAASGQKKSK"
FT   gene            161440..162165
FT                   /locus_tag="y0153"
FT   CDS_pept        161440..162165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0153"
FT                   /product="putative ATP-binding component of ABC transport
FT                   system"
FT                   /function="putative transport"
FT                   /note="residues 1 to 241 of 241 are 88.79 pct identical to
FT                   residues 1 to 241 of 241 from E. coli K12 : B3201; residues
FT                   1 to 241 of 241 are 88.79 pct identical to residues 1 to
FT                   241 of 241 from GenPept : >gb|AAL22188.1| (AE008852)
FT                   putative ABC superfamily (atp_bind) transport protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83747"
FT                   /db_xref="GOA:A0A380PHQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PHQ8"
FT                   /protein_id="AAM83747.1"
FT                   /translation="MATLIAEKLAKAYKGRKVVEDVSLNVKSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVQRDAGRIVIDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLE
FT                   IRKDLSAEQREERAEELMEEFHINHLRDSLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIKHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQ
FT                   DILADEQVKRVYLGEEFRL"
FT   gene            162227..163660
FT                   /gene="rpoN"
FT                   /locus_tag="y0154"
FT   CDS_pept        162227..163660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="y0154"
FT                   /product="RNA polymerase, sigma(54 or 60) factor"
FT                   /function="regulator; global regulatory functions"
FT                   /note="nitrogen and fermentation regulation; residues 1 to
FT                   477 of 477 are 82.59 pct identical to residues 1 to 477 of
FT                   477 from E. coli K12 : B3202; residues 1 to 477 of 477 are
FT                   82.38 pct identical to residues 1 to 477 of 477 from
FT                   GenPept : >emb|CAA26925.1| (X03147) ntrA protein (aa 1-477)
FT                   [Klebsiella pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83748"
FT                   /db_xref="GOA:A0A380PH56"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PH56"
FT                   /protein_id="AAM83748.1"
FT                   /translation="MKQGLQLKFSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESNP
FT                   LLEQTDLHEEIDAKETVDSESLDTREALEQKDMPEELPLDATWDEIYTAGTPSGMGNDY
FT                   SDDELPVYQGETTQTLQDYLMWQVDLTPFTETDAAIATSIVDAVDDTGYLTVPLEDILE
FT                   SMGDENVALDEVEAVLKRIQHFDPIGVAARNLRECLLVQLSQYAKDTPYLAEARLIVSE
FT                   YLDLLGNHDFRMMIRLSRLKEDTLKEAIALIQSLDPRPGQSINTGESEYVIPDVLVRKE
FT                   KGIWTVELNADSIPRLKVNQQYAAMGNSVRNDSDGQFIRSNLQEAKWLIKSLESRNETL
FT                   LKVARCIVEQQVEFFEKGAEFMKPMVLADIAQAVDMHESTISRVTTQKFLHSPRGIFEL
FT                   KYFFSSHVNTDSGGEASSTAIRALVKKLVAAENPAKPLSDSKLTTLLCEQGIMVARRTV
FT                   AKYRESLSIPPSNQRKQLV"
FT   gene            163684..163791
FT                   /locus_tag="y0155"
FT   CDS_pept        163684..163791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0155"
FT                   /product="putative sigma-54 modulation protein"
FT                   /function="putative regulator; global regulatory functions"
FT                   /note="residues 1 to 35 of 35 are 94.28 pct identical to
FT                   residues 1 to 35 of 95 from GenPept : >gb|AAL22190.1|
FT                   (AE008852) putative sigma N modulation factor [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83749"
FT                   /db_xref="GOA:Q8D1Q6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q6"
FT                   /protein_id="AAM83749.1"
FT                   /translation="MQLNITGHHVEITEALREFVTTKFAKLEQYFDRIN"
FT   gene            163798..163971
FT                   /locus_tag="y0156"
FT   CDS_pept        163798..163971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0156"
FT                   /product="probable sigma-54 modulation protein"
FT                   /function="putative regulator; global regulatory functions"
FT                   /note="residues 1 to 57 of 57 are 73.68 pct identical to
FT                   residues 39 to 95 of 95 from E. coli K12 : B3203; residues
FT                   1 to 57 of 57 are 77.19 pct identical to residues 39 to 95
FT                   of 95 from GenPept : >emb|CAA34391.1| (X16335) ORF95
FT                   peptide (AA 1-95) [Klebsiella pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83750"
FT                   /db_xref="GOA:Q8D1Q5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q5"
FT                   /protein_id="AAM83750.1"
FT                   /translation="MVLSVEKVKQIAEATVHVNGGELHASSEQEDMYAAIDILVDKLAR
FT                   QLNKHKDKLKQH"
FT   gene            164077..164571
FT                   /gene="ptsN"
FT                   /locus_tag="y0157"
FT   CDS_pept        164077..164571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="y0157"
FT                   /product="phosphotransferase system enzyme IIA"
FT                   /function="enzyme; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="regulates N metabolism; residues 7 to 158 of 164 are
FT                   86.18 pct identical to residues 4 to 155 of 163 from E.
FT                   coli K12 : B3204; residues 7 to 158 of 164 are 86.18 pct
FT                   identical to residues 4 to 155 of 163 from GenPept :
FT                   >gb|AAG58338.1|AE005548_9 (AE005548) phosphotransferase
FT                   system enzyme IIA, regulates N metabolism [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83751"
FT                   /db_xref="GOA:Q8D1Q4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q4"
FT                   /protein_id="AAM83751.1"
FT                   /translation="MKDEMTNDPALQLSSVLNIESTKSSVHCSSKKRALEIISELAAKQ
FT                   LNLPSQVVFDAVLTRERMGSTGIGSGIAIPHGKLEEDTLRAVGVFIRLEQPIAFDAIDN
FT                   QPVDLLFALLVPADQCKTHLHTLSLVAKRLADKTVCRRLRSAQSDDELYQIITELPPEI
FT                   A"
FT   gene            164877..165731
FT                   /locus_tag="y0158"
FT   CDS_pept        164877..165731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0158"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 283 of 284 are 94.34 pct identical to
FT                   residues 1 to 283 of 284 from E. coli K12 : B3205"
FT                   /db_xref="EnsemblGenomes-Gn:y0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83752"
FT                   /db_xref="GOA:Q8ZB41"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB41"
FT                   /protein_id="AAM83752.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPQLASTLA
FT                   DRNISAAVSIDVRNMPESPEVFEHAMTQLPDSFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSAKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVISFLDRHTEVHNFIYQT
FT                   RSYLEQWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRARGKNVQSRHRTLEK
FT                   RKQ"
FT   gene            165728..166000
FT                   /gene="ptsO"
FT                   /locus_tag="y0159"
FT   CDS_pept        165728..166000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="y0159"
FT                   /product="phosphocarrier protein HPr-like NPr"
FT                   /function="transport; transport of small molecules; Other"
FT                   /note="nitrogen related, exchanges phosphate with Enzyme I,
FT                   Hpr; residues 1 to 90 of 90 are 87.77 pct identical to
FT                   residues 1 to 90 of 90 from E. coli K12 : B3206; residues 1
FT                   to 90 of 90 are 85.55 pct identical to residues 1 to 90 of
FT                   90 from GenPept : >gb|AAL22193.1| (AE008853) NPr,
FT                   phosphocarrier protein HPr-like NPr, nitrogen related,
FT                   exchanges phosphate with Enzyme I [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83753"
FT                   /db_xref="GOA:A0A2S9PIQ8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PIQ8"
FT                   /protein_id="AAM83753.1"
FT                   /translation="MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAE
FT                   ASSVIALLMLDSAKGRQIEVEATGVDEIQALAAVIELFNSGFDED"
FT   gene            complement(165896..166147)
FT                   /locus_tag="y0160"
FT   CDS_pept        complement(165896..166147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0160"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BLD8"
FT                   /protein_id="AAM83754.1"
FT                   /translation="MHVVQQNIGGFSSFPPANCGELYSRLISLQGVKIVFFVLSKRLPT
FT                   LRAPLIFVKSRIKQLDNRCQCLNFINPGCFNLYLAAFG"
FT   gene            166338..167273
FT                   /gene="pyrB"
FT                   /locus_tag="y0161"
FT   CDS_pept        166338..167273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="y0161"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /function="enzyme; pyrimidine ribonucleotide biosynthesis"
FT                   /note="residues 1 to 311 of 311 are 84.88 pct identical to
FT                   residues 1 to 311 of 311 from E. coli K12 : B4245; residues
FT                   1 to 311 of 311 are 85.85 pct identical to residues 1 to
FT                   311 of 311 from GenPept : >gb|AAL23279.1| (AE008909)
FT                   aspartate carbamoyltransferase, catalytic subunit
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83755"
FT                   /db_xref="GOA:Q8ZB39"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="PDB:3LXM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB39"
FT                   /protein_id="AAM83755.1"
FT                   /translation="MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIV
FT                   MRHPQEGASRLAAQFSGNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGD
FT                   LKYGRTVHSLTQALAKFNGNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPE
FT                   LDILYMTRVQKERLDPSEYANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNAELAL"
FT   gene            167279..167749
FT                   /gene="pyrI"
FT                   /locus_tag="y0162"
FT   CDS_pept        167279..167749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="y0162"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /function="enzyme; pyrimidine ribonucleotide biosynthesis"
FT                   /note="residues 3 to 153 of 156 are 78.80 pct identical to
FT                   residues 1 to 151 of 153 from E. coli K12 : B4244; residues
FT                   3 to 156 of 156 are 83.11 pct identical to residues 1 to
FT                   154 of 154 from GenPept : >gb|AAA26565.1| (J05033)
FT                   aspartate transcarbamoylase [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83756"
FT                   /db_xref="GOA:Q8ZB38"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB38"
FT                   /protein_id="AAM83756.1"
FT                   /translation="MMMTQDYKLQVEAIKCGTVIDHIPAQIGFKLLSLFKLTATDQRIT
FT                   IGLNLPSKRSGRKDLIKIENTFLTEQQANQLAMYAPDATVNRIDNYEVVKKLTLSLPER
FT                   IDAVLTCPNSNCISHNEPVDSSFTVKAQRGEISLKCKYCEKEFDHLTVLHAD"
FT   gene            167848..168273
FT                   /locus_tag="y0163"
FT   CDS_pept        167848..168273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0163"
FT                   /product="hypothetical protein"
FT                   /note="residues 11 to 141 of 141 are 83.20 pct identical to
FT                   residues 11 to 141 of 141 from E. coli K12 : B4243;
FT                   residues 14 to 141 of 141 are 85.93 pct identical to
FT                   residues 1 to 128 of 128 from GenPept : >gb|AAL23277.1|
FT                   (AE008909) putative translation initiation inhibitor
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83757"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q3"
FT                   /protein_id="AAM83757.1"
FT                   /translation="MISLSALRKSGVKMLRAIKTKLAPAAIGPYVQGVDLGSMIMTSGQ
FT                   IPIDPKTGLVADDIAAQARQSLENVKAIVEAAGLKVADIVKTTVFVKDLNDFSIVNATY
FT                   EAFFTEHSAPFPARSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            168572..169048
FT                   /locus_tag="y0164"
FT   CDS_pept        168572..169048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0164"
FT                   /product="hypothetical"
FT                   /note="residues 62 to 143 of 158 are 31.70 pct identical to
FT                   residues 1565 to 1640 of 3016 from GenPept :
FT                   >dbj|BAA17634.1| (D90907) ORF_ID:slr1403; integrin alpha-
FT                   and beta4- subunit domain homolog [Synechocystis sp. PCC
FT                   6803]"
FT                   /db_xref="EnsemblGenomes-Gn:y0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83758"
FT                   /db_xref="InterPro:IPR031948"
FT                   /db_xref="InterPro:IPR038643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGQ4"
FT                   /protein_id="AAM83758.1"
FT                   /translation="MKLRTWLLIPIICSPFFWGSTAIAKNGVAIPLPDKRVAVLSEGDL
FT                   ESASVGTYSVAIFKNDTFLDFIAGGVFSRDGSIFQDNGKPRVEFTDINGDGNKELIVSQ
FT                   LTAGSGNYLRVDAFSLGPDSINKVLSIQSDTKSDYISLLKELCEICLPIDAPPH"
FT   gene            169282..170235
FT                   /gene="treR"
FT                   /locus_tag="y0165"
FT   CDS_pept        169282..170235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="y0165"
FT                   /product="repressor of treA,B,C"
FT                   /function="regulator; osmotic adaptation"
FT                   /note="residues 1 to 316 of 317 are 62.02 pct identical to
FT                   residues 1 to 314 of 315 from E. coli K12 : B4241; residues
FT                   1 to 316 of 317 are 62.02 pct identical to residues 1 to
FT                   314 of 315 from GenPept : >dbj|BAB38641.1| (AP002568)
FT                   repressor of treA,B,C [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83759"
FT                   /db_xref="GOA:A0A3N4AWJ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWJ3"
FT                   /protein_id="AAM83759.1"
FT                   /translation="MQNRLTIKDIARMSGVGKSTVSRVLNNEGSVSPQTRERVEAVIRQ
FT                   HGFTPSKSARAMRGQSDKVVGIIVSRLDSPSENQAVRTMLPLFYQQGYDPILMESQFDT
FT                   TLVSEHLHILQQRHVDGVILFGFSGLTAEMLAPWQEKMVVLAREYRGFSSVCYDDEGAI
FT                   YLLMDKLRQAGHRHISYIGVQSSDATTGMRRYQAYLDYSQQHGLTPMVALGELSYQSGF
FT                   QLAPQVITPQTSALVCASDTIAMGVSKYLQQQEREQPPIQVCGIGNTPLLHFLFPDTLT
FT                   IELGYGRAGVKAAQQLLDQLSNSQPIQQIIIPGQLV"
FT   gene            170610..172061
FT                   /gene="treB"
FT                   /locus_tag="y0166"
FT   CDS_pept        170610..172061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="y0166"
FT                   /product="PTS system enzyme IIBC"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="trehalose specific; residues 13 to 483 of 483 are
FT                   80.46 pct identical to residues 2 to 472 of 473 from E.
FT                   coli K12 : B4240; residues 13 to 483 of 483 are 80.89 pct
FT                   identical to residues 2 to 472 of 473 from GenPept :
FT                   >dbj|BAB38640.1| (AP002568) trehalose specific PTS system
FT                   enzyme II [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83760"
FT                   /db_xref="GOA:Q0WAV9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WAV9"
FT                   /protein_id="AAM83760.1"
FT                   /translation="MRARNLYGKDDKMGKVKQQDIDQLIVLVGGRENIATVSHCITRLR
FT                   FVLKDPSIASPKEIENLSMVKGCFTNAGQFQVVIGPEVDDYYKALIAKIGQSEVDKEQT
FT                   KLAARQNMTWFERGISHFAEIFFPLLPALISGGLILGFRNVIGDIPMSEGKTLAQMYPA
FT                   WQTIYDFLWLLGEAIFFYLPVAICWSTVKKMGGTPVLGIVLGITLVSPQLMNSYLLGQQ
FT                   LPDVWNFGWFTIEKVGYQAQVIPSILAGLALGWIETNLKRIIPAYLYLVVVPVVSLLLA
FT                   VFLAHTLIGPFGRMIGDGVAWGVKAVMTGSFAPVGAALFGFLYAPLVITGVHQTTLAID
FT                   MQMVQSMGGTPVWPLIALSNIAQASAVLGIIIISRKINEREISVPAAISAYLGVTEPAM
FT                   YGINLKYRFPMLCAMIGSALAGLICGLTGVMANGIGVGGLPGILSIQPQFWGIYAVAML
FT                   VAIVVPLALTILVYKRKERRGELPV"
FT   gene            172156..173823
FT                   /gene="treC"
FT                   /locus_tag="y0167"
FT   CDS_pept        172156..173823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="y0167"
FT                   /product="trehalase 6-P hydrolase"
FT                   /function="enzyme; degradation of small molecules; Carbon
FT                   compounds"
FT                   /note="residues 7 to 553 of 555 are 73.85 pct identical to
FT                   residues 7 to 549 of 551 from E. coli K12 : B4239; residues
FT                   7 to 553 of 555 are 73.12 pct identical to residues 6 to
FT                   548 of 550 from GenPept : >emb|CAD06914.1| (AL627283)
FT                   trehalose-6-phosphate hydrolase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83761"
FT                   /db_xref="GOA:A0A3N4AWG6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWG6"
FT                   /protein_id="AAM83761.1"
FT                   /translation="MNNPIPWWQHGVIYQIYPKSFQDSTGNGYGDLAGVAQRLDYLQKL
FT                   GVDAIWLTPVYVSPQVDNGYDVADYCAIDPAYGTLDDFKRLVAGAHQRGIRIIMDMVFN
FT                   HTSTEHAWFKASQDRNSPYRQFYIWRDGDGGDGSLPNNWRSKFGGHAWQWHAASGQYYL
FT                   HLFAPEQADLNWEHQPVRDELKKVCEFWADLGVDGLRLDVINLVSKQQDFPNDLDGDGR
FT                   RFYTDGPRIHEFLQELSRDVFQPRRLMTVGEMSSTRLEHCQRYAALGGDELSMTFNFHH
FT                   LKVDYLNGEKWSLMPPNRVELKHIFNQWQQGMHNRAWNALFWCNHDQPRIVSRFGHEGA
FT                   LRLPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPNFTDITQYRDVESLNMFAELSVAGRE
FT                   PDELLAILAAKSRDNSRTPMQWDSSDNAGFSQGTPWIAPCSNYHEINVNAALADADSVF
FT                   YAYQYLIALRKQYDIFTFGDYQDLCPQHPDLWCYLRSWQGKQLLVVANLSEEPQRWQPE
FT                   GLTLDGNWQLLMSSYDQSAFQPQDMILRGYEGIYWVCE"
FT   gene            174176..174586
FT                   /gene="rnk"
FT                   /locus_tag="y0168"
FT   CDS_pept        174176..174586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="y0168"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /function="regulator; central intermediary metabolism:
FT                   Nucleotide interconversions"
FT                   /note="residues 1 to 134 of 136 are 64.92 pct identical to
FT                   residues 1 to 134 of 136 from E. coli K12 : B0610"
FT                   /db_xref="EnsemblGenomes-Gn:y0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83762"
FT                   /db_xref="GOA:A0A3N4BBG9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BBG9"
FT                   /protein_id="AAM83762.1"
FT                   /translation="MTKPTITINELDAERLDALLAQPAFAGSVVATALNEELDRAEILP
FT                   PNEIPADVVTMNSRVRFLDLNSQEEHIRTLVYPASLKDSNEQLSVMAPLGAALLGLHVN
FT                   DEISWKLPGGDETRITVLELLYQPESAGEYHR"
FT   gene            complement(174818..175210)
FT                   /gene="cybC"
FT                   /locus_tag="y0169"
FT   CDS_pept        complement(174818..175210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cybC"
FT                   /locus_tag="y0169"
FT                   /product="cytochrome b(562)"
FT                   /function="enzyme; energy metabolism, carbon: Electron
FT                   transport"
FT                   /note="residues 31 to 130 of 130 are 57.99 pct identical to
FT                   residues 1 to 100 of 100 from E. coli K12 : B4236; residues
FT                   3 to 130 of 130 are 52.34 pct identical to residues 1 to
FT                   128 of 128 from GenPept : >gb|AAL23259.1| (AE008908)
FT                   cytochrome b(562) [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83763"
FT                   /db_xref="GOA:Q8ZAU2"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAU2"
FT                   /protein_id="AAM83763.1"
FT                   /translation="MSMGKTLMALITAALLSTSSLVMAASVADDMETIAEHYGKVLKAD
FT                   STAVIKQDLQAMRVAAVDAQKGIPTKLKSKVEDSPEMKDFRHGMDVLIGEIDGALALAD
FT                   QGKLDEAKQAAQDFKDTRNTYHKKYR"
FT   gene            complement(175412..176056)
FT                   /locus_tag="y0170"
FT   CDS_pept        complement(175412..176056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0170"
FT                   /product="hypothetical"
FT                   /note="residues 25 to 134 of 214 are 23.21 pct identical to
FT                   residues 51 to 159 of 320 from GenPept : >gb|AAC06973.1|
FT                   (AE000710) pyridoxal phosphate biosynthetic protein PdxA
FT                   [Aquifex aeolicus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83764"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV2"
FT                   /protein_id="AAM83764.1"
FT                   /translation="MIMPVLIRGSSNMIVMPSTYSPATIAREFKVIHEFELSSMKYGVI
FT                   FDKNVPKAAIIRMNTESFNGIPRHRIIAALDLVAKQELGENVISVQRFWQDSALFQVEG
FT                   MVVEQGARGKGLATLLYEELVVKCGVILMSDNKQYEAGKALWQKIAQESDKLAVFILDS
FT                   DVGQFYPYCGDRVPYNGKGIPEEKIWSLHPDTTKWGVVLVAENREKISQYC"
FT   gene            complement(176305..177645)
FT                   /gene="pmbA"
FT                   /locus_tag="y0171"
FT   CDS_pept        complement(176305..177645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="y0171"
FT                   /product="PmbA/TldD family protein"
FT                   /function="phenotype; proteins - translation and
FT                   modification"
FT                   /note="maturation of antibiotic MccB17, see tld genes;
FT                   residues 1 to 446 of 446 are 82.73 pct identical to
FT                   residues 5 to 450 of 450 from E. coli K12 : B4235"
FT                   /db_xref="EnsemblGenomes-Gn:y0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83765"
FT                   /db_xref="GOA:A0A3N4BAE9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAE9"
FT                   /protein_id="AAM83765.1"
FT                   /translation="MKVVTQVAEQRKTLEQAVAQALELARVGSDAAEVAVSKTTGISVS
FT                   TRFGEVENVEFNSDGALGITVYHQQRKGSASTTDLNPDAVARTVQAALDIARYTSPDPY
FT                   AGPADKSLLAFDAPDLDLFHPGDLDAEQGILLAARAEQAALQADKRITNTEGGSFNSHY
FT                   GIKVFGNSHGMLQSYCSSRHSLSSSVIAEHNGDMERDYAYTIGRRMEDLATPEWVGEEC
FT                   ARRTLSRLSPRKLPTMQSPVLFAAEVATGLFGHLVSAISGGNIYRKSTFLLDHLGQQIL
FT                   PEWLTIEEHPHLLRGLASTPFDSEGVRTLQREIVKDGVLQTYLLTSYSARKLGLQSTGH
FT                   AGGIHNWRIAGQGQDFAGMLKQLDKGLVVTELMGQGVSTVTGDYSRGAAGFWVENGEIQ
FT                   YPVSEITIAGNLKDMLRNIVSVGSDIETRSNIQCGSVLLPVMKIAGE"
FT   gene            177820..178374
FT                   /locus_tag="y0172"
FT   CDS_pept        177820..178374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0172"
FT                   /product="putative alpha helix protein"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 3 to 183 of 184 are 78.02 pct identical to
FT                   residues 1 to 182 of 183 from E. coli K12 : B4234"
FT                   /db_xref="EnsemblGenomes-Gn:y0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83766"
FT                   /db_xref="GOA:Q8ZAU5"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAU5"
FT                   /protein_id="AAM83766.1"
FT                   /translation="MTMNKQPEDWLDDVPENKNDDDDEIIWVSKSEIKRDAEALKDLGT
FT                   ELVDLGKNALERIPLDEDLLAAIELAQKIKKEGRRRQLQLIGKMLRARDVEPIQTALDK
FT                   LKNRHNQQISLFHKLETLRDRLIAEGDEAIPTVLELYPDADRQQLRSLVRNAQKEQAAN
FT                   KPPKSFRQIFSYLRELAEKKQ"
FT   gene            complement(178486..178767)
FT                   /locus_tag="y0173"
FT   CDS_pept        complement(178486..178767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0173"
FT                   /product="hypothetical protein"
FT                   /note="residues 6 to 87 of 93 are 53.01 pct identical to
FT                   residues 6 to 88 of 90 from E. coli K12 : B3239"
FT                   /db_xref="EnsemblGenomes-Gn:y0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83767"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXT2"
FT                   /protein_id="AAM83767.1"
FT                   /translation="MVKVVFDFNHIPDLPAFYRAFSQNFALSEDFGANLDALWDVVTGE
FT                   IALPVEIEFVHFSRRHQRRFAAIVLLLEEAEEELAGRLHFNVVDEHIV"
FT   gene            complement(178772..179245)
FT                   /locus_tag="y0174"
FT   CDS_pept        complement(178772..179245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0174"
FT                   /product="putative ribonuclease"
FT                   /function="enzyme; macromolecule degradation: Degradation
FT                   of RNA"
FT                   /note="residues 1 to 156 of 157 are 47.43 pct identical to
FT                   residues 1 to 148 of 149 from GenPept : >gb|AAA86441.1|
FT                   (M14442) barnase (RNase) precursor [Bacillus
FT                   amyloliquefaciens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83768"
FT                   /db_xref="GOA:Q8D1Q1"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR001887"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q1"
FT                   /protein_id="AAM83768.1"
FT                   /translation="MNKRLMAILGAVLLLIAGAWQGIDGVTVRDIGSSAELERPALSAS
FT                   AATESLTQHQKVVKYLQTHHRLPDFYLTKKQAREQGWDAQKGNLCDVLPGKAIGGDRFS
FT                   NRERQLPDAKGRHWREADVNYRCGRRGSDRLLYSNDGLIYLTQDHYKHFIRME"
FT   gene            complement(179440..179778)
FT                   /locus_tag="y0175"
FT   CDS_pept        complement(179440..179778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0175"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 112 of 112 are 59.82 pct identical to
FT                   residues 374 to 485 of 486 from GenPept : >gb|AAL44216.1|
FT                   (AE009270) succinate semialdehyde dehydrogenase
FT                   [Agrobacterium tumefaciens str. C58 (U. Washington)]"
FT                   /db_xref="EnsemblGenomes-Gn:y0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83769"
FT                   /db_xref="GOA:Q8CLV1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV1"
FT                   /protein_id="AAM83769.1"
FT                   /translation="MIADANEQMKVASEETFGPLAACFRFSTEAEVIQRANNTPFGLAA
FT                   YFYTQNLQRVFRVSEALESGMIGVNECSVSTELAPFGGVKESGLGREGSVLGLDEFMEV
FT                   KTLHLGNL"
FT   gene            complement(179775..180908)
FT                   /gene="gabD"
FT                   /locus_tag="y0176"
FT   CDS_pept        complement(179775..180908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="y0176"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="NADP-dependent activity; residues 23 to 366 of 377
FT                   are 56.06 pct identical to residues 15 to 360 of 482 from
FT                   E. coli K12 : B2661"
FT                   /db_xref="EnsemblGenomes-Gn:y0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83770"
FT                   /db_xref="GOA:Q8D1Q0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1Q0"
FT                   /protein_id="AAM83770.1"
FT                   /translation="MPAQNPLQHQRQHDGIYHIGYFVGGKWSQAQEQFDVYNPATGELV
FT                   ARVAKSGKQETEAAIKAASEAFPAWRKTPAKQRAEILQRWYLLIMEHQQSLAELMVSEQ
FT                   GKPLKEALVEVAYAASFIQWFSEQAKRANGEIIPSAKEGARILATREPIGVVAAITPWN
FT                   FPLAMLTRKLGPALAAGCTGLIKPANNTPLSAFALLALAEQAGVPAGVLNGVVGDTHAI
FT                   SDAIMASSDVRKISFTGSTNVGKTLMRNAAATMKRISMELGGNAPYIVFDDADLEAAVA
FT                   GAMACKFRNAGQVCVCVNRFYIQDAIYDEFVNRLAAEVKKLKVGNGMDKDVNMGPLINL
FT                   AGLEKVEEHVKDALEKGGRLLAGGIAMRWAVISSSQR"
FT   gene            complement(181175..183130)
FT                   /locus_tag="y0177"
FT   CDS_pept        complement(181175..183130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0177"
FT                   /product="hypothetical protein"
FT                   /note="residues 9 to 650 of 651 are 64.64 pct identical to
FT                   residues 11 to 652 of 655 from E. coli K12 : B3240;
FT                   residues 9 to 650 of 651 are 64.79 pct identical to
FT                   residues 11 to 652 of 655 from GenPept :
FT                   >gb|AAG58368.1|AE005551_11 (AE005551) orf, hypothetical
FT                   protein [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83771"
FT                   /db_xref="GOA:Q8ZAU8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAU8"
FT                   /protein_id="AAM83771.1"
FT                   /translation="MTHPSFIRLRFAFKLSFAIVAALFLGFHLQLETPRWSVLTAAIVS
FT                   AGPAFAAGGEPFSGAIRHRGWLRIIGTFIGCIGGLVIIVLTIRAPVLTLMLCCLWAGIC
FT                   TWISSLVRVENSYAFGLAGYTALIIIVTTGETPLLTPQFAVERCSEIVLGIVCAVMADL
FT                   LFSPRSIKQDIDRLVDKVLVDQYRLLQLCIQPAEKSEIDRAWNELVKNTTSLNGMRSYL
FT                   MMESSRWQRCNRRLQVLHTESLALITQACETYLVMSNHPEVISAELKTMLSEPAQTPAE
FT                   IHQQMKKLRQFIAASHSEAIPHTISSWVGAATRYLLLSKGIQTNSSINQVEEDILAGDA
FT                   PVKPISAEGHHAMINGLRTGIATAIGGLFWLWTGWTSGAGCMVMIAVVTSLAMRTPNPR
FT                   RMALDFLVGVIIALPIGALYFMFIIPSTQQSMLLLCISLGVLAFIIGIEVQKRRLGSLG
FT                   TLASTINIIVLSNPMIFNVRQFLDSALGQIVGCFVSLIVLLLIRDNAKDRTGRTLLNRF
FT                   VYSAVSALTTNKTKRGENHLPALYQQLNQLLMMFPADIDKYRLALTLIIAHQRLNRTEI
FT                   PVNAELSAFHKQIRSTAERVITVNNDQKRRYYFARLLQELDQYQQKLVDYQAADAVIRP
FT                   VKRLTEMLRKYQSALI"
FT   gene            complement(183132..184067)
FT                   /locus_tag="y0178"
FT   CDS_pept        complement(183132..184067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0178"
FT                   /product="putative membrane protein"
FT                   /function="putative membrane"
FT                   /note="residues 1 to 311 of 311 are 72.66 pct identical to
FT                   residues 1 to 310 of 310 from E. coli K12 : B3241; residues
FT                   1 to 311 of 311 are 100.00 pct identical to residues 1 to
FT                   311 of 311 from GenPept : >emb|CAC93154.1| (AJ414158)
FT                   putative HlyD family secretion protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83772"
FT                   /db_xref="GOA:Q8ZAU9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAU9"
FT                   /protein_id="AAM83772.1"
FT                   /translation="MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTA
FT                   DVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEK
FT                   QRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEG
FT                   WVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRIL
FT                   HGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTT
FT                   ATVVITGPNDRDPHQASPMTKLMHRLREFG"
FT   gene            complement(184075..184278)
FT                   /locus_tag="y0179"
FT   CDS_pept        complement(184075..184278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0179"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 66 of 67 are 81.81 pct identical to
FT                   residues 24 to 89 of 90 from E. coli K12 : B3242"
FT                   /db_xref="EnsemblGenomes-Gn:y0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83773"
FT                   /db_xref="GOA:Q8ZAV0"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAV0"
FT                   /protein_id="AAM83773.1"
FT                   /translation="MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVW
FT                   HPALFNTALYCCLFYLTSRLFS"
FT   gene            184581..185492
FT                   /locus_tag="y0180"
FT   CDS_pept        184581..185492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0180"
FT                   /product="putative transcriptional regulator LYSR-type"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 301 of 303 are 80.73 pct identical to
FT                   residues 1 to 301 of 309 from E. coli K12 : B3243"
FT                   /db_xref="EnsemblGenomes-Gn:y0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83774"
FT                   /db_xref="GOA:A0A3N4AWI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWI3"
FT                   /protein_id="AAM83774.1"
FT                   /translation="MERLKQMSVFAKVVECGSFTAAARRLENSVSSISQTVSKLENELN
FT                   VKLLNRSTRRIGLTEAGRIYYQGCRRMLQEVQQVHEQLYAFNNTPTGTLRIGCSSTMAQ
FT                   NVLATMTADMLKAYPGLSVNLVAGIPAPDLIADGLDVVIRVGALQNSGLFSRRLGAMPM
FT                   VVCAAKSYLSQYGTPAKPSDMANFSWLEYNVRPDSNFELIAPEGITTQISPQGRFVTND
FT                   SQTMIRWLKAGAGIAYTPLMWVIEEIKRGEVEILFKHYHSDPRPVYALYTEKDKMPLKV
FT                   QVCIDYLTEYFKRVADVYQDYR"
FT   gene            185744..186619
FT                   /locus_tag="y0181"
FT   CDS_pept        185744..186619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0181"
FT                   /product="putative transcriptional regulator"
FT                   /function="regulator"
FT                   /note="residues 4 to 182 of 291 are 26.76 pct identical to
FT                   residues 8 to 200 of 303 from GenPept : >gb|AAC75958.1|
FT                   (AE000375) putative transcriptional regulator LYSR-type
FT                   [Escherichia coli K12]"
FT                   /db_xref="EnsemblGenomes-Gn:y0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83775"
FT                   /db_xref="GOA:Q8D1P9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P9"
FT                   /protein_id="AAM83775.1"
FT                   /translation="MVHMFISKNLLVFFTTVQEGSLTNAAVKLFTTPPPMSRSLKILEE
FT                   ELGFKLFTRTTSGLKLTLEGAAFYQEIYPTYVRLTEITKNYKKNKNGIINIATYQLNSD
FT                   HAGVICDYFIKKGNFNIELRENIGDISQMDIVISTKEIKGYDFDTELTASCEIKLLYAS
FT                   HLNDLPDRVEYLKKLPFIQSSIFCSSCCFKRFSHNLIQQGYSGNVLRIDDARVRHEIIK
FT                   KGAGISLSTNYFFDKKKISHSTEISFISDINFDITYYIYFKSSVINKEFFIQYITNNSL
FT                   LQWQKAEKKH"
FT   gene            complement(186780..186941)
FT                   /locus_tag="y0182"
FT   CDS_pept        complement(186780..186941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0182"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83776"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLV0"
FT                   /protein_id="AAM83776.1"
FT                   /translation="MALFCFGLLMNRIISIRYNGCSMVDIILHNLPLYLGTLAWDVKQQ
FT                   VLTMCLLK"
FT   gene            187032..189356
FT                   /gene="tcaA1"
FT                   /locus_tag="y0183"
FT   CDS_pept        187032..189356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcaA1"
FT                   /locus_tag="y0183"
FT                   /product="putative toxin subunit"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 182 to 557 of 774 are 35.41 pct identical
FT                   to residues 602 to 996 of 1095 from GenPept :
FT                   >gb|AAL18449.1| (AF346497) toxin complex protein
FT                   [Photorhabdus luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83777"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P8"
FT                   /protein_id="AAM83777.1"
FT                   /translation="MQPEARTDLSLAEGIPERANEYADPASIQSLFSPGRYLCELYHVA
FT                   KELHEDGNKLHIDKRRPDLQELVLSNSNMNQEVSSLEILLNVLQTNAPLAKLAKDTEAH
FT                   ANDVSFTLPYDDNLTVINAILEDKAISLREIAALLAENNDPWANPITPALVQEQLGLNP
FT                   ASYALIDIKSPLDDNSAKRLAHATQLSVEQLQWLNKNAIESSSDKDSPLRPEILTIISE
FT                   YRRLHQRYGLSVDPFIAIINAVNTTHTNENKTSFFQQIFSTLDVDAGFNFLDQGSWEVI
FT                   IRKALGITAEELLRIAKYCFGKSSISNVKMNSKKFSQLYRMAMIPRTLGVSFSQAEYLW
FT                   QLYSHPDENIMEKIAQGNALTIIDAIIVLENTLQWMSEQKLDITTLQAMLTKQYSTTAT
FT                   PELFNFLSNIYQTLGKQVYSESLKPNLYRSLANGFHLKANVVAGLVNWLAKNDSEFTLE
FT                   RFWQNISMTFAEEPSLHQLEIHQPLLIQCQKLSQYVLIAQWAELSEQEIALILLPNGID
FT                   NRGSAPSPSITLLKLLSEFKLCQQEAKVSQSELFDIMQQLITDTNEKQEKLRNSADKVI
FT                   RSIAKSIGSINNSMDDIDSTISIRNGSATLFPPEHPMYKALKLEVSNLEKSKIQLEGKK
FT                   KEEEIKLEQAKDNIQSLINNWDSEIIIRLADAYHWDINIANSIFILIFGEKINFTFHYE
FT                   NRNDYHYEEHYGYRFEQKPMYSFDKKLTNGFGSILLLKNHIYIAEKLKIHPGTIIKIKN
FT                   YIFDDKSNELENIANKLRVNL"
FT   gene            189397..192990
FT                   /gene="tcbA"
FT                   /locus_tag="y0184"
FT   CDS_pept        189397..192990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcbA"
FT                   /locus_tag="y0184"
FT                   /product="putative toxin subunit"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 1 to 1196 of 1197 are 42.03 pct identical
FT                   to residues 1 to 1187 of 1189 from GenPept :
FT                   >gb|AAL18450.1| (AF346497) toxin complex protein
FT                   [Photorhabdus luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83778"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="InterPro:IPR041079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W9H5"
FT                   /protein_id="AAM83778.1"
FT                   /translation="MPTSTVLNKINESRRDALVNYYLAKNVSGDEKIKTAEQLYQYLLL
FT                   DTKIGHEVKTSPIAEAISSLQIYINRCVDGEENDLHEKNISTHFSSDNFLHGWNSYNKR
FT                   YARWAGKEKLMYYAADYIDPTLRYNKTELFNTFEQSINNSRLTEKSVKSALQSYLISYE
FT                   KLAQIDTIKELYVENIKTHFFLGKTRESPCQYYWRSGEQLSNDSHHLRWSEWKKVNCNI
FT                   NGTEEKFFINLSWHRSSLYIDWINKFSIRTDKDETTEKYHYNRVYKNDDNTWSELIINM
FT                   DIGFKLSTSTEVITLPPFFVNQGDPNAKEEVENLFLTNGTSIKRIESRLHGYINGHIKI
FT                   LCNDDGISFEIAEKLINGDNGTIGEVKIIENEKIISTINNEKGENKKINLIDKFEIRIF
FT                   PYNELVASTIVFNRIKPEEKIIDELDDKISLLSPNSLPLKEKFQTSVDELLSYNTQKNN
FT                   VKLNAFNGSYGIYLWELFFHIPLLASMRFLNEQRFDLAQHWLKYLFNSAGYRDGNGNLL
FT                   KEGDNILYWNILPLQQDTAWDKNTLIQATDDPDVIAMQDPMQYKLAIFMRTLDLIISQG
FT                   DQAYRQLERDTLAEAKIHYIQASQLLGPRPNLNSSHQWENIKLAEESRQLENSHFLPPY
FT                   NELLLSYWDKLEIRLYNLRHNLNLDGQPLHLPLFATPVDPKALQRQHGAGNGINSSEQI
FT                   ATAQTSLYRFPLLIERAKSAVSAVIQFGNSLQSVLERQDNEAMTLLFQQQQQKVLQHTK
FT                   DIQNNNIQVLQASLEATDSLKSAAEQRRKHYKELLDNGISSDEQLAINIRIASAALNGE
FT                   SLVPLGLSAVLDTAPNVFGLADGGSRWGAISQAVGWGMQSMAMALETTAGVRDAKANYS
FT                   RRAQEWTLQKDQADKDIEQLAHQYTSVQEQLNMAQKQLNLAELEQGHADALYQMQSTRF
FT                   TGKELYNWMAGRLSGLYFQLFDATQPLCLMAKAALEKEVDKAKTDGLFIRSGWNDLYQG
FT                   LLAGEDLQLNLQKLENVWLMEEQRALEVERTVSLAQHYQQLSDHKFNLAEIVTGYMAQD
FT                   KDQKTGNEQDFVELKNGTLITSLSIKGLNLVEDYPETMHLGDIRRIKQISVSLPALLGP
FT                   YQDVQATLDYAGENTHLAKGCTALAISRGMNDSGQFLLDFNDGKYLPFEGIDISDKGTL
FT                   VLRFPNATSKQKLLLQSLSDIILHIRYTIRS"
FT   gene            192987..197537
FT                   /gene="tcaC1"
FT                   /locus_tag="y0185"
FT   CDS_pept        192987..197537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcaC1"
FT                   /locus_tag="y0185"
FT                   /product="putative toxin subunit"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 21 to 1511 of 1516 are 48.90 pct identical
FT                   to residues 1 to 1473 of 1476 from GenPept :
FT                   >gb|AAL18487.1| (AF346500) toxin complex protein
FT                   [Photorhabdus luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83779"
FT                   /db_xref="GOA:Q8D1P6"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P6"
FT                   /protein_id="AAM83779.1"
FT                   /translation="MITPLPQSTGPTEGLIGEPFMENSKQQVAVAPLSLPKGGGAITGM
FT                   GDSLGPIGPSGMATLTLPLPISAGRGYAPSLTLSYSSGSGNGPFGLGWQLGTMAIRRRT
FT                   NAQVPRYDEYDEFLAPNGEVMVVAADPQGSIERTEQSLNGEQFSVIRYLPRIEGNFHRI
FT                   EYWRPRTNNSQAPFWLVHSSDGQKHCLGYSAAARIADPLHPEHIAEWLLEESVSLSGEH
FT                   IGYQYQAEDEQGIDEPSIYKAEKQNHPAASAQRYLKRVVYGNRQAAYELYCLTQQPAPT
FT                   SWLFSLIFDHGEYSNIAEQVPVIIKGKSWNFRQDAFSHFNYGFEVRTRRLCQQVLMYHN
FT                   LSALKGDEPDAQATLVSRLRLHYQHDAYATQLVGCQQLAHEPDGTKRSLPPLEFDYQDF
FT                   STRDALGWQPLTDWAEFNYQYQMVDLNGEGMPGMLYQDSGHWIYRPPVRQPGTADGITF
FT                   GAAQRLPSLPAMRENAMLMDINGDGKLDWVISQPGLAGYFSRDPDLSRDPDLSWTQFIP
FT                   LSTLPAEYFHPQAQLVDLAGSGLSDLALVGPKSVRVYTNLCDSFAAATQVAQDDDITLP
FT                   LPGVHFTELVAFSDVMGSGQQHLVRIRHNSVTCWPNLGHGRFGHPLSLPGFNQPVEQFN
FT                   PLAIYLADIDGSGTIDLIYATTSQLLIYRNQSGNRFAEPLAIALPTGIRFDNSCQLSLA
FT                   DIQGLGVASIMLSVPHPTTQHWRYDFVASKPYLLCTTNNNMGAESQLLYRSSVQFWLDE
FT                   KAQAAKQGRSLACQLPFPIHLLAQTTQFDEITGNSLSQTARYFHGFYDGVQREFSGFGR
FT                   VDTLDTDTSAQGSAAERTAPTKSSRWFHTGRAGNETLWQSEYWQGDDQAYSLLPTRLTK
FT                   FINNTQGDELLSELDDNQTFWLHRALKGSLLRSELYGLDDSELATQPYSVNSSRYQVRQ
FT                   IQSSADGISSPVALPMVLEQLSYHYERIAQDPQCSQQIVLRCNEYGHPLHSVTINYPRR
FT                   DKARISPYSWLAKEHWDSHFDEQQQQLRITESQQSYHHEISDKFYVLGLPAGQRSDVLT
FT                   YPDNFVPTAGIHWEELQQPEGLLGTKAERTFTAQQQVFYTSDTIPGLVAYSQQAEFDDQ
FT                   TLVALDELLPANERKQQLIKAGYQIAPRLFARTGETDIWVAQSGFTDYGDASRFYRPIS
FT                   QRSTQLVGKTILEWDATCCAVSDIILADYSITHAEYDYRFITPYLLIDINDNQHYIELD
FT                   ALGRVTSSRFAGTEIDPQTNKVIETGFPSIAEQPFSAPNSVDKALSLENTRIPVAQFSV
FT                   YQPQSWMISLQLDDIEIWIRANNITPEYLFQNHILIDNYYLCPLALRRWGRQNNLLITE
FT                   GVGLTLKNPMRQPPHILTVVVDNYFSASEPQQHQQTLAFSDGFGRVLLSARRVETGPSY
FT                   SFDPENGLLVDDKGNLVQLEVDQRWAVSGRTEYDNKGLPRRRYQPYFFDNWIWLYIANN
FT                   RTLKEAYADTHIYDPLGREIKVITAKGYLRRTHYFPWFVISEDENDTASEITPNP"
FT   gene            197671..197973
FT                   /locus_tag="y0186"
FT   CDS_pept        197671..197973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0186"
FT                   /product="hypothetical phage protein"
FT                   /function="phage-and prophage-related functions"
FT                   /note="residues 14 to 94 of 100 are 45.67 pct identical to
FT                   residues 12 to 92 of 101 from GenPept :
FT                   >gb|AAG55972.1|AE005330_4 (AE005330) putative holin protein
FT                   of prophage CP-933X [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83780"
FT                   /db_xref="GOA:A0A3N4B0Y0"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0Y0"
FT                   /protein_id="AAM83780.1"
FT                   /translation="MHVQVPIDDFFITWVIIGTFSAWGGLVRYIVDQNNEYEEWSWVGV
FT                   LCQVIVSAFTGLIGSLFTLETGSSRYITFAIAGLFGAMGNTALKHLWQRFFSHSK"
FT   gene            197977..198387
FT                   /locus_tag="y0187"
FT   CDS_pept        197977..198387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0187"
FT                   /product="hypothetical phage protein"
FT                   /function="phage-and prophage-related functions"
FT                   /note="residues 13 to 136 of 136 are 57.36 pct identical to
FT                   residues 5 to 132 of 213 from GenPept : >gb|AAL41481.1|
FT                   (AE009016) endolysin [Agrobacterium tumefaciens str. C58
FT                   (U. Washington)]"
FT                   /db_xref="EnsemblGenomes-Gn:y0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83781"
FT                   /db_xref="GOA:Q8CLU9"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU9"
FT                   /protein_id="AAM83781.1"
FT                   /translation="MDPMMNDKPTFRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRV
FT                   IEGIRTPERQRQMVLNGHSKTMNSRHLTGHAVDLAPMVNNRIPWDDWHAFVHVAKAMKQ
FT                   AAKAMELPLQWGGDWKNFRDGPHFELPRECYP"
FT   gene            198375..198743
FT                   /locus_tag="y0188"
FT   CDS_pept        198375..198743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0188"
FT                   /product="hypothetical"
FT                   /note="residues 35 to 96 of 122 are 37.50 pct identical to
FT                   residues 3 to 66 of 94 from GenPept :
FT                   >gb|AAK81976.1|AF303741_42 (AF303741) 042R [Chilo
FT                   iridescent virus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83782"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU8"
FT                   /protein_id="AAM83782.1"
FT                   /translation="MLPMISLSTLFGLGKSMMLLAGVVAIVWGVQASRTLDRLNQENVQ
FT                   LTTQLARIGQINQQLTQHIQATTVQLKQAQEQERLEREKSSELQKRLRLAQKGNRCAEE
FT                   PVPAAVIRMQQQSFSDGK"
FT   gene            198730..198903
FT                   /locus_tag="y0189"
FT   CDS_pept        198730..198903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0189"
FT                   /product="hypothetical"
FT                   /note="residues 8 to 32 of 57 are 43.99 pct identical to
FT                   residues 632 to 656 of 732 from GenPept : >dbj|BAB15720.1|
FT                   (AK024430) FLJ00019 protein [Homo sapiens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU7"
FT                   /protein_id="AAM83783.1"
FT                   /translation="MTVNECLPFPEVLLPPCQMPTFDVQTWGDYPHYVERTRLAMVRCN
FT                   ANRESALRFLQR"
FT   gene            198944..201775
FT                   /gene="tccC1"
FT                   /locus_tag="y0190"
FT   CDS_pept        198944..201775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tccC1"
FT                   /locus_tag="y0190"
FT                   /product="putative toxin subunit"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 13 to 699 of 943 are 53.30 pct identical to
FT                   residues 12 to 694 of 760 from GenPept : >gb|AAL18492.1|
FT                   (AF346500) unknown [Photorhabdus luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83784"
FT                   /db_xref="GOA:Q8D1P5"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P5"
FT                   /protein_id="AAM83784.1"
FT                   /translation="MPNILPTDLCANTPTLAIHDNRGFAIRTLAYNRRDHNETIGELIS
FT                   RNRYNASGQLIASRDPRLEVDNFRYQYSLSGVPLRTDSVDSGSTLQLADSAGRTVLTLD
FT                   AHHTRRWVEYETGEHSLGRPLSYHEQAKGGLKTVTDRFFYATNSEQDKSGNLNGQCVRH
FT                   YDSAGLQALINQSIIGVPLQQQRRLLTNPKGPVDWFGEKENWGARLSEQPFVSHSTTDA
FT                   LGQLLTQTDAKGHIQRMAYNRAGQLIGSWLTIKNSAEQVILRSLTYSAAGQKLREESGN
FT                   GVITEYRYEPQTQRLIGIKTTRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATRFYR
FT                   NQKIVPETTYRYDALYQLIEATGREADTNGIQNSQLPALASLNDSNQFVNYTRSYHYDR
FT                   AGNLLKIQHTGASQYSTHITVSDSSNHGIQQQEGITARDIRSQFDAAGNQQQLQPGQPL
FT                   RWNSRNQLQQVEPVPRNDGISDSESYLYDGGGSRVVKTSLHKTHNAIQTRSVIYLAGLE
FT                   LRSQYNGNNLTEDFQVITVGAAGRAQVRVLHWERGQPVDIVNDQLRYSFDNHLGSALIE
FT                   LDSDGDIISQEEYYPFGGTAVLASRNTVEAKYKTVRYSGKERDATGLYYYGYRYYQPWL
FT                   GRWLSADPAGTIDGLNLYRMVRNNPVGLMDGDGLMTDKLLAKHEANFAKKNISSMAELK
FT                   SEIEKLGLLPADSKQLFLHLNGGESDDEPSGSSGSSGSSEILENTSPHKIKNFHFISEI
FT                   NLATMPRPYYKDFSSTEDMLESAERLKAYGSIDTLLTLDLTSEDIPEFTSILADKGINY
FT                   IAEKQYEIIDYFSEDELSSENIDRIVNMIKTIQNNNHKVGIHCAAGNGRSGLIATAMII
FT                   NKKYTQSRINSFEEKNKLKEIIDKNKNEINVDAITYDAMKLVRKTNPFAGERTTDIKAA
FT                   REYSRYLYSKQNR"
FT   gene            201800..204658
FT                   /gene="tccC2"
FT                   /locus_tag="y0191"
FT   CDS_pept        201800..204658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tccC2"
FT                   /locus_tag="y0191"
FT                   /product="putative toxin subunit"
FT                   /function="putative factor; extracellular functions;
FT                   secreted proteins"
FT                   /note="residues 13 to 723 of 952 are 52.56 pct identical to
FT                   residues 12 to 716 of 760 from GenPept : >gb|AAL18492.1|
FT                   (AF346500) unknown [Photorhabdus luminescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83785"
FT                   /db_xref="GOA:A0A384LD39"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LD39"
FT                   /protein_id="AAM83785.1"
FT                   /translation="MSTSLPTQLCANTPALTIHDNRGLAIRTLAYNRRDHNETVDELIS
FT                   RNRYNASGQLIASRDPRLEVDNFRYQYSLSGVPLRTDSVDSGSTLQLADSAGRTVLTLD
FT                   AHHTRRWVEYETGEHSLGRPLSYHEQAKGGLKTVTDRFFYATNSEQDKNCNLNGQCVRH
FT                   YDSAGLQALISQSIIGVPLQQQRRLLTNPKGPVDWFGEKENWGARLSEQPFVSHSTTDA
FT                   LGQLLTQTDAKGHIQRMAYNRAGQLIGSWLTIKNSAEQVILRSLTYSAAGQKLREESGN
FT                   GVITEYRYEPQTQRLIGIKTTRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATRFYR
FT                   NQKIVPETTYRYDALYQLIEATGREADTNGIQNSQLPALASLNDSNQFVNYTRSYHYDR
FT                   AGNLLKIQHTGASQYSTHITVSDSSNHGIQQQDGIIARDIRSQFDAAGNQQQLQPGQPL
FT                   RWNSRNQLQQVEPVPRNDGISDSESYLYDGSGRRVAKISLHKTHNAIQTRSVIYLAGLE
FT                   LRGQHNDNNLTESFQVITVGAAGRAQVRVLHWESGQPVDIVNDQLRYSFDNHLGSALIE
FT                   LDSDGDIISQEEYYPFGGTAVLASRNTVEAKYKTVRYSGKERDATGLYYYGYRYYQPWL
FT                   GRWLSADPAGTIDGLNLYRMVRNNPIRWRDNNGLLTEEQINMYVNLFSNIGLKNDDELK
FT                   SELLKYGLSEEEQNQIYLNMLRPMQSGSSSSLFSFPSESSSSSGSTQSVDSGYLSPVRN
FT                   YHFFEDIKLATMHRPYPKKQASSDTITYSAEDLTEASPIKILIGLDLTSKNTQPYKSAL
FT                   AEKGIKYITKEKYEITDFFEEGGLSTEQIDLTVNKILKLQKKDLVGIHCGAGNGRSGVI
FT                   ASALSINKQYTTDKINSFDVTHSLRGSILKDTQTYQVDTVTAKAVGIIREINPKAVERN
FT                   QDVISLYRYSHFLYTRKHTTSL"
FT   gene            204594..204800
FT                   /locus_tag="y0192"
FT   CDS_pept        204594..204800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0192"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 65 of 68 are 27.69 pct identical to
FT                   residues 146 to 210 of 237 from GenPept : >emb|CAB73875.1|
FT                   (AL139078) putative integral membrane protein
FT                   [Campylobacter jejuni]"
FT                   /db_xref="EnsemblGenomes-Gn:y0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83786"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU6"
FT                   /protein_id="AAM83786.1"
FT                   /translation="MLFPYIDILIFYIQENTLHHYNLLILNTFPILNREGVYTRNTDFL
FT                   KSLILTAALAKIGLTNIPMLCWH"
FT   gene            complement(204861..206306)
FT                   /gene="tldD"
FT                   /locus_tag="y0193"
FT   CDS_pept        complement(204861..206306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="y0193"
FT                   /product="PmbA/TldD family protein"
FT                   /function="phenotype; Not classified"
FT                   /note="suppresses inhibitory activity of CsrA; residues 1
FT                   to 481 of 481 are 84.40 pct identical to residues 1 to 481
FT                   of 481 from E. coli K12 : B3244; residues 1 to 481 of 481
FT                   are 84.61 pct identical to residues 1 to 481 of 481 from
FT                   GenPept : >gb|AAL22237.1| (AE008855) suppresses inhibitory
FT                   activity of CsrA [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83787"
FT                   /db_xref="GOA:A0A3N4AWE1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWE1"
FT                   /protein_id="AAM83787.1"
FT                   /translation="MSLSFVSEQLLTANKLNHQDLFSVLGQLTERRLDYADLYFQSSYH
FT                   EAWVLEDSIIKDGSYNIDQGVGVRAVSGEKTGFAYADQITLNALQQSAHAARSIVRDTG
FT                   NGKVHTLGEIAYQALYPLLDPLQSLSREDKIALLHRVDKVARAADKRVQEVSASLTGVY
FT                   EQILVAATDGTLAADVRPLVRLSVSVLVEDNGKRERGACGGGGRFGYDYFLETVDGEVR
FT                   ADNFANEAVRMALVNLSAIAAPAGAMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGSSVF
FT                   SGQMGKLVASELCTVVDDGTMQGRRGSLAIDDEGVPGQYNVLIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGQSTPEDIIASVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEKGKITHAVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLDNLTVGGTA"
FT   gene            complement(206318..207187)
FT                   /locus_tag="y0194"
FT   CDS_pept        complement(206318..207187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0194"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /function="enzyme"
FT                   /note="residues 6 to 270 of 289 are 48.49 pct identical to
FT                   residues 4 to 266 of 275 from GenPept : >gb|AAF93594.1|
FT                   (AE004129) conserved hypothetical protein [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83788"
FT                   /db_xref="GOA:A0A380PI61"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PI61"
FT                   /protein_id="AAM83788.1"
FT                   /translation="MKNANVALLQLCSGENTRDNLAQIEQQIKQLNAGIKLVMTPENAL
FT                   LFANAASYRHHAEHHNDGPLQQEVREMARRYGVWIQVGSMPMVSRESPDLITSSSLLFD
FT                   DQGELKARYDKIHMFDVDINDIHGHYRESDTYQPGQQLTVVDTPVGRLGMTICYDLRFP
FT                   GLFQALRAQGAEIISVPAAFTKMTGEAHWETLLRARAIENQCVILAAAQVGRHGATRRT
FT                   WGHTMAVDAWGKIIGHNPDAVAALKVRIETAGLKTIRNQMPVMQHNRFQATLEPTLNKP
FT                   LLNKPPSN"
FT   gene            complement(207184..210375)
FT                   /locus_tag="y0195"
FT   CDS_pept        complement(207184..210375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0195"
FT                   /product="hypothetical protein"
FT                   /note="residues 37 to 1062 of 1063 are 48.00 pct identical
FT                   to residues 1 to 985 of 986 from E. coli K12 : B3245;
FT                   residues 1 to 1056 of 1063 are 49.00 pct identical to
FT                   residues 244 to 1259 of 1266 from GenPept : >gb|AAL22238.1|
FT                   (AE008855) paral putative protease [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83789"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P4"
FT                   /protein_id="AAM83789.1"
FT                   /translation="MAAWLSIKSGEVYRGNVLLSQGQANWTVGSNSHQLSVDNFVLEGR
FT                   RQGNGWQIDAPVLNLKTDGQAWPKGRLSALWLPENTQFIGPEQRQELRIRASNLQLERI
FT                   GPLLPTLSPFTPELLARWADLQPQGYVDALALDIPISQPETTRFQAKWHDVSWQYWGQL
FT                   PGVNHFDGELSGSARLGRLNINLKNSLLPYGDLFRAPLEVSQASGALNWRIDDKGWALW
FT                   SDQLDVQAKSLWGNGSFYYMQPNQKPSQLNQAQPWLKILAGIRLYDATDAWRYFPVSLM
FT                   GEKLADYLTEALQGGQVDNATLVYNGNPHDFPYKNKEGQFQVYVPLRNAVFQFQPDWPA
FT                   LDNLAIDLNFLNEGLWMNAPHTLLGKVIGSNISAIIPDYLKEKLYVDADVLGEGRDVHD
FT                   YFTATPLKDSVAETLDELQVGGKISGRLHLDIPLEEESITHASGEVTLNNNSLLVKPLQ
FT                   SQLENINGKFRFYDGNLESETLSANWYGQPLTVNFTTKEQPKDFLVNVGLQGDWLPAKL
FT                   PGVPDSLAKMLSGSANWQGKVAVKLPQHGKPDYQVDVSADLKKVSSHLPSPLDKNSGQA
FT                   LPLHVQVNGGLEAFTLSGSAGNNNAFNSQWLLQGEKVELARAIWQTDSKKIPSLPDDKA
FT                   LVFKLPAIDGERWLALLAPELATAASPFAASFSSPSATSSTQPKIKGSKTNVILPKRLT
FT                   LQTPELLVGGQAWHQLTLQADPLPSGMKITAKGQEVDGSLLMADYGPWHADLNYLYYNP
FT                   QWGSREANNPLAQAVSQEPTVLQKPQPPSGISFSDWPALQLRCKACWILGQNIGRVNAD
FT                   LTPKGSALILTNGLIEAGNGRANITGQWQQDRAGDKTTLNIGLNGPRIDETLSFFGLTT
FT                   LIKNASFAINADLNWRGVPWEPQINTLSGTLKGRLGKGQLTDLGGGRAGQLLRLVSFDA
FT                   LLRKLQLDFSDTFSRDFAFDSIRSTATLKNGVMSTNDLVIDGLAADIAMNGKVDLVKRQ
FT                   IAMEAVITPELSATVGVATAFAINPIVGAAVFAASKILGPLWSKVSLIRYQITGSLDQP
FT                   TIHEVLRQLKENEAP"
FT   gene            complement(211201..212670)
FT                   /gene="cafA"
FT                   /locus_tag="y0196"
FT   CDS_pept        complement(211201..212670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="y0196"
FT                   /product="cytoplasmic filament protein"
FT                   /function="structural component; cell division"
FT                   /note="residues 1 to 489 of 489 are 90.18 pct identical to
FT                   residues 7 to 495 of 495 from E. coli K12 : B3247"
FT                   /db_xref="EnsemblGenomes-Gn:y0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83790"
FT                   /db_xref="GOA:A0A2S9PIM5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PIM5"
FT                   /protein_id="AAM83790.1"
FT                   /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREAKRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFNVRDIAELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVLMPGAAHVGVSQRIESEAERERLKKTVAAYCD
FT                   EQGGFIIRTAAEGIGEEELSADAAFLKRLWTKVQERKKRNITKYKLYGEMALAQRVLRD
FT                   FAGAALDKIRVDSKLTYDLLVEFTREYIPEMTDKLELYTGKQPIFDLYDVENEIQRSLE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNIEATQAIARQLRMRNL
FT                   GGIIIIDFIDMSNEDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESIEH
FT                   VLCHECPTCRGRGTVKSVETVCYEILREIVRVHHAYDSDRFLVYASPAVGEALKGEESH
FT                   ALAEVEIFVGKQVKVQIEPLYNQEQFDVVMM"
FT   gene            complement(212660..213259)
FT                   /locus_tag="y0197"
FT   CDS_pept        complement(212660..213259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0197"
FT                   /product="hypothetical protein"
FT                   /note="residues 3 to 198 of 199 are 70.40 pct identical to
FT                   residues 1 to 196 of 197 from E. coli K12 : B3248"
FT                   /db_xref="EnsemblGenomes-Gn:y0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83791"
FT                   /db_xref="GOA:P58636"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58636"
FT                   /protein_id="AAM83791.1"
FT                   /translation="MPMTALYLASASPRRRELLALLDLPFEVLKTEVEEQRHPGESAQV
FT                   YVQRLAQDKARAGVAVAPQDLPVLGADTIVVLNGQVLEKPRDKEHAQQILSALSGQKHQ
FT                   VMTAVALADRQNMLSAMVVTDVTFRVLSPLEISDYIATGEPMDKAGAYGIQGKGGCFVR
FT                   AIAGSYHAVVGLPLVETHELLSHFIAQRNVRGIHDS"
FT   gene            212878..213480
FT                   /locus_tag="y0198"
FT   CDS_pept        212878..213480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0198"
FT                   /product="hypothetical"
FT                   /note="residues 23 to 126 of 200 are 29.80 pct identical to
FT                   residues 226 to 324 of 454 from GenPept :
FT                   >gb|AAF11838.1|AE002061_5 (AE002061) cell wall
FT                   glycyl-glycine endopeptidase, putative [Deinococcus
FT                   radiodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:y0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83792"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU5"
FT                   /protein_id="AAM83792.1"
FT                   /translation="MSHLSQPWPITCFADRPTPRRSSPDASGQTMHSVFVVHVPYPVVF
FT                   LKPAHLTPQWYRHPIPVNPVVRQPHLPVLYPAPNAGHTPAHSRQGDAALQPLFSVPQTV
FT                   NPTGPVIHGDVAKQKPDTGQSWALNPYCTENWRRILRISRNSHGQRMPLTTLLQKTSGR
FT                   NATLITKNSDQNTTTSIVSESSMTISACCHSAILRNN"
FT   gene            complement(213267..213755)
FT                   /gene="mreD"
FT                   /locus_tag="y0199"
FT   CDS_pept        complement(213267..213755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="y0199"
FT                   /product="rod shape-determining protein"
FT                   /function="structural component; murein sacculus,
FT                   peptidoglycan"
FT                   /note="residues 1 to 162 of 162 are 75.30 pct identical to
FT                   residues 1 to 162 of 162 from E. coli K12 : B3249; residues
FT                   4 to 162 of 162 are 77.35 pct identical to residues 5 to
FT                   163 of 163 from GenPept : >gb|AAL22241.1| (AE008855) rod
FT                   shape-determining protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83793"
FT                   /db_xref="GOA:A0A3N4AXR2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXR2"
FT                   /protein_id="AAM83793.1"
FT                   /translation="MNRYSSHGRWVIWLSFLIAMVLQIMPWPEQIYMFRPSWLALVLIY
FT                   WVMALPHRVNVGTGFILGLIMDLILGSTLGVRALAFSIIAYLVAFKFQLFRNMALWQQA
FT                   LIVMLLSLTMDVVVFWSEFLVINVAFRPEVFWSSVVNGILWPWLFLLMRKIRRQFSVQ"
FT   gene            213735..213854
FT                   /locus_tag="y0200"
FT   CDS_pept        213735..213854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0200"
FT                   /product="hypothetical"
FT                   /note="residues 2 to 38 of 39 are 44.73 pct identical to
FT                   residues 73 to 110 of 118 from GenPept : >dbj|BAB47792.1|
FT                   (AP002994) unknown protein [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83794"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU4"
FT                   /protein_id="AAM83794.1"
FT                   /translation="MTTVTIHGETPGVTTPGVAPAGVDAAGAGGPIASAEGNT"
FT   gene            complement(213752..214747)
FT                   /gene="mreC"
FT                   /locus_tag="y0201"
FT   CDS_pept        complement(213752..214747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="y0201"
FT                   /product="rod shape-determining protein"
FT                   /function="structural component; murein sacculus,
FT                   peptidoglycan"
FT                   /note="residues 1 to 316 of 331 are 81.32 pct identical to
FT                   residues 1 to 316 of 367 from E. coli K12 : B3250; residues
FT                   1 to 327 of 331 are 80.30 pct identical to residues 1 to
FT                   330 of 350 from GenPept : >emb|CAD07888.1| (AL627278) rod
FT                   shape-determining protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83795"
FT                   /db_xref="GOA:A0A3N4AZ56"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZ56"
FT                   /protein_id="AAM83795.1"
FT                   /translation="MKPIFSRGPSLQLRLFFAIIAAIVLVIADSRLGTFVKIRTYMDTA
FT                   VSPFYFLANGPRKILDNVSDTLATREQLELENRALRQELLLKNTDLQLLGQFKQENNRL
FT                   RELLGSPLRQDEQKMVTQVMSSGTDPYSDHVVIDKGSNSGVYEGQPVISDRGVVGQVVA
FT                   VSKFTSRVLLICDASHALPIQVLRNDIRVIAAGSGCSDDLLLEHLPSNTDIRVGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKVDNQRAYTVIQARPTADLQRLRYLLLLWGADRNGDMPMP
FT                   PDEVRRVANERLAPMMSQVLPSADAMGPPAPAASTPAGATPGVVTPGVSP"
FT   gene            complement(214951..215994)
FT                   /gene="mreB"
FT                   /locus_tag="y0202"
FT   CDS_pept        complement(214951..215994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="y0202"
FT                   /product="regulator of ftsI, penicillin binding protein 3"
FT                   /function="phenotype; cell division"
FT                   /note="septation function; residues 1 to 347 of 347 are
FT                   99.13 pct identical to residues 21 to 367 of 367 from E.
FT                   coli K12 : B3251; residues 1 to 347 of 347 are 100.00 pct
FT                   identical to residues 1 to 347 of 347 from GenPept :
FT                   >emb|CAC93135.1| (AJ414158) rod shape-determining protein
FT                   MreB [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83796"
FT                   /db_xref="GOA:A0A3N4AWE3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWE3"
FT                   /protein_id="AAM83796.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR
FT                   AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHSI
FT                   GSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            complement(216331..218247)
FT                   /locus_tag="y0203"
FT   CDS_pept        complement(216331..218247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0203"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 638 of 638 are 50.70 pct identical to
FT                   residues 1 to 641 of 646 from E. coli K12 : B3252; residues
FT                   1 to 638 of 638 are 50.70 pct identical to residues 1 to
FT                   641 of 646 from GenPept : >gb|AAG58379.1|AE005553_1
FT                   (AE005553) orf, hypothetical protein [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83797"
FT                   /db_xref="GOA:A0A3N4AWG0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWG0"
FT                   /protein_id="AAM83797.1"
FT                   /translation="MRFTTKLSAFMTLLVVLAMCLVLLGSTISFFYLCQKKMEQRLQSI
FT                   VTAYDQSLLLQPINKKREWLPLMMQTLGVVDVSVKNSTSTLYQLHIPAVYTPWNSHSRY
FT                   RQMVLPLLHQPGTEMHFNYIDPLGSYARSIYAAAILSLVVVVIALTLLLSFRWLRDQTV
FT                   GQEKLERRARRILNGEREHAVRSEDYEWPPCASRAIDHLLSELMEVRAERNRVDTLIRT
FT                   FAAQDAQTGLSNRQFFDNQLTTQLEETGAHGVVMMVQLPDFEALNETHDQQQVQELMSS
FT                   LVNLLSTFVARYPSALLARYLNSDIAILLPHKTLKDADVMAAQLVNAVRTLPEPHIIDR
FT                   ESLLHIGIVAYRSGESVEQIMDNAGQATKSAALYGGNGWYVFDTQVPERGRGSVKWRTL
FT                   LEQTLASGGPRLYQKPVITVDGKISHREIISRIYDGEQELLAAEFMPLVQLLGLGERYD
FT                   RQKIDKIIPLLSLWPDETLAFSISVDSLLHRPFQRWLRDTLLQCKKSDRMRIIFELAEA
FT                   DVCQHIEEIRQMVRLLRGVGCKVMASQAGLTVVSTSYIKSLQVEMIKLHPGVVRSINFR
FT                   YENQLFVESLTGACAGTQTKVFAAEVRTREEWQTLQEKGVYGGQGNFFAPPTPLNSGKK
FT                   KYS"
FT   gene            218648..219625
FT                   /locus_tag="y0204"
FT   CDS_pept        218648..219625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0204"
FT                   /product="putative dehydrogenase"
FT                   /note="residues 1 to 324 of 325 are 74.38 pct identical to
FT                   residues 1 to 323 of 324 from E. coli K12 : B3253; residues
FT                   1 to 324 of 325 are 74.69 pct identical to residues 1 to
FT                   323 of 324 from GenPept : >gb|AAG58380.1|AE005553_2
FT                   (AE005553) putative dehydrogenase [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83798"
FT                   /db_xref="GOA:A0A2S9PIM8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PIM8"
FT                   /protein_id="AAM83798.1"
FT                   /translation="MRALILEQIEGRTTAEVRQISASQLPAGNVTVDVNWSSLNYKDAL
FT                   AITGQGKIIRQFPMVPGIDFAGTVHSSEDPRFHIGQSVLLTGWGVGENHWGGLAEQARV
FT                   NGDWLVPMPDGLDARKAMIIGTAGFTAMLCVMALEDGGVTPKSGEVVVTGASGGVGSTA
FT                   IALLSALGYQIAAISGRDSNSDYLKNLGAQRILPRSDYLDASRPLEKQLWAGAIDTVGD
FT                   SMLAKILAQMNYNGTVAACGLAGGYNLPTTVMPFILRNIRLQGVDSVMTPQPRRLQAWQ
FT                   RLQKILPESFYQQASQAITLADTPTIAARLLANEVTGRTLVKVR"
FT   gene            219764..220948
FT                   /locus_tag="y0205"
FT   CDS_pept        219764..220948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0205"
FT                   /product="putative reductase"
FT                   /note="residues 62 to 394 of 394 are 75.44 pct identical to
FT                   residues 1 to 334 of 334 from E. coli K12 : B1971; residues
FT                   62 to 394 of 394 are 79.04 pct identical to residues 1 to
FT                   334 of 334 from GenPept : >gb|AAL22246.1| (AE008855)
FT                   putative nitrate reductase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83799"
FT                   /db_xref="GOA:Q8ZAW9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAW9"
FT                   /protein_id="AAM83799.1"
FT                   /translation="MFPFATMINHIRGNAINDIKGNYPTESAMHNTFTHTKNNTHTKNN
FT                   TQAKNSGSQTKSNAVSLNKPRKLTEADVTPESIFYQRRKVLQALGITAATLALPASAQA
FT                   DLLAWFKGNEPPKAPSGKPLTFTPSAAYHPDLALTPEDKVTGYNNFYEFGLDKADPAAN
FT                   AGTLKTEDWQIKIDGDVVKPMTLDMDYLMKCFPLEERIYRLRCVEAWSMVVPWIGFELG
FT                   KLLKLAEPTSNARYVAFQTLYAPDQMPGQKNRFIGGGLDYPYVEGLRLDEAMHPLAFMV
FT                   VGVYGKTLPPQNGAPLRLMTPWKYGFKSIKSIVHIRLTRDQPPTTWNLSAPNEYGFYAN
FT                   VNPHVDHPRWSQATERVIGSGGILDVKRQPTLLFNGYAEQVASLYRGLDLRKNF"
FT   gene            220948..221568
FT                   /locus_tag="y0206"
FT   CDS_pept        220948..221568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0206"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 203 of 206 are 68.96 pct identical to
FT                   residues 1 to 203 of 211 from E. coli K12 : B1972; residues
FT                   1 to 206 of 206 are 72.81 pct identical to residues 1 to
FT                   199 of 199 from GenPept : >emb|CAD07893.1| (AL627278)
FT                   putative membrane protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83800"
FT                   /db_xref="GOA:Q8ZAX0"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAX0"
FT                   /protein_id="AAM83800.1"
FT                   /translation="MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQH
FT                   FTGRMALKLLLATLLVSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSN
FT                   IGLLGHELINRPYLTLGIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPI
FT                   HYLWSVKTLSPWPIIYAVMAALLLLLRYKLLLPRYKKFRQWFR"
FT   gene            221831..222283
FT                   /locus_tag="y0207"
FT   CDS_pept        221831..222283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0207"
FT                   /product="putative dehydroquinase"
FT                   /function="enzyme"
FT                   /note="residues 1 to 146 of 150 are 73.28 pct identical to
FT                   residues 1 to 146 of 149 from GenPept : >gb|AAD10235.1|
FT                   (AF011408) type II 3-dehydroquinase [Aeromonas salmonicida
FT                   subsp. salmonicida]"
FT                   /db_xref="EnsemblGenomes-Gn:y0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83801"
FT                   /db_xref="GOA:Q8ZAX1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="PDB:3LWZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAX1"
FT                   /protein_id="AAM83801.1"
FT                   /translation="MSDKFHILLLNGPNLNLLGTREPEKYGYTTLAEIVSQLEIQAQGM
FT                   DVALSHLQSNAEHALIDSIHQARGNTDFILINPAAFTHTSVALRDALLGVQIPFIEIHL
FT                   SNVHAREPFRHHSYLSDIAVGVICGLGADGYNFALQAAVNRLSKSN"
FT   gene            222396..222905
FT                   /gene="accB"
FT                   /locus_tag="y0208"
FT   CDS_pept        222396..222905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="y0208"
FT                   /product="acetyl CoA carboxylase, BCCP subunit"
FT                   /function="carrier; biosynthesis of cofactors, carriers:
FT                   biotin carboxyl carrier protein (BCCP)"
FT                   /note="carrier of biotin; residues 16 to 169 of 169 are
FT                   82.80 pct identical to residues 1 to 156 of 156 from E.
FT                   coli K12 : B3255; residues 16 to 169 of 169 are 82.80 pct
FT                   identical to residues 1 to 156 of 156 from GenPept :
FT                   >gb|AAL22248.1| (AE008856) acetylCoA carboxylase, BCCP
FT                   subunit, carrier of biotin [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83802"
FT                   /db_xref="GOA:Q8D1P3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P3"
FT                   /protein_id="AAM83802.1"
FT                   /translation="MMGIIATHKEYGITLMDIRKIKKLIELVEESGISELEISEGEESV
FT                   RISRAPAAPNYPMMQQPYAFAAPQQQPALAAAVAPAPVAEAAPAAISGHIVCSPMVGTF
FT                   YHTPSPDAKAFVEVGQKVSVGDTLCIVEAMKMMNQIEADKSGTVKAILVENGQPVEFDE
FT                   PLVVIE"
FT   gene            222917..224266
FT                   /gene="accC"
FT                   /locus_tag="y0209"
FT   CDS_pept        222917..224266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="y0209"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /function="enzyme; fatty acid and phosphatidic acid
FT                   biosynthesis"
FT                   /note="residues 1 to 448 of 449 are 92.41 pct identical to
FT                   residues 1 to 448 of 449 from E. coli K12 : B3256"
FT                   /db_xref="EnsemblGenomes-Gn:y0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83803"
FT                   /db_xref="GOA:A0A3N4B0W1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0W1"
FT                   /protein_id="AAM83803.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSVADRDLKHVLLA
FT                   DETVCIGPAPSVKSYLNIPAIISAAEITGAVAVHPGYGFLSENADFAEQVERSGFIFIG
FT                   PRAETIRLMGDKVSAISAMKKAGVPCVPGSDGPLSDDTTKNKAFAKRIGYPVIIKASGG
FT                   GGGRGMRVVRHDKDLEESINMTRAEAKAAFNNDMVYMEKYLENPRHIEVQILADGQGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGITSEMRRYIGERCAKACMEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTVTEMITGIDLIKEQLRIAAGQPLSIKQDEVKVHGHAVECRIN
FT                   AEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYGENRDVAI
FT                   ARMKNALAELIIDGIKTNVELQQRIMNDENFQHGGTNIHYLEKKLGLQET"
FT   gene            225624..225866
FT                   /locus_tag="y0210"
FT   CDS_pept        225624..225866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0210"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 79 of 80 are 68.35 pct identical to
FT                   residues 1 to 79 of 80 from E. coli K12 : B3257; residues 1
FT                   to 79 of 80 are 69.62 pct identical to residues 1 to 79 of
FT                   80 from GenPept : >gb|AAG58385.1|AE005553_7 (AE005553) orf,
FT                   hypothetical protein [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83804"
FT                   /db_xref="GOA:A0A3N4AXQ2"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXQ2"
FT                   /protein_id="AAM83804.1"
FT                   /translation="METRFLQANKEARWAFGLTLAYLAGWIITAYLPGNLPGMSGLPAW
FT                   FEAACIALPLLFIVLCILMVRLIFRDIPLEDDDAN"
FT   gene            225850..227310
FT                   /gene="panF"
FT                   /locus_tag="y0211"
FT   CDS_pept        225850..227310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panF"
FT                   /locus_tag="y0211"
FT                   /product="sodium/pantothenate symporter"
FT                   /function="transport; transport of small molecules;
FT                   cations"
FT                   /note="residues 1 to 472 of 486 are 82.83 pct identical to
FT                   residues 1 to 472 of 485 from E. coli K12 : B3258"
FT                   /db_xref="EnsemblGenomes-Gn:y0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83805"
FT                   /db_xref="GOA:Q8D1P2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1P2"
FT                   /protein_id="AAM83805.1"
FT                   /translation="MTMQTDVVLPLVGYLVLVFGLSIYAYTRRQTGNFLNEYFIGNRSM
FT                   GGFVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGVLGKKFAILA
FT                   RRYNAVTLNDMLYARYQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYDTG
FT                   LLIFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQHI
FT                   DPALVSPQGGDQILDVPFMASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIV
FT                   VAILMFGMHLAGALGRAVLPDLKIPDQVIPTLMITVLPPFAAGIFLAAPMAAIMSTINA
FT                   QLLQSSATIVKDLYLNLWPAELKNERKLARISSLSTLILGLLLLLAAWRPPEMIIWLNL
FT                   LAFGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSL
FT                   TLNLLAFYIGNLFGDRARARHPAIVSAD"
FT   gene            227347..228267
FT                   /gene="prmA"
FT                   /locus_tag="y0212"
FT   CDS_pept        227347..228267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="y0212"
FT                   /product="methylase for 50S ribosomal subunit protein L11"
FT                   /function="enzyme; ribosomal proteins - synthesis,
FT                   modification"
FT                   /note="residues 14 to 305 of 306 are 85.27 pct identical to
FT                   residues 1 to 292 of 293 from E. coli K12 : B3259"
FT                   /db_xref="EnsemblGenomes-Gn:y0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83806"
FT                   /db_xref="GOA:Q8ZAX6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAX6"
FT                   /protein_id="AAM83806.1"
FT                   /translation="MVMAPIPALERIAMPWIQLKLNTTGNQAESLGDVLVESGAVSVTF
FT                   QDTHDNPVFEPLPGETRLWGDTDVIGLYDAETDMADVVAMLECHPQIGKGFIHKIEQLE
FT                   DKDWEREWMDNFHPMRFGERLWICPSWRDVPDPTAVNVMLDPGLAFGTGTHPTTALCLQ
FT                   WLDSLDLNGKTLIDFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSER
FT                   LELYLAKDQPAELSADVVVANILAGPLRELAPLISVLPTTGGHLGLSGVLATQAAGVAQ
FT                   AYEDKFILDPVAEKEEWCRITGIKK"
FT   gene            228754..229821
FT                   /locus_tag="y0213"
FT   CDS_pept        228754..229821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0213"
FT                   /product="putative dehydrogenase"
FT                   /note="residues 35 to 355 of 355 are 87.85 pct identical to
FT                   residues 1 to 321 of 321 from E. coli K12 : B3260; residues
FT                   35 to 355 of 355 are 92.21 pct identical to residues 1 to
FT                   321 of 334 from GenPept : >gb|AAC77880.1| (AF040378) yhdG
FT                   homolog [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83807"
FT                   /db_xref="GOA:Q8ZAX7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAX7"
FT                   /protein_id="AAM83807.1"
FT                   /translation="MLFFHQLVKVWPFIWAQKCVIYAPLRTQCGHSLSMRIGHFQLTNC
FT                   LIAAPMAGITDRPFRALCHGMGAGMAVSEMLSSNPEVWRTDKSRLRMVHVDEPGIRNVQ
FT                   IAGNDPDEMAAAARINVASGAQIIDINMGCPAKKVNRKLAGSALLQHPDLVKQILSAVV
FT                   NAVDVPVTLKIRTGWSPEHRNCIEIAQLAENCGIQALTIHGRTRSCLFNGEAEYDSIRA
FT                   VKQTVSIPVIANGDITDPHKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELL
FT                   PPMPLGEVQRLLDGHIRELHDFYGPGKGFRIARKHVSWYLQEHAPNDQFRRTFNAIEDA
FT                   SEQLEALEAYFENLA"
FT   gene            229846..230142
FT                   /gene="fis"
FT                   /locus_tag="y0214"
FT   CDS_pept        229846..230142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="y0214"
FT                   /product="site-specific DNA inversion stimulation factor"
FT                   /function="factor; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="DNA-binding protein; a trans activator for
FT                   transcription; residues 1 to 98 of 98 are 97.95 pct
FT                   identical to residues 1 to 98 of 98 from E. coli K12 :
FT                   B3261"
FT                   /db_xref="EnsemblGenomes-Gn:y0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83808"
FT                   /db_xref="GOA:Q8ZAX8"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAX8"
FT                   /protein_id="AAM83808.1"
FT                   /translation="MFEQRVNSDVLTVATVNSQDQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(230896..231372)
FT                   /locus_tag="y0215"
FT   CDS_pept        complement(230896..231372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0215"
FT                   /product="hypothetical"
FT                   /note="residues 13 to 88 of 158 are 33.70 pct identical to
FT                   residues 4 to 89 of 134 from GenPept : >dbj|BAB04617.1|
FT                   (AP001510) BH0898; unknown conserved protein in B. subtilis
FT                   [Bacillus halodurans]"
FT                   /db_xref="EnsemblGenomes-Gn:y0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83809"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJN8"
FT                   /protein_id="AAM83809.1"
FT                   /translation="MNTENKKLSTLIGKIHTIAKSRLAAGYEDRNGINEHQVTPCHHAL
FT                   TLLGGDDFAESYLPFLRNVNGFDLNGVRLFGYFDDKGDERDLRKQLADLKAFPELFPDA
FT                   FNDWVLIGETDTDILIFNKKNGSYENRDRIGLDRLNESYDDIVGLLISLMPLIE"
FT   gene            complement(231438..232163)
FT                   /locus_tag="y0216"
FT   CDS_pept        complement(231438..232163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0216"
FT                   /product="putative transcriptional regulator"
FT                   /function="regulator"
FT                   /note="residues 29 to 231 of 241 are 36.71 pct identical to
FT                   residues 9 to 215 of 223 from GenPept : >dbj|BAB53015.1|
FT                   (AP003010) transcriptional regulator [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83810"
FT                   /db_xref="GOA:Q8D1N9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N9"
FT                   /protein_id="AAM83810.1"
FT                   /translation="MFCITEAWYKKQPYCRTGIQLMLAGMGVIKPETLRYQVENVLRQA
FT                   IMSGRFTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVPHKGPIVAIISRQEA
FT                   AELFALRGLLEGFAAREFAQRATDVAIVHFAQAIQALRMAGMTKDRAKVLKAKTDLYDV
FT                   LLDNCGNGLVKETLTSLHSRINLLRATSLMDPQRLPVSINEIDDLYQALKARDPDAAER
FT                   HVANAKEVALRILEETNAT"
FT   gene            complement(232190..233554)
FT                   /locus_tag="y0217"
FT   CDS_pept        complement(232190..233554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0217"
FT                   /product="putative metabolite transport protein, permease"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 31 to 444 of 454 are 26.35 pct identical to
FT                   residues 35 to 452 of 461 from GenPept : >dbj|BAB60327.1|
FT                   (AP000995) shikimate transporter [Thermoplasma volcanium]"
FT                   /db_xref="EnsemblGenomes-Gn:y0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83811"
FT                   /db_xref="GOA:A0A3N4AWC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWC0"
FT                   /protein_id="AAM83811.1"
FT                   /translation="METLSADSAITAAENDPLRDVKRKNAIKGAFFSEFIDMFDIYLPV
FT                   IVLPPVLFYFQPPNLSSSTANILASLVFITTLLGRPIGALLFGIMADRIGRRMASIYSV
FT                   SGFGVVTFLIALIPGYETLGIASYLLLVLLRFIDGIFLGGGYTGAIPLALEYSKKEQRG
FT                   FVGGLILSGFPAAYVAINLVAMLMFALIPLDGLYSPYAQWGWRIPFVIGGLLAGFLALY
FT                   YVFNVTESEVWQQGSSKKRAREKQPLSTLVSGQSGRNLWQVLLMMSGFWLTQNLITLFL
FT                   PTGLLINTLNMRGLQVTSILLVTYCVLFFSYIGMGMLGQKIGRRRFFMIAGPLIATMGS
FT                   ALLYVLSHGDGLSFSTVMLLVCLLAVVVTSPWGVIITYINEHFATGVRATGFGVGFSLS
FT                   VIIPSFYAFYMDWLSVVVPFELTAVVLLALGGMIGTVGAIMGPETKEVDFTSSAG"
FT   gene            complement(233708..234145)
FT                   /locus_tag="y0218"
FT   CDS_pept        complement(233708..234145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0218"
FT                   /product="putative decarboxylase"
FT                   /function="enzyme"
FT                   /note="residues 21 to 141 of 145 are 48.36 pct identical to
FT                   residues 15 to 136 of 139 from GenPept : >gb|AAK42990.1|
FT                   (AE006881) 4-carboxymucolactone decarboxylase (pcaC)
FT                   [Sulfolobus solfataricus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83812"
FT                   /db_xref="GOA:Q8D1N8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N8"
FT                   /protein_id="AAM83812.1"
FT                   /translation="MSNRVGYEIGRRVMMVAQDRFERGFHNRKVVLGAEHVETSWGNSD
FT                   EFNRPVQKLITEYCWGEVWGDPALTFKTRSMLNIGILTAMGQHHELSLHVKGALRNGVT
FT                   REEIRAVLLQTVVYCGAPVALAAFRIASAAIKAYDDEIADS"
FT   gene            complement(234281..235171)
FT                   /locus_tag="y0219"
FT   CDS_pept        complement(234281..235171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0219"
FT                   /product="putative oxidoreductase"
FT                   /function="enzyme"
FT                   /note="residues 6 to 290 of 296 are 34.58 pct identical to
FT                   residues 2 to 290 of 298 from GenPept : >emb|CAD17800.1|
FT                   (AL646080) probable 3-hydroxyisobutyrate dehydrogenase
FT                   oxidoreductase protein [Ralstonia solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83813"
FT                   /db_xref="GOA:A0A380PJ81"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PJ81"
FT                   /protein_id="AAM83813.1"
FT                   /translation="MKQLQRIGFIGLGKMGTPMVQRLVKAGFELYLCDADITKVQILTA
FT                   ELNAESLTVDNAASLDALITMLPNSEAVEQVLLGSDGISGWVAQLSQAAVVIDMSSSDP
FT                   ERSRRLAILLAVWELDYLDAPVSGGVKKAQNGTLSILIGGEDRVLKSCYTALAAMGEQI
FT                   LFVGPAGSGHAAKALNNYVSATGLLATIEALHVAQRFGIEPEVMTEVLNTSTGRSNTSE
FT                   NKVRQFMLNGSYASGFTLQLMNKDLHIARNLAQRLNYPMRLGMHCVDVWDEVSRRATPM
FT                   ADHTEMYRLLIDKEP"
FT   gene            complement(235236..236063)
FT                   /locus_tag="y0220"
FT   CDS_pept        complement(235236..236063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0220"
FT                   /product="hypothetical"
FT                   /note="residues 46 to 246 of 275 are 28.20 pct identical to
FT                   residues 34 to 254 of 262 from GenPept : >gb|AAB89741.1|
FT                   (AE000998) A. fulgidus predicted coding region AF1509
FT                   [Archaeoglobus fulgidus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83814"
FT                   /db_xref="GOA:A0A3N4B0V3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0V3"
FT                   /protein_id="AAM83814.1"
FT                   /translation="MENRDMSASHENYRIFAIKYAHHHRLTRDNFLGGDPHDGPMPIDY
FT                   FVWAIVGTTRTIMVDTGFDAAMAHQRGRTITHCIEDGLSQLGIDAGKIEDVIISHMHYD
FT                   HAGNHGLFPNARFHLQDREMAFCTGRCMGHHGLSQAFDVEDVKAMVGRLFAGRLQFHHG
FT                   DAEIAPGISVHRVGGHTDGLQIIRVHTARGWVVLASDATHFYANIQQRRPYPILYNVGD
FT                   VLEGYNTLYRWADSFDHIIPGHDPMVLQRYPAGTPETAAWIAQVDVAPLTQWT"
FT   gene            236518..236991
FT                   /gene="slyB"
FT                   /locus_tag="y0221"
FT   CDS_pept        236518..236991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyB"
FT                   /locus_tag="y0221"
FT                   /product="putative outer membrane receptor"
FT                   /function="putative membrane"
FT                   /note="residues 3 to 157 of 157 are 66.02 pct identical to
FT                   residues 1 to 155 of 155 from E. coli K12 : B1641; residues
FT                   3 to 157 of 157 are 73.71 pct identical to residues 1 to
FT                   155 of 155 from GenPept : >emb|CAA42977.1| (X60448) outer
FT                   membrane lipoprotein [Yersinia enterocolitica]"
FT                   /db_xref="EnsemblGenomes-Gn:y0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83815"
FT                   /db_xref="GOA:Q8D1N7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N7"
FT                   /protein_id="AAM83815.1"
FT                   /translation="MIMNKLAIAVALAATVLSGCANNTASGDTFTASQARQVQTVTYGS
FT                   IVSARPVTIQGGNNNNVAGAIGGAVVGGFLGNTIGGGRGNSLATAGGAVAGGVAGQGIQ
FT                   SAMNRSEGVQLEIRRDDGSNIVVVQAQGPTRFSAGQRVIIASDRSGTVTVSPR"
FT   gene            complement(237082..237279)
FT                   /locus_tag="y0222"
FT   CDS_pept        complement(237082..237279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0222"
FT                   /product="hypothetical"
FT                   /note="residues 41 to 57 of 65 are 76.47 pct identical to
FT                   residues 1185 to 1201 of 1247 from GenPept :
FT                   >gb|AAL20679.1| (AE008778) nitrate reductase 1, alpha
FT                   subunit [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZ38"
FT                   /protein_id="AAM83816.1"
FT                   /translation="MVFSSDFMGYVLHLMWINNLLRQLNACGNLCNIFGGGRAYHHFVT
FT                   HISPKPTHMIGGLRAISLRL"
FT   gene            237428..237736
FT                   /gene="cspI"
FT                   /locus_tag="y0223"
FT   CDS_pept        237428..237736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspI"
FT                   /locus_tag="y0223"
FT                   /product="cold shock-like protein"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 33 to 102 of 102 are 82.85 pct identical to
FT                   residues 1 to 70 of 70 from E. coli K12 : B1552; residues
FT                   33 to 102 of 102 are 98.57 pct identical to residues 1 to
FT                   70 of 70 from GenPept : >emb|CAB10779.1| (Z97978)
FT                   hypothetical protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83817"
FT                   /db_xref="GOA:Q8D1N6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N6"
FT                   /protein_id="AAM83817.1"
FT                   /translation="MSLLLSAQVRHPLKDRPRSLHYCGKIIEGNISMSNKMTGLVKWFD
FT                   AGKGFGFITPADGSKDVFVHFSAIQSNDFKTLDEGQNVEFSIENGAKGPSAVNVIAL"
FT   gene            237921..238208
FT                   /gene="cspI"
FT                   /locus_tag="y0224"
FT   CDS_pept        237921..238208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspI"
FT                   /locus_tag="y0224"
FT                   /product="cold shock-like protein"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 26 to 95 of 95 are 84.28 pct identical to
FT                   residues 1 to 70 of 70 from E. coli K12 : B1552; residues
FT                   26 to 95 of 95 are 100.00 pct identical to residues 1 to 70
FT                   of 70 from GenPept : >emb|CAB10779.1| (Z97978) hypothetical
FT                   protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83818"
FT                   /db_xref="GOA:Q8D1N5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N5"
FT                   /protein_id="AAM83818.1"
FT                   /translation="MPHKFYPSLSSRLWRQLKIIEGSISMSNKMTGLVKWFDAGKGFGF
FT                   ITPADGSKDVFVHFSAIQSNDFKTLDEGQNVEFSIENGAKGPAAVNVIAL"
FT   mobile_element  complement(238285..238994)
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            complement(238391..238900)
FT                   /locus_tag="y0225"
FT   CDS_pept        complement(238391..238900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0225"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 100.00 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83819"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAM83819.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            238849..239211
FT                   /locus_tag="y0226"
FT   CDS_pept        238849..239211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0226"
FT                   /product="hypothetical"
FT                   /note="residues 61 to 115 of 120 are 36.36 pct identical to
FT                   residues 30 to 81 of 275 from GenPept : >gb|AAL48672.1|
FT                   (AY071050) RE13795p [Drosophila melanogaster]"
FT                   /db_xref="EnsemblGenomes-Gn:y0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83820"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU2"
FT                   /protein_id="AAM83820.1"
FT                   /translation="MGPPFDFLLNICSCQTANCFNKSKGVFITDPKLKALLNPQPSWGF
FT                   SGHKKNLPPCRFFCAYDTGTDIKNTALPRAPESPADIIAAQKNHVTGQETVIWLNYLTI
FT                   LAGSPFIHLEQCETVV"
FT   gene            239254..240429
FT                   /locus_tag="y0227"
FT   CDS_pept        239254..240429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0227"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 388 of 391 are 58.50 pct identical to
FT                   residues 1 to 388 of 391 from GenPept : >gb|AAL19518.1|
FT                   (AE008722) putative ATPase involved in DNA repair
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83821"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWB9"
FT                   /protein_id="AAM83821.1"
FT                   /translation="MKKLIKRLEIIKSGIELEDDDIIRHQLPYLKSETQDPVLVFIVMA
FT                   IEQGKFTQALDAIATWLGSKQGVIQWQDIELAACKLELKALEEQLSELIDKRNERIQLL
FT                   DDFNDLYLVRLGPLMKQILNLRRQLAESTLRKAEAEARRRERDYRNCQQYISQAIDELI
FT                   SLKQRWLALPSISNDTIEIRNRIQQQTELITALLAEIKELENSFCTRNTESTRKAREEA
FT                   KEKYERYQEQQTDAEQRLDNDRKLSSEQRQDLKRLWRQASRLCHPDLVADAFKEKAHQL
FT                   MVQLNQARQRGDFPAIHALLESLKQGLEPLMASDLIDDLERLRRKISDVRTQIDAILHE
FT                   IDALKGEESWRLATSLPDKDKWFKEQENVLSKTLNILERQVEEASRVLYEA"
FT   gene            complement(240536..241882)
FT                   /locus_tag="y0228"
FT   CDS_pept        complement(240536..241882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0228"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 446 of 448 are 52.78 pct identical to
FT                   residues 1 to 449 of 452 from GenPept : >emb|CAC45768.1|
FT                   (AL591786) hypothetical signal peptide protein
FT                   [Sinorhizobium meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83822"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWB0"
FT                   /protein_id="AAM83822.1"
FT                   /translation="MHMSKFRLVLLASSIAFSTSSWAQAVEVPAVLAGHAVLPVKSTVA
FT                   TPSDAPTDLQQSGKYTSGQRVSALGSVAAKSADRLTGIGLPISGQPLQGHSGIKHMPDG
FT                   TYWVLTDNGFGSKANSPDAMLYLNHYNIDFKNGNVTPLQTVFLHDPDKKVPFHIINEST
FT                   EKRYLTGSDFDPESFQFADDALWIGDEFGPYLIKADLNGKVLAVFETQVDGNVVKSPDN
FT                   PTLTLPGAPDGKQNFQVARSKGFEGMAVSPDGSKLYPMLEGALWDGEKFENIDGKRYLR
FT                   VLEFDVKNQAWTGRSWQYVLEDNQNAIGDFNLIDANHGLVIERDNGEGTADKACAAGAP
FT                   TDKCFSQIAKFKRVYKIAFSDDNVGKPVEKVSYIDLLNIKDPQNLARKPLNNGVLTFPF
FT                   FTIENVDVVDASHIIVGNDNNFPFSSSRQPNEADDNEFILLDVKALLSQ"
FT   gene            242133..242987
FT                   /locus_tag="y0229"
FT   CDS_pept        242133..242987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0229"
FT                   /product="hypothetical protein"
FT                   /note="residues 2 to 280 of 284 are 70.25 pct identical to
FT                   residues 17 to 295 of 304 from E. coli K12 : B2989;
FT                   residues 2 to 280 of 284 are 72.04 pct identical to
FT                   residues 1 to 279 of 288 from GenPept : >gb|AAL22014.1|
FT                   (AE008844) putative glutathione S-transferase [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83823"
FT                   /db_xref="GOA:A0A3N4AZQ1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZQ1"
FT                   /protein_id="AAM83823.1"
FT                   /translation="MMKDNEYQPPKIWTENNASGGVWSKINRPTAGARYEADLPVGKHP
FT                   LQLYSMGTPNGQKVTILLEELLALGEKGAEYDAHLIRISEGEQFSSGFVSINPNSKIPA
FT                   LMDYSSTPPVRVFESGAILLYLADKFGHFLPKSHAARTEALNWLFWLQGAAPYLGGGFG
FT                   HFYHYAPVKIEYAIDRFTMEAKRQLDLLNTQLKTHEYIAGDEYTIADIAIWPWYGSLVL
FT                   GLQYEAGEFLDVKSYPHLIRWTETIAKRPAVQRGRIVNRTWGAPEEQLPERHDAADFDR
FT                   LIK"
FT   gene            complement(243177..243782)
FT                   /locus_tag="y0230"
FT   CDS_pept        complement(243177..243782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0230"
FT                   /product="hypothetical"
FT                   /note="residues 14 to 194 of 201 are 44.75 pct identical to
FT                   residues 14 to 194 of 200 from GenPept : >emb|CAC95734.1|
FT                   (AL596165) similar to putative sugar-phosphate isomerase
FT                   [Listeria innocua]"
FT                   /db_xref="EnsemblGenomes-Gn:y0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83824"
FT                   /db_xref="GOA:A0A380PHA6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PHA6"
FT                   /protein_id="AAM83824.1"
FT                   /translation="MSQNKEWLAASDAWMIYSRELAALKENVDQQVWLQVLDALAECRG
FT                   KIAVTGVGTSGIAARKVAHMLACVEQPAIYLNATDAAHGDLGFLGAQDIIILISRGGNS
FT                   DELTRLLPTLQRKQVKIISVTENEQSAIAQVSALVLKTHVKQEIDPLNMLATTSIVLVL
FT                   ALFDAICACLMARTGFSKETLLAVHPGGDVGMVLRKQQ"
FT   gene            complement(243779..245431)
FT                   /locus_tag="y0231"
FT   CDS_pept        complement(243779..245431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0231"
FT                   /product="putative sugar kinase"
FT                   /function="enzyme"
FT                   /note="residues 8 to 548 of 550 are 50.44 pct identical to
FT                   residues 13 to 566 of 569 from GenPept : >emb|CAB81024.1|
FT                   (AL161576) putative protein [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83825"
FT                   /db_xref="GOA:Q8D1N4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N4"
FT                   /protein_id="AAM83825.1"
FT                   /translation="MRDKTMASYFIGVDVGTGSARAGVFDLQGRMVGQASREITMFKPK
FT                   ADFVEQSSENIWQAVCNAVRDAVNQADINPIQVKGLGFDATCSLVVLDKEGNPLTVSPS
FT                   GRNEQNVIVWMDHRAITQAERINATKHPVLEFVGGVISPEMQTPKLLWLKQHMPNTWSN
FT                   VGHLFDLPDFLTWRATKDETRSLCSTVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAK
FT                   IGATVKPMGAPLGHGLSQRAASEMGLIPGTAVSVSIIDAHAGTIGILGASGVTGENANF
FT                   DRRIALIGGTSTAHMAMSRSAHFISGIWGPYYSAILPEYWLNEGGQSATGALIDHIIQS
FT                   HPCYPALLEQAKNKGETIYEALNYILRQMAGEPENIAFLTNDIHMLPYFHGNRSPRANP
FT                   NLTGIITGLKLSTTPEDMALRYLATIQALALGTRHIIETMNQNGYNIDTMMASGGGTKN
FT                   PIFVQEHANATGCAMLLPEESEAMLLGSAMMGTVAAGVFESLPEAMAAMSRIGKTVTPQ
FT                   TNKIKAYYDRKYRVFHQMYHDHMRYQALMQEGA"
FT   gene            complement(245435..246388)
FT                   /locus_tag="y0232"
FT   CDS_pept        complement(245435..246388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0232"
FT                   /product="putative permease of ABC transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 20 to 310 of 317 are 58.76 pct identical to
FT                   residues 16 to 306 of 318 from GenPept :
FT                   >gb|AAG54673.1|AE005211_8 (AE005211) putative permease
FT                   component of transport system, probably ribose specific
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83826"
FT                   /db_xref="GOA:A0A3N4AXM9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXM9"
FT                   /protein_id="AAM83826.1"
FT                   /translation="MTWLNRTIPDDRIIRLQLLILIAVMLVFSLTLGQRFFSLGNFQSM
FT                   SSQLPILGMLALGMGLTMLTGGINLSIIAGANACSLVMAAIIVSHPGQPAFLLLALVAG
FT                   LLVAVAIGTLNGVLISVIGVSPILATLGTMTLITGLNILLSNGDVISGFPPVIQYIGSG
FT                   DIVGIPVAMILFLLVAAGLWVLLEHTTLGRSIYLVGSNEQATRFSGVNTHRVQIAVYIL
FT                   SALLGWGAAILMMAKFNSAKAGYGESYLLVTILASVLGGINPDGGFGRIIGLILALVVL
FT                   QLLESGLNLLGVSSYLTMALWGGVLILFIALQNRKA"
FT   gene            complement(246390..247379)
FT                   /locus_tag="y0233"
FT   CDS_pept        complement(246390..247379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0233"
FT                   /product="putative permease of ABC transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 6 to 321 of 329 are 57.59 pct identical to
FT                   residues 1 to 316 of 323 from GenPept :
FT                   >gb|AAG54672.1|AE005211_7 (AE005211) putative permease
FT                   component of transport system, probably ribose specific
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83827"
FT                   /db_xref="GOA:A0A3N4AZ29"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZ29"
FT                   /protein_id="AAM83827.1"
FT                   /translation="MDKLKLRQLTGHHEFYLGLLVLLLAIGLSVQSPEFLTLGNLTDVA
FT                   TSYAILGILACGLFVVLIAGGIDISFPAVTAIAQYVMASWVITQGGSFPLALVMAMAVG
FT                   LLLGLINGLLVYWLKVPAIIITIATLNLFYGLLVYFTNGTWLYGFPDWFMTGINWFSFE
FT                   GSDGYDYGLTLPLLCLAGTIIFTGVMMNYTRLGRQIFAMGSNKDAASRLGINIFRLHLY
FT                   VYGYMGILAGVAAVVQAQISQSVAPNSLMGFELTVLAAVVLGGTSMSGGRGSLTGTVLG
FT                   VMLLAFLQNGLTLLSVSSYWHTVFSGVIILVSISTTAWNEKRKLLREH"
FT   gene            complement(247372..248868)
FT                   /locus_tag="y0234"
FT   CDS_pept        complement(247372..248868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0234"
FT                   /product="putative ATP-binding protein of ABC transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 116 to 498 of 498 are 61.19 pct identical
FT                   to residues 9 to 392 of 392 from GenPept :
FT                   >gb|AAG54671.1|AE005211_6 (AE005211) putative ATP-binding
FT                   component of transport system, probably ribose specific
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83828"
FT                   /db_xref="GOA:A0A2S9PE17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PE17"
FT                   /protein_id="AAM83828.1"
FT                   /translation="MTQATAFITLENISKRFPGVLALDGVNLTLNKGEVHCLAGQNGCG
FT                   KSTIIKVISGVYQPEKGASILIDGKLLHQLTPQLSFYYGVQVIYQDLSLFPNLTVAENI
FT                   AVHRYLPGGDFWVKRKSMRERALAAMQRVGVTLDLDKKVEQLSIADRQLVAICRAIAAD
FT                   ARLVIMDEPTASLTSQEVKGLLNVVRDLKSQGICVVFVSHRLDEVMEVADRISVMRDGK
FT                   WVGTWQASELDSHELAFLMTGQRFTYRPLPPLAAKAAPLLEIRKLSRGEQFRNIDLTLH
FT                   QGEIVSITGLLGAGRTELCLSLFGMTQPESGEIFVAGEPVRFRHNRDAIRHGIGYVSED
FT                   RLTQGLIMEQSIYDNTIVSVFDQLHTRSGLLDHSKAAALVNKLVQDLNIKVSDTALPVK
FT                   TLSGGNAQRIAIAKWVATQPRILILDSPTVGVDIANKEGIYHIAKALAEQGMAVLMICD
FT                   EIPEAYYNSHRVLVMRKGELIAEFYPHQCTEQQIAEVVNG"
FT   gene            complement(249072..250130)
FT                   /locus_tag="y0235"
FT   CDS_pept        complement(249072..250130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0235"
FT                   /product="putative periplasmic binding protein of ABC
FT                   transporter"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="residues 25 to 350 of 352 are 53.37 pct identical to
FT                   residues 5 to 327 of 328 from GenPept :
FT                   >gb|AAG54669.1|AE005211_4 (AE005211) putative periplasmic
FT                   binding protein, probable substrate ribose [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83829"
FT                   /db_xref="GOA:A0A3N4AWD1"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWD1"
FT                   /protein_id="AAM83829.1"
FT                   /translation="MQHNKISYLATVPLPERKQEGIAMKFNLALLNVCIVSACMLFTTQ
FT                   TLAAEKKHEIAVVAKVTGIPWFTRMEVGVNEAAKKLNVNAYQVGPATPDPAQQVKVIED
FT                   LIAKNVDAIIVVPNDAKVLEPVLKKAQEKGIVVLTHESPDQRIGQWDVETIDSEKYAQA
FT                   NMDELAKAMGNKGGYAIYVGSLTVPLHNAWADYAIKYQKEKYPEMFEVTPRLPVAENID
FT                   KSYSTTLDLMKTYPQMKGIIGFGSLGPIGAGQAVAKKRAKDQIAVVGIAMPAQAAPYLM
FT                   RGDIKKALLWDPKDAGFAVVEIANQLLNGQKVTEDLTIDGLGKADVDSKNGVIRFNKIL
FT                   EVTKDNAKTLGF"
FT   gene            250774..251775
FT                   /gene="ddg"
FT                   /locus_tag="y0236"
FT   CDS_pept        250774..251775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddg"
FT                   /locus_tag="y0236"
FT                   /product="putative heat shock protein"
FT                   /function="putative factor"
FT                   /note="residues 25 to 333 of 333 are 66.66 pct identical to
FT                   residues 20 to 327 of 328 from E. coli K12 : B2378;
FT                   residues 28 to 333 of 333 are 66.66 pct identical to
FT                   residues 1 to 305 of 306 from GenPept : >emb|CAD07638.1|
FT                   (AL627274) putative acyltransferase [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83830"
FT                   /db_xref="GOA:Q8D1N3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N3"
FT                   /protein_id="AAM83830.1"
FT                   /translation="MSEDMYRYRVMSLCVTHSHLTHNDRVHMIKPQKFHISLLHPRYWL
FT                   TWFGLGVLFLLVQLPYPLLNKLGVWLGRTSMRFLKRRVSIARRNLELCFPDMDKQVLEQ
FT                   TIIGNFESLGMGLLETGMAWFWSDTRIQRWFSVSGLENLKRAQQGKRGVLVIGVHFMSL
FT                   ELGGRVMGQCQPMMAMYRPHNNKVMELVQTWGRMRSNKAMLDRRDLRGMVRALKQGEAV
FT                   WFAPDQDYGPRGSVFAPLFAVEHAATTSGTFMLARLAKPALLPLVLLRKKEGRGYDLLI
FT                   QPALEDYPIDDEIAAASYMNKVIEKEIMRAPEQYLWLHRRFKTRPIGEPSLY"
FT   gene            251819..253114
FT                   /locus_tag="y0237"
FT   CDS_pept        251819..253114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0237"
FT                   /product="hypothetical"
FT                   /note="residues 186 to 247 of 431 are 26.15 pct identical
FT                   to residues 515 to 579 of 865 from GenPept :
FT                   >dbj|BAB73440.1| (AP003587) ORF_ID:all1741; probable
FT                   proteinase [Nostoc sp. PCC 7120]"
FT                   /db_xref="EnsemblGenomes-Gn:y0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83831"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU1"
FT                   /protein_id="AAM83831.1"
FT                   /translation="MKGKRAVGVVGITAHFILWFNRSNVALIPFFEGPSIMKSLILLLA
FT                   LLIPASVTANTLSVEPKDTKPALIDSLSATFAIDKIAMLKKEKGANESNLYLPFEQTKD
FT                   GLAILFGDINQDGKIDALVPFTWEGLNGLDQEIPSNDWYSYYAIYLQDDQGWKQVGQIP
FT                   TGTFTTDNQTLLTNIEDGVIYGEIMPRMTDDDPQPQQWVLRAHPEKDNLLVPIPTPQPL
FT                   ANALTLNLSKKRPLTRNALVTAFGEPINIGDNYFLVDGDCVGHPDWKYYQYPGAAFNVS
FT                   QNDNSVGVSHFIGIPDNLSLVLGDLTITQKTSAHQLIKALSQNDSFTVSRTSTDLRTDL
FT                   GQSSPYFDDANDIFALRLPYYIAGFEAWAKKNEAREVPNDEEADTFTRQFYFTTTIGVA
FT                   PIQNSPTRLMFYFLGDKMVALSVIYDDGQVCI"
FT   gene            complement(253332..255002)
FT                   /locus_tag="y0238"
FT   CDS_pept        complement(253332..255002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0238"
FT                   /product="hypothetical protein"
FT                   /note="residues 8 to 554 of 556 are 75.13 pct identical to
FT                   residues 1 to 547 of 549 from E. coli K12 : B4065; residues
FT                   5 to 555 of 556 are 74.95 pct identical to residues 13 to
FT                   563 of 563 from GenPept : >emb|CAD09253.1| (AL627282)
FT                   putative sodium/hydrogen exchanger family protein
FT                   [Salmonella enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83832"
FT                   /db_xref="GOA:Q8D1N2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N2"
FT                   /protein_id="AAM83832.1"
FT                   /translation="MWSLKESMEIFFTILILILVVSLSGVVTRMLPFQVPLPLMQIVCG
FT                   ALLAWPNFGLHVNFDPELFLVLFIPPLLFADGWKTPTREFIHHGREILGLALALVLVTI
FT                   VGIGYLIYWMVPGIPLVAAFALAAVLSPTDAVALSGIVGKGRIPKSIMGVLEGEALMND
FT                   ASGLVALKFAIAVAMGTMIFTVSGATLEFLKVAIGGLLAGVAITWLYSKSLRIMSRWSG
FT                   DDPATQIVLLLLLPFASYLVAEHLGVSGILAAVAAGMTISQSGIIRNAPLAMRLRADSV
FT                   WSMLEFVFNGMVFILLGLQLPGILETSITQAELDPTIQTWNLFADVAIIYGALLLLRFG
FT                   WLWSMKKISKRVLTKRPLQFSDYTTRELWVASFAGVRGAITLAGVLSIPLFLSDGSAFP
FT                   SRYQLVFIATGVILLSVIIGVIALPPLLRGVVVADKSASREEIRLARAAMAEVAIVSLN
FT                   KMEERLMTSSEENIDSELLKEVSSRVIGTLRRRTGSKDEVENTLLIENLERRFRLTALR
FT                   AERGELYHLRATQKISNETLQKLLHDLDLLEALLIEKEG"
FT   gene            complement(255330..256685)
FT                   /locus_tag="y0239"
FT   CDS_pept        complement(255330..256685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0239"
FT                   /product="putative transporter"
FT                   /note="residues 4 to 451 of 451 are 85.04 pct identical to
FT                   residues 2 to 449 of 449 from E. coli K12 : B4064; residues
FT                   9 to 451 of 451 are 87.35 pct identical to residues 13 to
FT                   455 of 455 from GenPept : >gb|AAG58013.1|AE005518_7
FT                   (AE005518) Z4223 gene product [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83833"
FT                   /db_xref="GOA:A0A3N4AZP9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZP9"
FT                   /protein_id="AAM83833.1"
FT                   /translation="MSSSNPQAQPKGTLDAFFKLSERGSNVRQEVLAGLTTFLAMVYSV
FT                   IVVPSMLGKAGFPPTAVFVATCLVAGLGSLLMGLWANLPMAIGCAISLTAFTAFSLVLG
FT                   QQISIPVALGAVFLMGVLFTIISVTGIRSWILRNLPMGVAHGTGIGIGLFLLLIAANGV
FT                   GLVIKNPIEGLPVALGAFTSFPVIMTLLGLAVIFGLEKLRVPGGILLVIVAISVIGLIF
FT                   DPSVTYQGLFAMPSLADANGDSLIFSLDIMGALQPVVLPSVLALVMTAVFDATGTIRAV
FT                   AGQANLLDKDGQIISGGKALTTDSVSSIFAGLVGAAPAAVYIESAAGTAAGGKTGLTAT
FT                   VVGILFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVSKLDFEDFVDAMSGLLCAVF
FT                   IVLTCNIVTGIMLGFSSLVIGRVCSGEWRKLNVGTVIIAVALVAFYAGGWAI"
FT   gene            257139..257342
FT                   /locus_tag="y0240"
FT   CDS_pept        257139..257342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0240"
FT                   /product="putative DNA-damage inducible protein"
FT                   /note="residues 7 to 66 of 67 are 38.33 pct identical to
FT                   residues 26 to 85 of 86 from GenPept :
FT                   >gb|AAG54551.1|AE005201_4 (AE005201) damage-inducible
FT                   protein J [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83834"
FT                   /db_xref="GOA:A0A3N4BA97"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA97"
FT                   /protein_id="AAM83834.1"
FT                   /translation="MANAKALGLDLSTVIRMVVNRLAVNAELPIDLLQPNQETLQAIRD
FT                   LENGVEVYRVDSVDALKRDLGW"
FT   gene            257698..257781
FT                   /locus_tag="y0241"
FT   CDS_pept        257698..257781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0241"
FT                   /product="hypothetical"
FT                   /note="residues 2 to 27 of 27 are 57.69 pct identical to
FT                   residues 73 to 98 of 98 from GenPept : >gb|AAF96231.1|
FT                   (AE004370) conserved hypothetical protein [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83835"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLU0"
FT                   /protein_id="AAM83835.1"
FT                   /translation="MPDLLLIYQRTDSEIKLYRVGSHSDLF"
FT   gene            complement(257961..258815)
FT                   /gene="ssuB"
FT                   /locus_tag="y0242"
FT   CDS_pept        complement(257961..258815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="y0242"
FT                   /product="putative ATP-binding component of a transport
FT                   system of aliphatic sulfonates ABC transporter"
FT                   /function="transport of small molecules; carbohydrates,
FT                   organic acids, alcohols"
FT                   /note="residues 22 to 256 of 284 are 72.34 pct identical to
FT                   residues 8 to 242 of 255 from E. coli K12 : B0933; residues
FT                   16 to 260 of 284 are 72.24 pct identical to residues 11 to
FT                   255 of 274 from GenPept : >gb|AAG06830.1|AE004765_3
FT                   (AE004765) probable ATP-binding component of ABC
FT                   transporter [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83836"
FT                   /db_xref="GOA:Q74PI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74PI5"
FT                   /protein_id="AAM83836.1"
FT                   /translation="MASGLSTKIRRSAMTTLTHIPQGTPITLESIGKRYGNRTVLDNLQ
FT                   LRITAGQFVAVVGRSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKDETRLMFQEAR
FT                   LLPWKKVIDNVGLGLRGHWRDEALQVLDTVGLADRANEWPAALSGGQKQRVALARALIH
FT                   RPRLLLLDEPLGALDALTRIEMQGLIERLWQQHGFTVLLVTHDVSEAIALADRVLLIEE
FT                   GRIGLDLAIDLPRPRRKGSAKLAALEAEVLERVLSPPQGIEASRQGIKASRQGTATSRR
FT                   VAN"
FT   gene            complement(258773..259570)
FT                   /gene="ssuC"
FT                   /locus_tag="y0243"
FT   CDS_pept        complement(258773..259570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="y0243"
FT                   /product="putative transport system permease protein of
FT                   aliphatic sulfonates ABC transporter"
FT                   /function="transport of small molecules; carbohydrates,
FT                   organic acids, alcohols"
FT                   /note="residues 1 to 260 of 265 are 79.61 pct identical to
FT                   residues 15 to 274 of 278 from E. coli K12 : B0934;
FT                   residues 2 to 264 of 265 are 80.98 pct identical to
FT                   residues 1 to 262 of 262 from GenPept :
FT                   >gb|AAG06831.1|AE004765_4 (AE004765) probable permease of
FT                   ABC transporter [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83837"
FT                   /db_xref="GOA:A0A3N4AXM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXM2"
FT                   /protein_id="AAM83837.1"
FT                   /translation="MMTISAQRILHRLAPWILPVALVVGWQVAVEAGWLSNRILPAPSA
FT                   VVTAFWALTKSGELWQHLTISSWRALIGFSIGGSIGLVLGVITGLSRWGERLLNSSVQM
FT                   IRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIKNIDSGLLEMARSYG
FT                   LSGFRLLTQVVLPGALPSIMVGVRFALGFMWLTLIVAETISANSGIGYLAMNAREFLQT
FT                   DVVVVAIVLYALLGKLADGSAQLLERVWLRWHPAYQQKSGEAQ"
FT   gene            complement(259579..260727)
FT                   /locus_tag="y0244"
FT   CDS_pept        complement(259579..260727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0244"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 382 of 382 are 78.79 pct identical to
FT                   residues 1 to 381 of 381 from E. coli K12 : B0935; residues
FT                   1 to 382 of 382 are 81.93 pct identical to residues 1 to
FT                   382 of 382 from GenPept : >gb|AAF81710.1|AF250869_2
FT                   (AF250869) sulfonate monooxygenase [Buttiauxella sp. PNBS]"
FT                   /db_xref="EnsemblGenomes-Gn:y0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83838"
FT                   /db_xref="GOA:Q8ZB04"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZB04"
FT                   /protein_id="AAM83838.1"
FT                   /translation="MSINVFWFLPTHGDGHYLGSSEGARAVDYSYLQQIAQAADRLGFG
FT                   GVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDRLSNGRAL
FT                   FNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETVDFAGKHIQVKGAKLL
FT                   FPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVRAKAAAKGRTV
FT                   RFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFAGFDSVGQQRMAALHGGKK
FT                   DNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGIDTFVFSGYPHLEEAYR
FT                   VSELLFPHLDLATTELPTQRPATQPQGEVVANIYVPQKVSQS"
FT   gene            complement(260746..261882)
FT                   /gene="ssuA"
FT                   /locus_tag="y0245"
FT   CDS_pept        complement(260746..261882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="y0245"
FT                   /product="solute-binding periplasmic protein of aliphatic
FT                   sulfonates, ABC transporter"
FT                   /function="transport of small molecules; carbohydrates,
FT                   organic acids, alcohols"
FT                   /note="residues 18 to 333 of 378 are 73.10 pct identical to
FT                   residues 17 to 331 of 333 from E. coli K12 : B0936;
FT                   residues 18 to 333 of 378 are 73.41 pct identical to
FT                   residues 17 to 331 of 333 from GenPept :
FT                   >gb|AAG55421.1|AE005283_8 (AE005283) orf, hypothetical
FT                   protein [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83839"
FT                   /db_xref="GOA:Q8D1N0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1N0"
FT                   /protein_id="AAM83839.1"
FT                   /translation="MSLSFFFRRGFNVHRWLNIGAMAAIITLAFTNTVIAQDNAPAQFR
FT                   IGYQKGSVNLVLAKTHQLLEKRFPDTQISWIEFPAGPQMLEALNVNSIDLGSTGDIPPI
FT                   FAQAAGADLLYVGMEPPKPKAEVILVPENSAINSVAELKGHKVAFQKGSSSHNLLLQAL
FT                   QKAGLKFTDIQPVYLTPADARAAFQQGNVDAWVIWDPYYSAALLQGGIRVLIDGSQLNQ
FT                   TGSFYLASRPYTEANGPFIQQVLEVLTQADALTLSDRAQSITLLANAMGLPEAVIASYL
FT                   DHRPPTAIQPLSQATVAAQQRTADLFFANRLLPVKVDISQRVWQPAGQLSSKPPSSKPS
FT                   SSKPSSSNQSSPSQLPTDQPSIAQTSIEQSSTAKSQTK"
FT   gene            complement(261897..262478)
FT                   /locus_tag="y0246"
FT   CDS_pept        complement(261897..262478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0246"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 175 of 193 are 61.14 pct identical to
FT                   residues 1 to 175 of 191 from E. coli K12 : B0937; residues
FT                   1 to 175 of 193 are 61.71 pct identical to residues 1 to
FT                   175 of 191 from GenPept : >dbj|BAB34443.1| (AP002553)
FT                   NAD(P)H-dependent FMN reductase [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83840"
FT                   /db_xref="GOA:A0A2S9PDX7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PDX7"
FT                   /protein_id="AAM83840.1"
FT                   /translation="MRVISLAGSPRTPSRSAALLNLSQHWLQQQNVEVIPYTLHDFQAD
FT                   DLLRANFNSPDVSAFVAQLATADGLLIATPIYKASFSGALKTLLDLLPERALDHKVVLP
FT                   LATGGSIGHMLAVDYALKPVLTALKAQEVLHGVFVDDSQVVFHGEQVTVSTSATTRLEE
FT                   ALESFYLALGRRKPLASNAVSSSLVQQTAA"
FT   gene            262949..263650
FT                   /locus_tag="y0247"
FT   CDS_pept        262949..263650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0247"
FT                   /product="putative deoxyribose-phosphate aldolase"
FT                   /function="enzyme"
FT                   /note="residues 9 to 225 of 233 are 34.10 pct identical to
FT                   residues 11 to 222 of 224 from GenPept : >gb|AAB85318.1|
FT                   (AE000859) deoxyribose-phosphate aldolase
FT                   [Methanothermobacter thermautotrophicus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83841"
FT                   /db_xref="GOA:A0A3N4BJG6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJG6"
FT                   /protein_id="AAM83841.1"
FT                   /translation="MIDFNDPRQVAKAIQFTNVNADLTREGVIKHLNICLEYQFDAAMI
FT                   APCWVYLAKDVLKGSGVRVATTVNFPQANDTTAMKVAIVRELAKEGADEFDFPPNPGFL
FT                   LGGLDELYFNELKEVTHIAHDLGMKVKAMLEFGFITEEAMKIKATRYAYEAGIDWVKQS
FT                   SGWGKGGCAATVEDVQLLKANIQAPCRVKVSGKVNTLEKMKEMFLAGAELVGTSSGPEL
FT                   VKGLTGDINAY"
FT   gene            263804..264736
FT                   /locus_tag="y0248"
FT   CDS_pept        263804..264736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0248"
FT                   /product="putative ribokinase"
FT                   /function="enzyme; degradation of small molecules; Carbon
FT                   compounds"
FT                   /note="residues 4 to 299 of 310 are 39.26 pct identical to
FT                   residues 5 to 301 of 308 from GenPept :
FT                   >gb|AAG05338.1|AE004621_9 (AE004621) ribokinase
FT                   [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83842"
FT                   /db_xref="GOA:A0A3N4AW99"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW99"
FT                   /protein_id="AAM83842.1"
FT                   /translation="MMSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMA
FT                   VQAVRLGAEVAYAGVVGDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEAR
FT                   NVIVVDMGANKLFTPALVDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILN
FT                   PAPARDLRGLDLSAIDYLTPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLG
FT                   ESGSAVFGRNDTQEIPPCIIDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAAL
FT                   CCMDWETVPSYRYREDVDAFMRSITVKEE"
FT   gene            264742..265245
FT                   /locus_tag="y0249"
FT   CDS_pept        264742..265245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0249"
FT                   /product="putative inner membrane permease"
FT                   /function="putative transport; transport of small
FT                   molecules; carbohydrates, organic acids, alcohols"
FT                   /note="residues 1 to 135 of 167 are 34.04 pct identical to
FT                   residues 1 to 139 of 139 from GenPept : >gb|AAC22159.1|
FT                   (U32732) high affinity ribose transport protein (rbsD)
FT                   [Haemophilus influenzae Rd]"
FT                   /db_xref="EnsemblGenomes-Gn:y0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83843"
FT                   /db_xref="GOA:A0A3N4AW87"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW87"
FT                   /protein_id="AAM83843.1"
FT                   /translation="MRPDRILHPELAAALATLGHTDIILVTDAGFPIPPQAKRIDLGFW
FT                   PGTVDVLHILRVLRKEIFVEEVRFASEVRDCHPQLYRDVQTLYTGSGAEFQAASHETLC
FT                   HDLAHQAKVVIRSGSFNPWANFALVASTDPFAWFTDESGVKPLPAYVARRQRILDNVVP
FT                   ELNA"
FT   gene            complement(265407..266348)
FT                   /locus_tag="y0250"
FT   CDS_pept        complement(265407..266348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0250"
FT                   /product="putative AraC-like regulator"
FT                   /function="regulator"
FT                   /note="residues 54 to 306 of 313 are 23.57 pct identical to
FT                   residues 51 to 302 of 307 from GenPept :
FT                   >gb|AAG06959.1|AE004778_3 (AE004778) transcriptional
FT                   regulator MmsR [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83844"
FT                   /db_xref="GOA:A0A3N4AZN8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZN8"
FT                   /protein_id="AAM83844.1"
FT                   /translation="MACHDEPGYSLNFCHQHRVGRMEKNMQRTQVVANWYRESDEFSTL
FT                   VNYRILRAGHIRAADNFHVRRQSVAGHELIFCLNGSGFIRLENNLHEVKKGNLAWLPVR
FT                   WPHEHFPNKQEPWEILWLRIDGAKLNNIMQILDVAQQPVFEFTSPETITDIYHRLFDLM
FT                   QSHTLVADAHCDVLCSQLIYTLLENRSFDATKSPVISHRGLGRLIYQIHSHYNDDWDID
FT                   KFMQYCQVSKSQLFRLFQETFNQSPLRWLKNYRLSQARRLLVETEETISRIAGLVGYND
FT                   PLHFSRDFHRSVGLSPSDFRRQERQLDNDRHD"
FT   gene            266543..267673
FT                   /locus_tag="y0251"
FT   CDS_pept        266543..267673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0251"
FT                   /product="putative oxidoreductase"
FT                   /note="residues 18 to 370 of 376 are 43.94 pct identical to
FT                   residues 13 to 359 of 362 from GenPept : >dbj|BAB49039.1|
FT                   (AP002998) hypothetical protein [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83845"
FT                   /db_xref="GOA:A0A2S9PDY4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PDY4"
FT                   /protein_id="AAM83845.1"
FT                   /translation="MDTLISQLEHATQPVLPKRRDYRIGIIGAGFIVEHCHLVAYQKAG
FT                   FVPYGITSKEHSQNHRLAETFAIKKVYETWQDMVCDPQIDIIDIAVPPHIQLEIVRFIC
FT                   ESNSAAKHIKGILCQKPLAMSLKDGREIVRLSQQSGIPIAVNSNMRYDPSMRALKYILE
FT                   NQLIGDPVIASIDMRAIPDWQAFLQKYKKLELYAMAIHHIDAFRFLFGDPVKVTAVCRT
FT                   DPRTTFEHIDGITQYTFQYANGLIATSLDDVWAWPGEPCAKNNYINWRVEGSDGLAEGD
FT                   FGWHRREPEYCGSTLKLASRNHPGQWIAPKWERQWFPDAFIGTMANLMCAIEENRPPEI
FT                   SAEDNLGTLACIEACYLSIQQERTVYLNEILLENAK"
FT   gene            267670..268569
FT                   /locus_tag="y0252"
FT   CDS_pept        267670..268569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0252"
FT                   /product="hypothetical"
FT                   /note="endonuclease motif; residues 1 to 298 of 299 are
FT                   51.48 pct identical to residues 1 to 303 of 304 from
FT                   GenPept : >dbj|BAB49038.1| (AP002998) unknown protein
FT                   [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83846"
FT                   /db_xref="GOA:A0A3N4B0S6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0S6"
FT                   /protein_id="AAM83846.1"
FT                   /translation="MINVGIFTGYYPYTLSGTIDKIKQAGMGCVQLDLEFTDIDLRRGR
FT                   ITKEKAHQVRNAFRRANIPIVAISAYTNLVHPDPVKRAENIAAVKEILAHARHFGTPYV
FT                   ISETGTYNTDSDWLYDPKNSTEEAYQEFKAIAKELATFAYEHNAVFLVENYVNNIIGSV
FT                   GQVARLMQEVEHPGLGLALDPTNYFDDKNIDAIDETLHNIFNVLESRIKIAHAKDCKKT
FT                   DAIAEKFGGGAAEHNSFRGAGSVELPAAGLGALNYPLYVELLAQKHPNIPLIIEHVDEE
FT                   DIPRAKRFVDEVLMATGS"
FT   gene            268784..268858
FT                   /locus_tag="y0253"
FT   CDS_pept        268784..268858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0253"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83847"
FT                   /db_xref="GOA:Q8CLT9"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT9"
FT                   /protein_id="AAM83847.1"
FT                   /translation="MDWIQDNSEMYLAGDWLTQTGLTG"
FT   gene            complement(268916..269710)
FT                   /locus_tag="y0254"
FT   CDS_pept        complement(268916..269710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0254"
FT                   /product="hypothetical"
FT                   /note="residues 42 to 145 of 264 are 31.77 pct identical to
FT                   residues 163 to 258 of 325 from GenPept : >emb|CAB12673.1|
FT                   (Z99108) similar to iron(III) dicitrate transport permease
FT                   [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXL5"
FT                   /protein_id="AAM83848.1"
FT                   /translation="MCTAIAIYGTENIPPETAYEIGMLFFKVIELDITSTGYYKYREDR
FT                   SEEDIDFIEVSLSDLKNELKNKNATSFRFYNESEKSNYWTASFGFSTSDFGGFYHFDAQ
FT                   CALSKNGKEKFIEFIKEFSSKNNFSYGIVYNPDNVADGFYYAEGGNFVQIYQYENPMFF
FT                   EKETGGMYEGQERYKNTMLRMVYPVNVINHHHLDIIIGNVSLKEWISSDEKHGTLEGLN
FT                   NDLWLWTVEDTKLDEVNKYLGEAGVLISWKPPTIKKAPRKLP"
FT   gene            complement(269719..274263)
FT                   /locus_tag="y0255"
FT   CDS_pept        complement(269719..274263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0255"
FT                   /product="Rhs-like core protein"
FT                   /note="Rhs element associated; residues 89 to 1396 of 1514
FT                   are 33.53 pct identical to residues 112 to 1362 of 1517
FT                   from GenPept : >emb|CAD18288.1| (AL646083) putative
FT                   RHS-related transmembrane protein [Ralstonia solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83849"
FT                   /db_xref="GOA:Q8D1M9"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M9"
FT                   /protein_id="AAM83849.1"
FT                   /translation="MFMTVAQSIGTGYGAAGAQSALRQTALGQQSPARTDYQVSNPNVG
FT                   NIARASDSLLNVAESQQFNTLVTAGFGMQAIAAGVAGGYVGAKIGNKLGHGIARALNFN
FT                   QVATEGESPAHLGHPIAHQKKDWGVWGAIGGILLGAAAAALVVVTFGTGLVVIAAAAAA
FT                   AGLIGGIAAATGAALGQYGDNKGVIAEGSANVFFEGQPVARVGDKIQCSDHPSSPPPMI
FT                   AEGAKTVFANQKQIARLGHRTTCDGNINAGCGSLAITQETAYVYEVADSRNPYLRWSAV
FT                   ILSFLPIQKKFEQGFRSLKKPPNTAVNATHNCPTGSDPVDMVSGDYLQVWPVIDIAGVL
FT                   PVRLQRTYRSGDYFTVSGCFGHKWADSWSQHLVVHEDNIDYIDEEGVGLSFFTPENKVQ
FT                   AVNLYNLRYELVGERHGELRVFDRSTQQTLHFNQQQQQQRYLSAITDRKGNRIDFRYQQ
FT                   GELISVEHSDGYVLEIDSRGRTIHAVELVTQEKRQKLLQSTFSERGYLVQCQSFQYGTL
FT                   SHEYDPKGYMVRWRDTDSTDVAVRYDISGRVVALKTSTGFFADHFIYHDKERYTIYRDG
FT                   EGGETGYHYNENNLLIKLVDPLGNTTLTDWDLTQKIKETDALGRITRFIYNERGDLTAV
FT                   ILPDETRTEYEYNPSGVVTAFTSSAGDSWQYQYDRQGLLRQVTYPSGQTMSFRYGKKGE
FT                   VLRKIIAEDQVWRYHYDHHGCLSTIIDPKGNSTAVTLDVLGRLFSHQNALGELTRYTHS
FT                   DAHASPAGSVTKMVMPDGVEQAIAYDSEKRIAALTDGAGKTTRYEYGGFDLLTGLIRPD
FT                   GQRLTFGYDTLTRLNQVTNASGDTYRYTRDRAGQVISETDFTGRTVHYQYDAVGRRIGA
FT                   RYPDQRLVRWHYSMQDQVLAQQTWHCDALSSTLVGTVSYGYDGAGRLLSATNADAVVEF
FT                   DYDEAGQLVAERLNGREVRHQWDALNGTPVARQVGELGLTFVYGAQGELTRLQLAGHQP
FT                   LQLQHDRLGRETVRESAAGFIQACNYTPSGLLAHQAAGRNSALFQQQLIAPESPALHGS
FT                   AVNRSWQYDRAYNVVGMDDGRWGKTQYQYDRNDQVVRADFGGFLPLQEQFSYDVNQNLR
FT                   EHRCLPRGAQAVLAQASQQQQAGRVVKRGDSQYRYDAAGRLVEKRSQKDGYRPQLWRYR
FT                   WNEQDQLSELITPTGARWRYGYDAFGRRIRKLRVVDTPPLNEMDAPSTGPATASLAGYA
FT                   YLWSGDQLIEEVPVYADGTVAYEQGIHWLYAPGGLTPMARYAQGKLHYVVADHLGTPRE
FT                   LLNEQGKVVWASRLSTWGQAELWRQAANEEDRVSCNLRFAGQYADAESGLHYNRFRYYD
FT                   GETGQYLCPDPIGLEGGLNPYGYVHNPVSWVDPLGLATCPMREVNGTKIFGKGQKDGTP
FT                   GHDQFSEVIANKLAMSGKFKEVYLNRSYNFANGKGISGRRPDIMAVDMNGKVHAIELAS
FT                   KTDMGRKFPSLRTRNQDAMKNLPSIDRGSVIVLEHQYNSSKIKNALDNLISGI"
FT   gene            complement(274302..274724)
FT                   /locus_tag="y0256"
FT   CDS_pept        complement(274302..274724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0256"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 137 of 140 are 36.49 pct identical to
FT                   residues 4 to 140 of 143 from GenPept : >emb|CAD18289.1|
FT                   (AL646083) conserved hypothetical protein [Ralstonia
FT                   solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83850"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW97"
FT                   /protein_id="AAM83850.1"
FT                   /translation="MYYFNEGSLELPEAWRDMTVNVLTSSLDETVGLSFTVSRDTPPWG
FT                   MGFHEFFDREIGSLSRQLNHYQLLHQDTGEVNNHPSVTAEFCWSSEQGRIHQLMTLVDI
FT                   APRVLILTATMVGELTPQQKEHITAIVQTLQINARS"
FT   gene            complement(274727..276829)
FT                   /locus_tag="y0257"
FT   CDS_pept        complement(274727..276829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0257"
FT                   /product="VgrG-like protein"
FT                   /note="Rhs element associated; residues 77 to 696 of 700
FT                   are 46.91 pct identical to residues 3 to 633 of 633 from
FT                   GenPept : >gb|AAG54902.1|AE005236_3 (AE005236) Z0707 gene
FT                   product [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83851"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M8"
FT                   /protein_id="AAM83851.1"
FT                   /translation="MSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDAKAKVLDG
FT                   GVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEML
FT                   SSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTR
FT                   YSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQY
FT                   QESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLPYNPNVAAQAQELS
FT                   ITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEHFDFPGRFKDAQH
FT                   GQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGVQHSGKQ
FT                   MQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
FT                   GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPI
FT                   VTGRTYHANNIPPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFMHAQKDMST
FT                   TVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQV
FT                   KAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDAIAPLIN
FT                   LNKDKG"
FT   gene            complement(276826..276924)
FT                   /locus_tag="y0258"
FT   CDS_pept        complement(276826..276924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0258"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT8"
FT                   /protein_id="AAM83852.1"
FT                   /translation="MFAHDKANNNKTADKTGTVTPTHIVSPEAAQP"
FT   gene            complement(276946..277122)
FT                   /locus_tag="y0259"
FT   CDS_pept        complement(276946..277122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0259"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83853"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT7"
FT                   /protein_id="AAM83853.1"
FT                   /translation="MQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNALLS
FT                   RYHHLTQQTNSAR"
FT   gene            277204..277692
FT                   /locus_tag="y0260"
FT   CDS_pept        277204..277692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0260"
FT                   /product="transcriptional repressor"
FT                   /function="regulator"
FT                   /note="residues 48 to 154 of 162 are 33.64 pct identical to
FT                   residues 6 to 108 of 112 from GenPept : >gb|AAF94621.1|
FT                   (AE004224) transcriptional repressor RstR [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83854"
FT                   /db_xref="GOA:Q8D1M7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M7"
FT                   /protein_id="AAM83854.1"
FT                   /translation="MHRITISNSIAIRCVFVFKSGLILEHLMTDVIDEIMQTEEQRRAF
FT                   GLRLKELRKQQHKTQKEVATRIGLQLSQYNKYESGMHIPPADKLITLAELLVTSIDYLL
FT                   LGSSNETSSIRNTRLLERFKALSQCQPEEQETVIKLIDAVIVKHRVESALQPVDPEKK"
FT   gene            277774..277998
FT                   /locus_tag="y0261"
FT   CDS_pept        277774..277998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0261"
FT                   /product="hypothetical"
FT                   /note="residues 15 to 68 of 74 are 42.59 pct identical to
FT                   residues 35 to 88 of 132 from GenPept : >gb|AAA97244.1|
FT                   (U14003) ORF_f132 [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83855"
FT                   /db_xref="GOA:A0A2S9PAU5"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PAU5"
FT                   /protein_id="AAM83855.1"
FT                   /translation="MAKAHSTSGTGINKTPKTERYYTVGYVPQRGKRNPPPAINLKGRW
FT                   LEALGFFSGQPVLITVEHGRLVIQPEIKI"
FT   gene            complement(277977..278174)
FT                   /locus_tag="y0262"
FT   CDS_pept        complement(277977..278174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0262"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83856"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT5"
FT                   /protein_id="AAM83856.1"
FT                   /translation="MSHSPDRDSSPLSCIQAITILLYFKYCAGRKSCINNIGFVDNEFR
FT                   DIIVHNTVENNIPIHIFISG"
FT   gene            278074..278265
FT                   /locus_tag="y0263"
FT   CDS_pept        278074..278265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0263"
FT                   /product="hypothetical"
FT                   /note="residues 15 to 63 of 63 are 34.69 pct identical to
FT                   residues 177 to 224 of 243 from GenPept :
FT                   >gb|AAG55242.1|AE005267_7 (AE005267) arginine 3rd transport
FT                   system periplasmic binding protein [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83857"
FT                   /db_xref="GOA:A0A3N4AW81"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW81"
FT                   /protein_id="AAM83857.1"
FT                   /translation="MQDLRPAQYLKYNNIVMAWIQDNGELSLSGEWLTQTGLTGQPLAI
FT                   SVMAGKVIIQFQKMNMLL"
FT   gene            complement(278315..278800)
FT                   /locus_tag="y0264"
FT   CDS_pept        complement(278315..278800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0264"
FT                   /product="hypothetical"
FT                   /note="residues 17 to 157 of 161 are 25.97 pct identical to
FT                   residues 29 to 169 of 192 from GenPept : >gb|AAC12984.1|
FT                   (AF020713) unknown [Bacteriophage SPBc2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83858"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZM3"
FT                   /protein_id="AAM83858.1"
FT                   /translation="MKNPCQNCEKNIDLSDIKSVEKTLGYSFPEAFVSHYLSFNGGVPL
FT                   RAWWACDDGCEPLEIAAFKPFKYHKMTNDNPNSLIDGCYNEMIRKNVIPSNIIPFGNDW
FT                   GGNFFCLNKDDDSVVFYATDSFDPEVSMSKNHDVLQKKLTSSFEEFINGLVEEDDLE"
FT   gene            complement(278802..280172)
FT                   /locus_tag="y0265"
FT   CDS_pept        complement(278802..280172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0265"
FT                   /product="rhsD protein"
FT                   /note="Rhs element associated; residues 8 to 326 of 456 are
FT                   44.23 pct identical to residues 957 to 1250 of 1354 from
FT                   GenPept : >emb|CAD08751.1| (AL627266) Rhs-family protein
FT                   [Salmonella enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83859"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA71"
FT                   /protein_id="AAM83859.1"
FT                   /translation="MAADLLPRQGDIWRKFSFDTAGELSMATDFIRGEQQYRYDAEGRL
FT                   TDSRERHQLSVAEDFAYDNADNLLNLRKLPFDTVDPLYDTPVANNRLTQWQHYRFEYDA
FT                   WGNMTTRHAGGRMQHFAYDDDNRLLRAWGTGPLGEHDSHYRYDALGRRIHKSVTIKRGA
FT                   EKTTRQTDFIWQGLRLLQEQHTDGNATYIYDPNESYTPLARVDQRHGETESQVYYFHTD
FT                   INGTPLDVTDGEGKHRWSGKYHAWGKVTRQNVSDPRQSTVSRFAQPLRYPGQYSDDETG
FT                   LHYNTFRYYDPEIGRFSTQDPIGLAGGINLYQYGPNPLTWIDPWGWAFGGVDFTGSPDL
FT                   FPVKGSQLNIVEITMQGARGRDFTEAFKLAGISKADATGYTWHHLNDFDPVSGKTTMQL
FT                   VTTSAHEATFPHAGSVSQFEKHFNLPSQSYGSADAVAISHSKGWLKGRIPKALRSGC"
FT   gene            complement(280200..283091)
FT                   /locus_tag="y0266"
FT   CDS_pept        complement(280200..283091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0266"
FT                   /product="Rhs-like protein"
FT                   /note="Rhs element associated; residues 10 to 960 of 963
FT                   are 37.73 pct identical to residues 1 to 934 of 1364 from
FT                   GenPept : >gb|AAL19248.1| (AE008708) putative RHS-family
FT                   protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83860"
FT                   /db_xref="GOA:Q8D1M6"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M6"
FT                   /protein_id="AAM83860.1"
FT                   /translation="MRRGPGRPAMFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAA
FT                   YAASIVLTGGATLVATGFIVGMGVTTLGVVAGGLIRSVGEKIGSMCHHDVGQITTGSKN
FT                   VKVNSKRAAHVELSTVACKDDSAIQRMAEGSSNIFINSKAAVRLEDKTTCDAVVDSASS
FT                   NVTFGGGRVQYLDIKREISDEMRDLSEKLFIVAGLAGGIFGAAKQAGCFGLKCLSKIAL
FT                   GEMAGAAAGYGLEKGVGAIAGYFGYPVDVISGQKLLTGEGDDTDFILPGIFPLHWSRIY
FT                   RSENHHVGALGQGWSLVWERSLRKEDDSIVYQNDEGREIVFPLIKRGERYFSPTEHIWL
FT                   ARTERDTYAISSPFETCFIFEAFSEAGVAKLASLEDLNGHALYFSYDDIGQLKKISTTS
FT                   GYGVYCQYEKGRLVSVACVKGGTPGTLVRYQYNEQHQLVSVTNREGQITRQFGYHGHLI
FT                   NKLADVRGLECRYTWADIGGTPRITHSATNLGEQWQFDYDIDNQQTTLTDLNTGQTACW
FT                   GYNAQHLITDYRDFDGGKYAFDYNDLNMPVRVVLAGERTLVLVYDALARPIQITDPLKR
FT                   ETHIDYHRNSLRVVRRQYPDGQVWKGEYDRTGRLLKENAPDGGVTLYHYPGASSLPERI
FT                   TNAVGAQTHLGWERHGQLTEHTDCSGKLTRYEYDIDGHLLTVIDAENHSTHYSYNRLGQ
FT                   PTGIRYADGRKEQLRYNAQGLVEQFTDPVGRQLHWRYNLRGQPVSFTDRLQREYRYRYD
FT                   CHGQMIELDNANGGQYHFRWSSGGQLVEEQYPDNLVRRYRYGESGMLMALETTAPTVDD
FT                   LTVSRQVSFDYDAGGRMTQRLTGMSATRYDWDIMDRLLLAERVPTAVGEQAGIVGHGVR
FT                   LAYDKAGHLLTESGDLGAVTYQWDPLHHLAALTLPDGQTLSWLRYGAGHVSAIRHGDTL
FT                   ISEFSRDNLHREVSRTQGILTQYRDYDAMGRRL"
FT   gene            complement(283057..283515)
FT                   /locus_tag="y0267"
FT   CDS_pept        complement(283057..283515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0267"
FT                   /product="hypothetical"
FT                   /note="residues 9 to 144 of 152 are 35.71 pct identical to
FT                   residues 5 to 144 of 148 from GenPept : >gb|AAL19247.1|
FT                   (AE008708) putative cytoplasmic protein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83861"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXK5"
FT                   /protein_id="AAM83861.1"
FT                   /translation="MPENNINTYCIQEGTLECPEGFTDRTVNLFMKGKPGAAFALNIAR
FT                   DVPEAHEVLSDYVQRQIGILKDNLKKYEVKKHQQIDVGAQHIPGEYVEATYMAETRRVW
FT                   QRQVAIQVGDHMMIFTATNASPFNPQQQATWEQWIHSFAPWAREAGHV"
FT   gene            complement(283521..285923)
FT                   /locus_tag="y0268"
FT   CDS_pept        complement(283521..285923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0268"
FT                   /product="VgrG-like protein"
FT                   /note="VgrG-like protein (Rhs element associated); residues
FT                   169 to 792 of 800 are 44.06 pct identical to residues 3 to
FT                   674 of 713 from GenPept : >gb|AAC62387.1| (AF044506) VgrG
FT                   protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83862"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFB9"
FT                   /protein_id="AAM83862.1"
FT                   /translation="MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGI
FT                   GDAVGGTAGKRINQAAEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGG
FT                   IGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAISR
FT                   LVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDED
FT                   ATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASV
FT                   EEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
FT                   KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPN
FT                   WAAAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDF
FT                   TLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQ
FT                   TWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVT
FT                   QPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFR
FT                   SKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTV
FT                   VRNQSNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKS
FT                   IKIHAKQGDISISTPNAGITITHDGAIVLQGKYIRLAADMIDLNPEE"
FT   gene            complement(285945..287257)
FT                   /pseudo
FT                   /locus_tag="y0269"
FT                   /note="disrupted by frameshift"
FT   gene            287229..287591
FT                   /locus_tag="y0270"
FT   CDS_pept        287229..287591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0270"
FT                   /product="hypothetical"
FT                   /note="residues 19 to 79 of 120 are 34.84 pct identical to
FT                   residues 53 to 114 of 311 from GenPept : >gb|AAC17095.1|
FT                   (AC004482) hypothetical protein [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83863"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT4"
FT                   /protein_id="AAM83863.1"
FT                   /translation="MMICCGVSLMQTHPLIVFLPPKQQEDVMTTINTICLNASVSMRSV
FT                   SIQSCVSIQSVWQTEFTEQTAREWVVGFINKDAVRHLAAINLEADIEGVGAHIGQFTGV
FT                   DQPQLRPRTAEAEGAR"
FT   gene            complement(287382..290842)
FT                   /pseudo
FT                   /locus_tag="y0271"
FT                   /note="disrupted by frameshift"
FT   gene            complement(290946..292352)
FT                   /locus_tag="y0272"
FT   CDS_pept        complement(290946..292352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0272"
FT                   /product="hypothetical"
FT                   /note="residues 213 to 462 of 468 are 53.33 pct identical
FT                   to residues 8 to 259 of 264 from GenPept :
FT                   >gb|AAG54520.1|AE005198_1 (AE005198) Z0251 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83864"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT3"
FT                   /protein_id="AAM83864.1"
FT                   /translation="MSLVRHMDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQ
FT                   MVKLGSLAHATLNIDDIQQQAMALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLT
FT                   EYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVW
FT                   HSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTS
FT                   DRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRT
FT                   ADYLARLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFL
FT                   ARIPALKTLFFTDMTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQM
FT                   INRQPQQSEPRDRFYHQLLSAQLFEKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIAL
FT                   LTEKQRQLKP"
FT   gene            complement(292340..293035)
FT                   /locus_tag="y0273"
FT   CDS_pept        complement(292340..293035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0273"
FT                   /product="hypothetical"
FT                   /note="residues 36 to 231 of 231 are 50.00 pct identical to
FT                   residues 47 to 244 of 247 from GenPept :
FT                   >gb|AAG54522.1|AE005198_3 (AE005198) Z0253 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83865"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT2"
FT                   /protein_id="AAM83865.1"
FT                   /translation="MPAMNTWLLISSLLFSGGHTDAFWTMGLPPPVAEKEEAGTLALVM
FT                   RCRSENSALVRLDCYDKALSPVNAVDEKRVNAGPAWQRAMNQEKGRTDHSTAFLVTEGE
FT                   GSNPMVLITTPAIGMPPPRPVLMLSCIDNITRLQIALVGPQKESSVTLIIDKAGIIDKT
FT                   RLDAQWFLRENGYLLESSRGLAGIDEIKRLMSAETLTIEGANGAFPRLTFTLSQLTPAL
FT                   KPLRNACHW"
FT   gene            complement(293023..293820)
FT                   /locus_tag="y0274"
FT   CDS_pept        complement(293023..293820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0274"
FT                   /product="hypothetical"
FT                   /note="residues 194 to 260 of 265 are 29.57 pct identical
FT                   to residues 454 to 524 of 530 from GenPept :
FT                   >gb|AAF96031.1| (AE004353) sigma-54 dependent
FT                   transcriptional regulator [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83866"
FT                   /db_xref="GOA:A0A3N4AW71"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW71"
FT                   /protein_id="AAM83866.1"
FT                   /translation="MRQRLKSVLALLDNDSTEQLIHRFLTINHHRQRFSALMVSMFNAS
FT                   EGRLDCYHQPDGGMNVALKLDANIEDVNHPLVRVLRNGFPEVWGSLYQGVRIEDDDFRS
FT                   FIQALPTRCGLYALPLFDVHGHACGVIAVFSENIERFADTRGIFSIYCHIFQHRLNKLQ
FT                   EMDQLRSQFNQIRTVFKEQRQREKQLDELLVSLSTSDTHALPGISQDYSKIDSLTTAVE
FT                   TFECAVLTQRQRLYGNDKSRIAASLGLSLRALTYKLAKYRCQL"
FT   gene            complement(293817..296420)
FT                   /gene="clpB"
FT                   /locus_tag="y0275"
FT   CDS_pept        complement(293817..296420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="y0275"
FT                   /product="heat shock protein"
FT                   /function="putative enzyme; degradation of proteins,
FT                   peptides, glyco"
FT                   /note="residues 153 to 857 of 867 are 40.22 pct identical
FT                   to residues 133 to 849 of 857 from E. coli K12 : B2592;
FT                   residues 1 to 866 of 867 are 67.25 pct identical to
FT                   residues 1 to 910 of 923 from GenPept :
FT                   >gb|AAG54523.1|AE005198_4 (AE005198) putative protease
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83867"
FT                   /db_xref="GOA:A0A3N4AZL8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZL8"
FT                   /protein_id="AAM83867.1"
FT                   /translation="MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQM
FT                   ISTPLCDVRLILSHAGVEEDELRESLDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLAS
FT                   TEMEHSQLRSGVMLLTLLLSPSRYLVPTANRLLSPINRELLRQNFANWTADSAETPRAE
FT                   KGAEAGNGAEINGDSLLARYASNMTEQARNGELDPVLCRDTEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEIAQSTTPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRY
FT                   ISGRQLPDKAIDVLDTAAARVAINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSR
FT                   PDERLSVLQQQRIEIEQQLIALNTGWEKQQHLVQQIIALRAVLLAQEESATDEQVVNLT
FT                   ALSDELERLQQHQTLVSPHVDKSQIAAVIAEWTGVPLNRLSQSELAVVTELPSYLGQQI
FT                   KGQETAIHCLHQHLLTARADLRRPGRPMGAFLLVGPSGVGKTETVLQIADLLYGGRQYL
FT                   TTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLN
FT                   LFYQAFDKGELADGEGRIIDCKNIVFFLTSNLGYQTIVDHADEPALLNERLYPELSAFF
FT                   KPALLARMEVVPYLPLGMETLQIIIHGKLNRLDTLLRQRFSADVVIEPEVIDEILLRAT
FT                   RAENGARMLESIIDGALLPPVSLLLLQKVAAGTAISHIRIAVEGNVFTAQVEGAI"
FT   gene            complement(296431..297198)
FT                   /locus_tag="y0276"
FT   CDS_pept        complement(296431..297198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0276"
FT                   /product="putative membrane protein"
FT                   /function="putative membrane"
FT                   /note="residues 20 to 254 of 255 are 62.55 pct identical to
FT                   residues 18 to 252 of 253 from GenPept :
FT                   >gb|AAG54524.1|AE005198_5 (AE005198) Z0255 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83868"
FT                   /db_xref="GOA:A0A384KRV9"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRV9"
FT                   /protein_id="AAM83868.1"
FT                   /translation="MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLG
FT                   MVLRLKDMENQALPDQLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALG
FT                   HGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRG
FT                   RYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLW
FT                   GGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS"
FT   gene            complement(297198..298544)
FT                   /locus_tag="y0277"
FT   CDS_pept        complement(297198..298544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0277"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 446 of 448 are 53.60 pct identical to
FT                   residues 4 to 442 of 443 from GenPept :
FT                   >gb|AAG54525.1|AE005198_6 (AE005198) Z0256 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83869"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT1"
FT                   /protein_id="AAM83869.1"
FT                   /translation="MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYRYGF
FT                   SSLILNQELLKLGRIGLTVASGNMADGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLAL
FT                   PMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTEGGDVSQLVLAQLAPRLMQGSEDL
FT                   SAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVEGTLVERAQLLAK
FT                   RIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFTD
FT                   ESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDS
FT                   DLLRSADFVLAVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQ
FT                   LPYHSGYTYFMLDLQSPVWKEIQQSNAIAFHVSGDFPDLDMQFWAIRSS"
FT   gene            complement(298547..299092)
FT                   /locus_tag="y0278"
FT   CDS_pept        complement(298547..299092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0278"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 181 of 181 are 46.92 pct identical to
FT                   residues 2 to 174 of 174 from GenPept :
FT                   >gb|AAG54526.1|AE005198_7 (AE005198) Z0257 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83870"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXJ6"
FT                   /protein_id="AAM83870.1"
FT                   /translation="MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQ
FT                   ATDQPSTVRLTLLSDPDTNPNEKGEAVPTEIVVVYLSENSKLLAADYDQLSSDALEKTL
FT                   GKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNY
FT                   QVLVHVRSNDVDLRKEEE"
FT   gene            complement(299092..300408)
FT                   /locus_tag="y0279"
FT   CDS_pept        complement(299092..300408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0279"
FT                   /product="hypothetical"
FT                   /note="residues 2 to 438 of 438 are 45.47 pct identical to
FT                   residues 10 to 432 of 433 from GenPept :
FT                   >gb|AAG54527.1|AE005198_8 (AE005198) Z0258 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83871"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYY8"
FT                   /protein_id="AAM83871.1"
FT                   /translation="MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSI
FT                   QDQGGNISPSQFAIEWRDGSFCLRMLNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVI
FT                   KSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEGEPLASPHHQQDSRLAATVSHNFS
FT                   HDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPKDSAMDQAFIDLP
FT                   QISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKTL
FT                   KATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAV
FT                   AESLDNLRLHHQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMY
FT                   KNYYNELASSRQQGFEKLFGEVYEQAYDRALRQGMKDSE"
FT   gene            complement(300534..301631)
FT                   /locus_tag="y0280"
FT   CDS_pept        complement(300534..301631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0280"
FT                   /product="hypothetical"
FT                   /note="residues 44 to 363 of 365 are 57.89 pct identical to
FT                   residues 37 to 358 of 360 from GenPept :
FT                   >gb|AAG54528.1|AE005198_9 (AE005198) Z0259 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83872"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLT0"
FT                   /protein_id="AAM83872.1"
FT                   /translation="MLRMAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYN
FT                   FFQLVELLNQLAVAWQGAAPVATPANEAIRFKSTASLAFPTRDVIALDTSARGQFELEV
FT                   SFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICF
FT                   DNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCF
FT                   NLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKF
FT                   LLCINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQ
FT                   NSLLGWTSILGDPEQKPSVTIGVME"
FT   gene            complement(301586..302458)
FT                   /locus_tag="y0281"
FT   CDS_pept        complement(301586..302458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0281"
FT                   /product="hypothetical"
FT                   /note="residues 46 to 290 of 290 are 55.51 pct identical to
FT                   residues 345 to 589 of 589 from GenPept : >gb|AAF96024.1|
FT                   (AE004353) hypothetical protein [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83873"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS9"
FT                   /protein_id="AAM83873.1"
FT                   /translation="MRFPAEWPFLKGNVEPPLGGLKKGVSLNRTSRSWIKRSKIWGSVH
FT                   RGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
FT                   ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLL
FT                   SNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGL
FT                   PVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWP
FT                   VQTGQHALM"
FT   gene            302218..302895
FT                   /locus_tag="y0282"
FT   CDS_pept        302218..302895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0282"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1661 transposase; residues 56 to 224 of 226 are
FT                   39.64 pct identical to residues 1 to 167 of 173 from
FT                   GenPept : >emb|CAA63546.1| (X92970) orfA [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83874"
FT                   /db_xref="GOA:Q8D1M5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M5"
FT                   /protein_id="AAM83874.1"
FT                   /translation="MNFSHVGGNKVRSFLASVRSDGGSSQTRCTPGHDPGALNPRSWIF
FT                   LSMIWRFGSMKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRRQGEAG
FT                   LEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEALN
FT                   PSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKALREQQK
FT                   KPE"
FT   mobile_element  302324..303509
FT                   /mobile_element_type="insertion sequence:IS1661"
FT                   /note="insertion element; partial"
FT   gene            302949..303569
FT                   /locus_tag="y0283"
FT   CDS_pept        302949..303569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0283"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1661 transposase; residues 3 to 187 of 206 are
FT                   45.74 pct identical to residues 24 to 207 of 283 from
FT                   GenPept : >gb|AAB18535.2| (U00039) orfB in IS150
FT                   [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83875"
FT                   /db_xref="GOA:Q8D1M4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M4"
FT                   /protein_id="AAM83875.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGICNERCNSDPHPTPEIRSRG"
FT   mobile_element  303510..305463
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            303596..304618
FT                   /locus_tag="y0284"
FT   CDS_pept        303596..304618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0284"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 340 of 340 are 100.00 pct
FT                   identical to residues 1 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83876"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAM83876.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            304615..305397
FT                   /locus_tag="y0285"
FT   CDS_pept        304615..305397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0285"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfB; residues 1 to 260 of 260 are 100.00 pct
FT                   identical to residues 1 to 260 of 260 from GenPept :
FT                   >gb|AAC69770.1| (AF074612) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83877"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM83877.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   mobile_element  complement(305463..305663)
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element; partial"
FT   gene            complement(305910..308024)
FT                   /locus_tag="y0286"
FT   CDS_pept        complement(305910..308024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0286"
FT                   /product="putative secretion ATPase"
FT                   /function="putative membrane; transport of small molecules;
FT                   cations"
FT                   /note="similar to colicin V secretion ATP-binding protein
FT                   CvaB; residues 1 to 698 of 704 are 57.16 pct identical to
FT                   residues 1 to 698 of 698 from GenPept : >gb|AAL08400.1|
FT                   (AF063590) MceG [Klebsiella pneumoniae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83878"
FT                   /db_xref="GOA:Q8D1M3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M3"
FT                   /protein_id="AAM83878.1"
FT                   /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMTCRYHG
FT                   MDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWDMS
FT                   HFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPNSEFTRQKSRTRLSLL
FT                   SLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDYDLLALICIGLLF
FT                   FILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSRFGSLD
FT                   IIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATYNQYRQA
FT                   SEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRLTKLDMFF
FT                   GGVNTLIGTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLINMVLQLRM
FT                   LALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPIFSDLNIHVE
FT                   AGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYRDCIACVLQDD
FT                   KLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLISELGGSLSGGQK
FT                   QRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFIAHRPSTIASAQR
FT                   IINLEKQNVS"
FT   gene            complement(308017..309333)
FT                   /locus_tag="y0287"
FT   CDS_pept        complement(308017..309333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0287"
FT                   /product="putative secretion permease"
FT                   /function="putative membrane; transport of small molecules;
FT                   cations"
FT                   /note="similar to colicin V secretion protein CvaA;
FT                   residues 14 to 438 of 438 are 47.05 pct identical to
FT                   residues 1 to 424 of 424 from GenPept : >emb|CAC21493.1|
FT                   (AJ278866) MchE protein [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83879"
FT                   /db_xref="GOA:Q8D1M2"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M2"
FT                   /protein_id="AAM83879.1"
FT                   /translation="MMGITERGMSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAAL
FT                   CAIFLVLLITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQ
FT                   HLYQIDVSRTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKA
FT                   HKKSQELVDNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQ
FT                   LIQESLQIAKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKI
FT                   ENMSVTQGQMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEK
FT                   FGQFPGRIISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLM
FT                   LSNGLKANVTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
FT   gene            309522..309761
FT                   /locus_tag="y0288"
FT   CDS_pept        309522..309761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0288"
FT                   /product="hypothetical"
FT                   /note="residues 12 to 72 of 79 are 31.14 pct identical to
FT                   residues 383 to 440 of 657 from GenPept : >gb|AAB18717.1|
FT                   (U38906) ORF42 [Bacteriophage r1t]"
FT                   /db_xref="EnsemblGenomes-Gn:y0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAS4"
FT                   /protein_id="AAM83880.1"
FT                   /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKPN
FT                   ASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
FT   gene            309936..310085
FT                   /locus_tag="y0289"
FT   CDS_pept        309936..310085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0289"
FT                   /product="hypothetical"
FT                   /note="residues 7 to 48 of 49 are 26.19 pct identical to
FT                   residues 262 to 303 of 355 from GenPept : >gb|AAF98228.1|
FT                   (U64843) hypothetical protein K06C4.8 [Caenorhabditis
FT                   elegans]"
FT                   /db_xref="EnsemblGenomes-Gn:y0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0A0"
FT                   /protein_id="AAM83881.1"
FT                   /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYEF
FT                   ILYH"
FT   gene            complement(310351..310512)
FT                   /locus_tag="y0290"
FT   CDS_pept        complement(310351..310512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0290"
FT                   /product="hypothetical"
FT                   /note="residues 4 to 40 of 53 are 37.83 pct identical to
FT                   residues 159 to 195 of 195 from GenPept : >emb|CAC09571.1|
FT                   (AJ298983) S-receptor kinase (SRK) [Fagus sylvatica]"
FT                   /db_xref="EnsemblGenomes-Gn:y0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83882"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS8"
FT                   /protein_id="AAM83882.1"
FT                   /translation="MACSDFACSEIAHADTDSVMATIKATPAVVVLRRKQQPLCIKKPH
FT                   QDVNELSQ"
FT   gene            310544..310975
FT                   /locus_tag="y0291"
FT   CDS_pept        310544..310975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0291"
FT                   /product="hypothetical"
FT                   /note="residues 10 to 30 of 143 are 66.66 pct identical to
FT                   residues 1017 to 1037 of 1263 from GenPept :
FT                   >gb|AAG31016.1| (AY007367) tospovirus resistance protein D
FT                   [Lycopersicon esculentum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83883"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS7"
FT                   /protein_id="AAM83883.1"
FT                   /translation="MAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISF
FT                   EGAVGQQLAVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVV
FT                   VTLLGGTLRLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
FT   gene            complement(311092..311577)
FT                   /gene="menG"
FT                   /locus_tag="y0292"
FT   CDS_pept        complement(311092..311577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="y0292"
FT                   /product="2-heptaprenyl-1,4-naphthoquinone
FT                   methyltransferase"
FT                   /function="putative enzyme; biosynthesis of cofactors,
FT                   carriers: Menaquinone, ubiquinone"
FT                   /note="menaquinone biosynthesis; residues 1 to 161 of 161
FT                   are 87.57 pct identical to residues 1 to 161 of 161 from E.
FT                   coli K12 : B3929"
FT                   /db_xref="EnsemblGenomes-Gn:y0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83884"
FT                   /db_xref="GOA:Q8ZJJ7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ7"
FT                   /protein_id="AAM83884.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(311719..312648)
FT                   /gene="menA"
FT                   /locus_tag="y0293"
FT   CDS_pept        complement(311719..312648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="y0293"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Menaquinone, ubiquinone"
FT                   /note="1,4-dihydroxy-2-naphthoate --> dimethylmenaquinone;
FT                   residues 12 to 309 of 309 are 68.12 pct identical to
FT                   residues 7 to 304 of 308 from E. coli K12 : B3930; residues
FT                   12 to 309 of 309 are 69.12 pct identical to residues 8 to
FT                   305 of 309 from GenPept : >gb|AAL22930.1| (AE008891)
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83885"
FT                   /db_xref="GOA:Q8D1M1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M1"
FT                   /protein_id="AAM83885.1"
FT                   /translation="MKRKMSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDS
FT                   FKPAVALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVAL
FT                   IITVILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISV
FT                   LVFFGWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLA
FT                   VRLGPVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTA
FT                   AGMRPMLEQMVKAALLTNILFAVGLVFS"
FT   gene            complement(312872..314203)
FT                   /gene="hslU"
FT                   /locus_tag="y0294"
FT   CDS_pept        complement(312872..314203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="y0294"
FT                   /product="heat shock protein, ATPase subunit"
FT                   /function="factor; adaptations, atypical conditions"
FT                   /note="homologous to chaperones; residues 1 to 443 of 443
FT                   are 90.29 pct identical to residues 1 to 443 of 443 from E.
FT                   coli K12 : B3931"
FT                   /db_xref="EnsemblGenomes-Gn:y0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83886"
FT                   /db_xref="GOA:Q8ZJJ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ5"
FT                   /protein_id="AAM83886.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   gene            complement(314274..314798)
FT                   /gene="hslV"
FT                   /locus_tag="y0295"
FT   CDS_pept        complement(314274..314798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="y0295"
FT                   /product="heat shock protein, proteasome-related peptidase
FT                   subunit"
FT                   /function="enzyme; degradation of proteins, peptides,
FT                   glyco"
FT                   /note="residues 1 to 174 of 174 are 90.80 pct identical to
FT                   residues 1 to 174 of 176 from E. coli K12 : B3932; residues
FT                   1 to 174 of 174 are 100.00 pct identical to residues 1 to
FT                   174 of 174 from GenPept : >emb|CAC88971.1| (AJ414141) heat
FT                   shock protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83887"
FT                   /db_xref="GOA:Q8ZJJ4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ4"
FT                   /protein_id="AAM83887.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   gene            complement(314898..315743)
FT                   /gene="ftsN"
FT                   /locus_tag="y0296"
FT   CDS_pept        complement(314898..315743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="y0296"
FT                   /product="essential cell division protein"
FT                   /function="phenotype; cell division"
FT                   /note="residues 1 to 281 of 281 are 49.68 pct identical to
FT                   residues 1 to 319 of 319 from E. coli K12 : B3933; residues
FT                   1 to 281 of 281 are 51.38 pct identical to residues 1 to
FT                   324 of 324 from GenPept : >gb|AAL22933.1| (AE008891)
FT                   essential cell division protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83888"
FT                   /db_xref="GOA:A0A3N4AZJ2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZJ2"
FT                   /protein_id="AAM83888.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGG
FT                   EVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQ
FT                   PVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQ
FT                   AESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
FT                   "
FT   gene            complement(315809..316837)
FT                   /gene="cytR"
FT                   /locus_tag="y0297"
FT   CDS_pept        complement(315809..316837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytR"
FT                   /locus_tag="y0297"
FT                   /product="regulator for deo operon, udp, cdd, tsx, nupC,
FT                   and nupG"
FT                   /function="regulator; global regulatory functions"
FT                   /note="residues 1 to 339 of 342 are 71.38 pct identical to
FT                   residues 1 to 339 of 341 from E. coli K12 : B3934"
FT                   /db_xref="EnsemblGenomes-Gn:y0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83889"
FT                   /db_xref="GOA:A0A3N4AY76"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY76"
FT                   /protein_id="AAM83889.1"
FT                   /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVE
FT                   QAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGD
FT                   CAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYI
FT                   IRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFD
FT                   DLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAP
FT                   KH"
FT   gene            complement(317190..319388)
FT                   /gene="priA"
FT                   /locus_tag="y0298"
FT   CDS_pept        complement(317190..319388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="y0298"
FT                   /product="primosomal protein N'"
FT                   /function="factor; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="factor Y; putative helicase; residues 1 to 731 of
FT                   732 are 73.08 pct identical to residues 1 to 731 of 732
FT                   from E. coli K12 : B3935; residues 1 to 731 of 732 are
FT                   72.67 pct identical to residues 1 to 731 of 732 from
FT                   GenPept : >gb|AAL22935.1| (AE008891) primosomal protein N'
FT                   (= factor Y) directs replication fork assembly at D-loops
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83890"
FT                   /db_xref="GOA:A0A380PK94"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PK94"
FT                   /protein_id="AAM83890.1"
FT                   /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIGI
FT                   VVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLLDLKGLPL
FT                   KVGLSQPLLKQMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPITRIDRDTTSR
FT                   KGSLEQYLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
FT   gene            319574..319846
FT                   /gene="rpmE"
FT                   /locus_tag="y0299"
FT   CDS_pept        319574..319846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="y0299"
FT                   /product="50S ribosomal subunit protein L31"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 20 to 89 of 90 are 81.42 pct identical to
FT                   residues 1 to 70 of 70 from E. coli K12 : B3936"
FT                   /db_xref="EnsemblGenomes-Gn:y0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83891"
FT                   /db_xref="GOA:P58471"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58471"
FT                   /protein_id="AAM83891.1"
FT                   /translation="MWCLAEQGWIATRPNIEVSMKQGIHPKYEQVTASCSCGNVIKINS
FT                   TVGHDLNLDVCGECHPFYTGKQRDVASGGRVDRFNKRFSVPGAKK"
FT   gene            complement(320371..320838)
FT                   /locus_tag="y0300"
FT   CDS_pept        complement(320371..320838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0300"
FT                   /product="hypothetical protein"
FT                   /note="residues 13 to 140 of 155 are 65.62 pct identical to
FT                   residues 10 to 137 of 146 from E. coli K12 : B3562;
FT                   residues 5 to 150 of 155 are 57.53 pct identical to
FT                   residues 1 to 146 of 166 from GenPept : >emb|CAD13669.1|
FT                   (AL646057) hypothetical transmembrane protein [Ralstonia
FT                   solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83892"
FT                   /db_xref="GOA:Q8D1M0"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M0"
FT                   /protein_id="AAM83892.1"
FT                   /translation="MDLNMNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNER
FT                   GYYFAVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLA
FT                   LSEKGFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
FT   gene            complement(321175..321492)
FT                   /gene="metJ"
FT                   /locus_tag="y0301"
FT   CDS_pept        complement(321175..321492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="y0301"
FT                   /product="repressor of all met genes but metF"
FT                   /function="regulator; amino acid biosynthesis: Methionine"
FT                   /note="residues 1 to 105 of 105 are 89.52 pct identical to
FT                   residues 1 to 105 of 105 from E. coli K12 : B3938; residues
FT                   1 to 105 of 105 are 91.42 pct identical to residues 1 to
FT                   105 of 105 from GenPept : >gb|AAL22939.1| (AE008891)
FT                   transcriptional repressor of all met genes but metF (MetJ
FT                   family) [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83893"
FT                   /db_xref="GOA:Q8ZJI8"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI8"
FT                   /protein_id="AAM83893.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   gene            321789..323029
FT                   /pseudo
FT                   /locus_tag="y0302"
FT                   /note="metB; disrupted by frameshift"
FT   gene            323032..325467
FT                   /gene="metL"
FT                   /locus_tag="y0303"
FT   CDS_pept        323032..325467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /locus_tag="y0303"
FT                   /product="aspartokinase II and homoserine dehydrogenase II"
FT                   /function="enzyme; amino acid biosynthesis: Methionine"
FT                   /note="residues 8 to 811 of 811 are 83.95 pct identical to
FT                   residues 7 to 810 of 810 from E. coli K12 : B3940; residues
FT                   8 to 811 of 811 are 83.95 pct identical to residues 7 to
FT                   810 of 810 from GenPept : >gb|AAG59141.1|AE005625_4
FT                   (AE005625) aspartokinase II and homoserine dehydrogenase II
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83894"
FT                   /db_xref="GOA:A0A380PJB4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PJB4"
FT                   /protein_id="AAM83894.1"
FT                   /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFI
FT                   HDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERA
FT                   AQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYVARFDANGKARVGV
FT                   EAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   gene            325700..326584
FT                   /gene="metF"
FT                   /locus_tag="y0304"
FT   CDS_pept        325700..326584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="y0304"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 1 to 294 of 294 are 86.39 pct identical to
FT                   residues 1 to 294 of 296 from E. coli K12 : B3941; residues
FT                   1 to 294 of 294 are 91.83 pct identical to residues 1 to
FT                   294 of 298 from GenPept : >gb|AAC72242.1| (U74302)
FT                   5,10-methylenetetrahydrofolate reductase [Pectobacterium
FT                   carotovorum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83895"
FT                   /db_xref="GOA:A0A3N4AWV2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWV2"
FT                   /protein_id="AAM83895.1"
FT                   /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAI
FT                   DYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRP"
FT   mobile_element  complement(326721..328172)
FT                   /mobile_element_type="insertion sequence:IS1661"
FT                   /note="insertion element"
FT   gene            complement(326762..327361)
FT                   /locus_tag="y0305"
FT   CDS_pept        complement(326762..327361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0305"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1661 OrfB transposase; residues 1 to 198 of 199
FT                   are 54.54 pct identical to residues 41 to 238 of 240 from
FT                   GenPept : >emb|CAA63547.1| (X92970) orfB [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83896"
FT                   /db_xref="GOA:Q8D1L9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L9"
FT                   /protein_id="AAM83896.1"
FT                   /translation="MNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLKWCT
FT                   DVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGLMLH
FT                   SDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDSATV
FT                   LKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(327602..328243)
FT                   /locus_tag="y0306"
FT   CDS_pept        complement(327602..328243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0306"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1661 DNA-binding protein; residues 43 to 211 of
FT                   213 are 39.64 pct identical to residues 1 to 167 of 173
FT                   from GenPept : >emb|CAA63546.1| (X92970) orfA [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83897"
FT                   /db_xref="GOA:Q8D1L8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L8"
FT                   /protein_id="AAM83897.1"
FT                   /translation="MNRGNPRSGQAIVRKRGVPRGPRFALNPRSWIFLSMIWRFGSMKH
FT                   PFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRRQGEAGLEHHLSRTYTPE
FT                   FRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEALNPSKTGPTMPKDK
FT                   YEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKALREQQKKPE"
FT   gene            328492..328707
FT                   /locus_tag="y0307"
FT   CDS_pept        328492..328707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0307"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 66 of 71 are 32.30 pct identical to
FT                   residues 328 to 389 of 550 from GenPept : >gb|AAB88471.1|
FT                   (AF242881) agaG [Agrobacterium tumefaciens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS6"
FT                   /protein_id="AAM83898.1"
FT                   /translation="MTLSAIRNIADKERGASERAWTPAKSALGQGCPSRWLVSPKDAGG
FT                   LPAGQYFAQAAGAGGPASPPARLRRL"
FT   gene            complement(328859..331555)
FT                   /gene="ppc"
FT                   /locus_tag="y0308"
FT   CDS_pept        complement(328859..331555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="y0308"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /function="enzyme; energy metabolism, carbon: Fermentation"
FT                   /note="residues 21 to 898 of 898 are 82.10 pct identical to
FT                   residues 1 to 883 of 883 from E. coli K12 : B3956; residues
FT                   21 to 898 of 898 are 82.10 pct identical to residues 1 to
FT                   883 of 883 from GenPept : >dbj|BAB38308.1| (AP002567)
FT                   phosphoenolpyruvate carboxylase [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83899"
FT                   /db_xref="GOA:Q8ZA84"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA84"
FT                   /protein_id="AAM83899.1"
FT                   /translation="MNIASNPAASNTKDKWVRGHMNEQYSAMRSNVSMLGTLLGDTIKE
FT                   ALGEHILDRVETIRKLSKSSRAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNT
FT                   AEQYHSISPHGEAASNPEALAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITR
FT                   RTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAK
FT                   WGFAVVENSLWEGVPAFLREFNEQLENSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAE
FT                   ITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRELAGGEEVLEPYRQLMKNVRT
FT                   QLTNTQAYLEARLKGERVLPPHDLLVSNDQLWEPLYACYQSLKACGMEIIANGQLLDTL
FT                   RRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESWSESDKQAFLVRELNSKRP
FT                   LVPLKWEPSAETQEVLETCRVIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFT
FT                   LPVAPLFETLDDLNNADDVMTQLLGIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQ
FT                   YRAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEM
FT                   IRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLSDASCDMYRSYVREN
FT                   PEFVRYFRAATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAWTQNRLMLPAWLGA
FT                   GAGLQRAIDAGKQDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWP
FT                   LGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQ
FT                   QEHPDACVEQALMVTIAGVAAGMRNTG"
FT   gene            complement(331869..333038)
FT                   /gene="argE"
FT                   /locus_tag="y0309"
FT   CDS_pept        complement(331869..333038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="y0309"
FT                   /product="acetylornithine deacetylase"
FT                   /function="enzyme; amino acid biosynthesis: Arginine"
FT                   /note="residues 1 to 386 of 389 are 77.72 pct identical to
FT                   residues 1 to 381 of 383 from E. coli K12 : B3957"
FT                   /db_xref="EnsemblGenomes-Gn:y0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83900"
FT                   /db_xref="GOA:Q8ZA85"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA85"
FT                   /protein_id="AAM83900.1"
FT                   /translation="MKMKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFAD
FT                   LGFRVEIQPVPDTRHKFNLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFTLT
FT                   EHDHKLYGLGTADMKGFFAFILDAVRDIDASKLTKPLYILATADEETTMAGARYFAANT
FT                   QLRPDFAIIGEPTSLQPVRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESITQLM
FT                   ALRTTLQERYHNPAFTIPYPTMNFGHINGGDAANRICACCELHMDIRPLPGLTLSDLNE
FT                   LMTEALEPVSQRWPGRLSIDELHPPIPGYECPTDHHMVGVIEKLLGERTAVVNYCTEAP
FT                   FIQQVCPTLVLGPGSINQAHQPDEFIDMAFIEPTRELIGQLVDHFCQQK"
FT   gene            333283..334287
FT                   /gene="argC"
FT                   /locus_tag="y0310"
FT   CDS_pept        333283..334287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="y0310"
FT                   /product="N-acetyl-gamma-glutamylphosphate reductase"
FT                   /function="enzyme; amino acid biosynthesis: Arginine"
FT                   /note="residues 1 to 334 of 334 are 78.14 pct identical to
FT                   residues 1 to 334 of 334 from E. coli K12 : B3958"
FT                   /db_xref="EnsemblGenomes-Gn:y0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83901"
FT                   /db_xref="GOA:Q8ZA86"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA86"
FT                   /protein_id="AAM83901.1"
FT                   /translation="MLNTLIVGASGYAGAELTAYLNRHPHMNITGLAVSAQSADAGKLL
FT                   SDLHPQLKGILDLPLQPLVDVAQAAKGIDVVFLATAHEVSHDLAPQFLAAGCVVFDLSG
FT                   AFRVRDAAFYSQYYGFEHQHPDWLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQLAL
FT                   KPLVDGQLLNDAQWPVINAVSGVSGAGRKASMGNSFCEVSLQPYGLFTHRHQPEIVTHL
FT                   GTPVIFTPHLGNFARGILATITCRLKAGVTAQNIADAYHHAYQNKPLVRLYQQGVPALK
FT                   AVVGLPFCDIGFSVQGEHLIIVATEDNLLKGAAAQAVQCMNIRFGFPETQSLL"
FT   gene            334453..335229
FT                   /gene="argB"
FT                   /locus_tag="y0311"
FT   CDS_pept        334453..335229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="y0311"
FT                   /product="acetylglutamate kinase"
FT                   /function="enzyme; amino acid biosynthesis: Arginine"
FT                   /note="residues 1 to 256 of 258 are 84.76 pct identical to
FT                   residues 1 to 256 of 258 from E. coli K12 : B3959"
FT                   /db_xref="EnsemblGenomes-Gn:y0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83902"
FT                   /db_xref="GOA:Q8ZA87"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="PDB:3T7B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA87"
FT                   /protein_id="AAM83902.1"
FT                   /translation="MMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGG
FT                   CLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCL
FT                   ADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQ
FT                   AATALAATLGADLILLSDVSGILDGKGQRIAEMTAQKAEQLIAQGIITDGMVVKVNAAL
FT                   DAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV"
FT   gene            335396..336769
FT                   /gene="argH"
FT                   /locus_tag="y0312"
FT   CDS_pept        335396..336769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="y0312"
FT                   /product="argininosuccinate lyase"
FT                   /function="enzyme; amino acid biosynthesis: Arginine"
FT                   /note="residues 1 to 456 of 457 are 89.03 pct identical to
FT                   residues 1 to 456 of 457 from E. coli K12 : B3960; residues
FT                   1 to 456 of 457 are 90.57 pct identical to residues 1 to
FT                   456 of 458 from GenPept : >gb|AAL22962.1| (AE008892)
FT                   argininosuccinate lyase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83903"
FT                   /db_xref="GOA:Q8ZA88"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA88"
FT                   /protein_id="AAM83903.1"
FT                   /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALV
FT                   TVGVLNADEQQQLEQALSVLLEEVQANPHAILASDAEDIHSWVETKLIDKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKFQITELQTAVQQLQQALVMTAEANQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYVEMLSRDESRLQDTLKRLDVSPLGCGALAGTAYAIDREQLAGWLGFASAT
FT                   RNSLDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALTGMTMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLH
FT                   MAALVLDGIQVKRPRCKEAAEQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQG
FT                   KALEALALSDLQQFSSVIGDDVYPILALQSCLDKRVAKGGVSPQQVASAIAEAKARLF"
FT   gene            337368..339860
FT                   /gene="hasR"
FT                   /locus_tag="y0313"
FT   CDS_pept        337368..339860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasR"
FT                   /locus_tag="y0313"
FT                   /product="putative outer membrane receptor"
FT                   /function="transport: transport of small molecules;
FT                   cations"
FT                   /note="receptor for HasA and heme; residues 42 to 830 of
FT                   830 are 55.62 pct identical to residues 122 to 899 of 899
FT                   from GenPept : >emb|CAA70172.1| (Y08983) hasR [Serratia
FT                   marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83904"
FT                   /db_xref="GOA:A0A3N4B6R1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6R1"
FT                   /protein_id="AAM83904.1"
FT                   /translation="MDNIIRDKKTIISVNKITTCILFALVTQGYSGQLAANTAETPTNN
FT                   NDMALDKLNVEGKGNAHDSDWIYDEPRSVSEITREQLDNRPARHAADILEQTPGVYSSV
FT                   SQQDPGLSINIRGIQDYGRVNMNIDGMRQNFMKSGHGQRNGSMYIDPEILSNVVIERGI
FT                   FNGIGGAGAIGGIATFNTINASDFLAPEKELGGHIRAMTGDNGTRFIGSGALALGNPNG
FT                   DILLAVSERNLKDYWPGNKGVLAGLRLYSPTRNVGDDLKNTKTLFTGYKMRSQLAKVGW
FT                   NFEAGQRLEFSYLQTQIASPNASMLSEVLALSPSGKEITKIGWRNTSFTNVENRNIALD
FT                   YRLNPEHISWLDATAKIYYVDTNDETDNANSLFKEYFWTQTRLKTRGLQLQNTNTFTPS
FT                   DAHQIRLKYGLEWFSDKSEGYSTRKLIERTTPPGKRAITSTFAQLNYEYDDWLRLEGGL
FT                   RYDQFRLKGNTWLHTRSFLQPYTFENPCDRRIHEQSEKPGSRCSSRRPATMRWDVDRCE
FT                   QQLSPTLAMGVKPGLEWLEFFGSYGKSWRPPAMTEVLATGTAHGYSWVLPNPFVAAERA
FT                   RTWEAGFNIQQSNLFIEDDHFAAKVAYFDTRIANYINLELGKAKPKFGGDSFTDVAYVN
FT                   NLLKTRFRGLEYQLSYDAGTFYTNINYTRMIGVNNVCSPYAWLGGLQSVKYKYVGKVEQ
FT                   IYAVENEVANNYVTCMNANVLFGSSAYLPGDRGSLTLGSRIFDRRLDFGTVIRYNKGYQ
FT                   DRSAQDENGNPLTAYVADWPKYIVYDLYASYKVTNNLILRSSIENITNRAYLVNYGDTL
FT                   SFAPSRGRTIQGGFEYKF"
FT   gene            340082..340699
FT                   /gene="hasA"
FT                   /locus_tag="y0314"
FT   CDS_pept        340082..340699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasA"
FT                   /locus_tag="y0314"
FT                   /product="secreted hemophore"
FT                   /function="transport: transport of small molecules;
FT                   cations"
FT                   /note="secreted heme-binding protein experimentally shown
FT                   to bind heme; residues 1 to 181 of 205 are 31.60 pct
FT                   identical to residues 1 to 182 of 188 from GenPept :
FT                   >emb|CAA57068.1| (X81195) hasA [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83905"
FT                   /db_xref="GOA:A0A3N4BW03"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="InterPro:IPR036912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BW03"
FT                   /protein_id="AAM83905.1"
FT                   /translation="MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFSG
FT                   SSTLFSGTQYAIGSSHSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGGPS
FT                   AGKHLEKIDITFNELDLSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKAKGI
FT                   NVDTAFKDLSIASQYPDSGYMSDAPMVDTVGVVDCHDMLLAA"
FT   gene            340850..342673
FT                   /gene="hasD"
FT                   /locus_tag="y0315"
FT   CDS_pept        340850..342673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasD"
FT                   /locus_tag="y0315"
FT                   /product="secretion ATPase, Type I secretion system"
FT                   /function="transport: transport of small molecules;
FT                   cations"
FT                   /note="secretion of HasA; residues 22 to 589 of 607 are
FT                   62.14 pct identical to residues 1 to 566 of 582 from
FT                   GenPept : >dbj|BAA12015.1| (D83582) metalloprotease
FT                   transporter [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83906"
FT                   /db_xref="GOA:Q8CWI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWI3"
FT                   /protein_id="AAM83906.1"
FT                   /translation="MEMDAMESCKTPGASSVPPTILSVLAGNKKILWGIGLFTAVINLL
FT                   MLAPAIYMLQVYDRVLASANTMTLLMLTVLVLGVFVFIGLLEWVRSAVVIRLGTQIDMQ
FT                   LNQPVFNAAFAANLKGHNTPAAQALNDLTVLRQFATGNALFAFFDAPWFPLYLLVIFLL
FT                   HPWLGMLAAAGAGILVVLAWLNQWICKKPLHDASIITSHATQQANANLRNADVIEAMGM
FT                   LKALRERWLMQHANFLYQQNLASDKSSRVTAVAKSSRQALQSMMLGLGALLVIYNEITA
FT                   GVMIAGSILIGRVLGPIDQLIAVWKQWSHARLAYQRLSQLLAQHPSSPTGMVLPAPQGK
FT                   LNVTQLMACKPGTHIPVLHSINFELQPGDVLGILGPSGSGKSTLAKLLVASQPTFSGTV
FT                   RLDSADLSRWDKTQLGEFIGYLPQNIQLFRGTVAENIARFGAIDTAKVVAAAQLADVHD
FT                   LILHLPQGYDTPLGDDGEGLSGGQRQRIALARAMYGIPRLIVLDEPDASLDKEGEQALL
FT                   ASIIQLKQQGCTIVMITHKPELLSGSDYLLFLKNGQMDLFDRTQAVLQNIQGKDKPAVQ
FT                   PEAKILNSRSGWSNGVSYGIGPARTTSSPKP"
FT   gene            342749..344077
FT                   /gene="hasE"
FT                   /locus_tag="y0316"
FT   CDS_pept        342749..344077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasE"
FT                   /locus_tag="y0316"
FT                   /product="secretion permease, Type I secretion system"
FT                   /function="transport: transport of small molecules;
FT                   cations"
FT                   /note="secretion of HasA; residues 20 to 442 of 442 are
FT                   47.54 pct identical to residues 17 to 443 of 443 from
FT                   GenPept : >dbj|BAA12016.1| (D83582) metalloprotease
FT                   transporter [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83907"
FT                   /db_xref="GOA:A0A3N4B6R0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6R0"
FT                   /protein_id="AAM83907.1"
FT                   /translation="MLPESVCYSVANANRQPPLQINSGRYLNIGGGLVVIGFIGFLLWA
FT                   GLAPLDKGVAVTGLLVVAENRKVIQPLQGGRIQQLHVTEGDEIVSGQLLVTLDDTAIRN
FT                   QRDNLQHQYLSALAQEARLTAEQNDLDVITFPQALLEHATQPAVERNIILQQQLLHHRR
FT                   QAHLSEIARLSTQLTRHQARLDGLQAMRSNHQRQSNLFQQQLDSVQLLAKDGHIAKNKL
FT                   LEMESQSTSLQARVEQSTSDIAEAHKLIDETEQHVLQRREQYQSENSEQLAKAQQNTQE
FT                   LVQRLNIAEYELSHTRIFAPVSGSVIALAQHTVGGVVSSGQALMEIVPSGQPLFVEAQL
FT                   PVELIDKVAVGLPVDLNFSAFNQSNTPRLQGSVWRIGADRIQPPPTSPPYYPLTVAIDL
FT                   DPTELAIRPGMAVDVFIRTGERSLLSYLFKPFTDRLHLALAEE"
FT   gene            344142..344945
FT                   /gene="hasB"
FT                   /locus_tag="y0317"
FT   CDS_pept        344142..344945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hasB"
FT                   /locus_tag="y0317"
FT                   /product="TonB-like protein"
FT                   /function="transport: transport of small molecules;
FT                   cations"
FT                   /note="possibly specific for heme-HasA uptake via HasR
FT                   receptor; residues 14 to 265 of 267 are 36.90 pct identical
FT                   to residues 16 to 257 of 258 from GenPept : >gb|AAK67308.1|
FT                   (AF283294) CjrB [Shigella flexneri]"
FT                   /db_xref="EnsemblGenomes-Gn:y0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83908"
FT                   /db_xref="GOA:A0A3N4BB94"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB94"
FT                   /protein_id="AAM83908.1"
FT                   /translation="MNRLQQSSDKLIFWLVGALLACGIHIYALWWLSTASIPAIPTSYP
FT                   AAIMMELSAEPEFMQNLPQNSVVGITQNIIEPAVEQRVNQPDDIVDLPTLPEQPEGQRE
FT                   ITRKEPIKVKRPAENRATSRKPVNKETQESDSKQSSPAAAASAMLSGTSQQVAAAVNSD
FT                   SSHRQQAQVSWKSRLQGHLMGFKRYPSSARKQQQQGTAMIRFVVDKNGYVSSVQLSHSS
FT                   GTSALDREALAIIKRAQPLPKPPAELLSQGQITLSLPVDFNLKRK"
FT   gene            complement(345061..346524)
FT                   /locus_tag="y0318"
FT   CDS_pept        complement(345061..346524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0318"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /function="enzyme; oxidoreductase"
FT                   /note="residues 1 to 486 of 487 are 75.00 pct identical to
FT                   residues 1 to 483 of 484 from GenPept : >gb|AAF95779.1|
FT                   (AE004330) pyridine nucleotide-disulfide oxidoreductase,
FT                   class I [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83909"
FT                   /db_xref="GOA:A0A384KJ53"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJ53"
FT                   /protein_id="AAM83909.1"
FT                   /translation="MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCAR
FT                   VGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLESV
FT                   ETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNELGDR
FT                   LIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRD
FT                   YAAKTLGDEFYLDPDVKVELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDK
FT                   LGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQLPLLHEASDQARIAGVNAGG
FT                   FPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVML
FT                   KNKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEE
FT                   GLRTALRDLQSKLKLGADEAERCLRCPGE"
FT   gene            complement(346619..347350)
FT                   /locus_tag="y0319"
FT   CDS_pept        complement(346619..347350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0319"
FT                   /product="peroxiredoxin family protein"
FT                   /function="enzyme; oxidoreductase"
FT                   /note="residues 1 to 241 of 243 are 81.32 pct identical to
FT                   residues 5 to 245 of 247 from GenPept : >gb|AAF95778.1|
FT                   (AE004330) peroxiredoxin family protein/glutaredoxin
FT                   [Vibrio cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83910"
FT                   /db_xref="GOA:A0A2S9PCW9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PCW9"
FT                   /protein_id="AAM83910.1"
FT                   /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNG
FT                   EFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVP
FT                   QIFIGGRHIGGSDDLEKYLPA"
FT   gene            347497..348414
FT                   /gene="oxyR"
FT                   /locus_tag="y0320"
FT   CDS_pept        347497..348414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="y0320"
FT                   /product="activator, hydrogen peroxide-inducible genes"
FT                   /function="regulator; global regulatory functions"
FT                   /note="residues 1 to 305 of 305 are 86.55 pct identical to
FT                   residues 1 to 305 of 305 from E. coli K12 : B3961; residues
FT                   1 to 297 of 305 are 91.24 pct identical to residues 1 to
FT                   297 of 302 from GenPept : >gb|AAC72241.1| (U74302)
FT                   oxidative stress transcriptional regulator [Pectobacterium
FT                   carotovorum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83911"
FT                   /db_xref="GOA:A0A3N4B8N5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8N5"
FT                   /protein_id="AAM83911.1"
FT                   /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGI
FT                   MLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPLFDE
FT                   PMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGR
FT                   YEQLAEAIRDHMQERMAPSLEQAI"
FT   gene            complement(348397..349731)
FT                   /gene="udhA"
FT                   /locus_tag="y0321"
FT   CDS_pept        complement(348397..349731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udhA"
FT                   /locus_tag="y0321"
FT                   /product="putative oxidoreductase"
FT                   /note="residues 1 to 444 of 444 are 84.00 pct identical to
FT                   residues 1 to 444 of 444 from E. coli K12 : B3962; residues
FT                   1 to 444 of 444 are 85.36 pct identical to residues 23 to
FT                   466 of 466 from GenPept : >gb|AAL22964.1| (AE008893)
FT                   soluble pyridine nucleotide transhydrogenase [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83912"
FT                   /db_xref="GOA:Q8ZA97"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZA97"
FT                   /protein_id="AAM83912.1"
FT                   /translation="MGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFN
FT                   QNPLYSDNARTIKSSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVN
FT                   VRYADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVIIYGAG
FT                   VIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEFEQIE
FT                   GTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTAL
FT                   SHVYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKT
FT                   EQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILFHRETKQILGIHCFGERAAEII
FT                   HIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF"
FT   gene            350003..350650
FT                   /locus_tag="y0322"
FT   CDS_pept        350003..350650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0322"
FT                   /product="hypothetical protein"
FT                   /note="residues 4 to 210 of 215 are 95.65 pct identical to
FT                   residues 19 to 225 of 234 from E. coli K12 : B3963"
FT                   /db_xref="EnsemblGenomes-Gn:y0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83913"
FT                   /db_xref="GOA:Q7CL09"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CL09"
FT                   /protein_id="AAM83913.1"
FT                   /translation="MGTIMGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREA
FT                   GIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIG
FT                   NNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVT
FT                   IVFSAGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
FT   gene            350663..351070
FT                   /locus_tag="y0323"
FT   CDS_pept        350663..351070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0323"
FT                   /product="hypothetical protein"
FT                   /note="residues 3 to 115 of 135 are 66.37 pct identical to
FT                   residues 2 to 114 of 119 from E. coli K12 : B3964; residues
FT                   3 to 115 of 135 are 70.79 pct identical to residues 2 to
FT                   114 of 119 from GenPept : >gb|AAL22966.1| (AE008893)
FT                   putative inner membrane protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83914"
FT                   /db_xref="GOA:A0A3N4B6Q5"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6Q5"
FT                   /protein_id="AAM83914.1"
FT                   /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTLI
FT                   LAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVVLV
FT                   FWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
FT   gene            complement(351204..352307)
FT                   /gene="trmA"
FT                   /locus_tag="y0324"
FT   CDS_pept        complement(351204..352307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="y0324"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /function="enzyme; aminoacyl tRNA synthetases, tRNA
FT                   modification"
FT                   /note="residues 1 to 363 of 367 are 77.41 pct identical to
FT                   residues 1 to 363 of 366 from E. coli K12 : B3965; residues
FT                   1 to 363 of 367 are 77.41 pct identical to residues 1 to
FT                   363 of 366 from GenPept : >gb|AAG59169.1|AE005628_5
FT                   (AE005628) tRNA (uracil-5-)-methyltransferase [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83915"
FT                   /db_xref="GOA:Q8ZAA0"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAA0"
FT                   /protein_id="AAM83915.1"
FT                   /translation="MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHYR
FT                   MRAEFRVWHDEDDLYHIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLRRK
FT                   LFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTKIML
FT                   DHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELYCGNG
FT                   NFSLALARNFERVLATEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREFN
FT                   RLKGIDLGSYNCETIFVDPPRSGLDHETVKLVQAYPRILYISCNPETLCANLEQLQHTH
FT                   KISRLALFDQFPYTHHMECGVLLEKRH"
FT   gene            352703..354664
FT                   /gene="btuB"
FT                   /locus_tag="y0325"
FT   CDS_pept        352703..354664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuB"
FT                   /locus_tag="y0325"
FT                   /product="outer membrane receptor for transport of vitamin
FT                   B12, E colicins, and bacteriophage BF23"
FT                   /function="membrane; outer membrane constituents"
FT                   /note="residues 31 to 653 of 653 are 64.84 pct identical to
FT                   residues 2 to 614 of 614 from E. coli K12 : B3966"
FT                   /db_xref="EnsemblGenomes-Gn:y0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83916"
FT                   /db_xref="GOA:Q8ZAA1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAA1"
FT                   /protein_id="AAM83916.1"
FT                   /translation="MAVAYYRPWHCGIRQLSLDALLMIIKNTMTIKKYTLLTALSVTAF
FT                   SGWAQGNNTTDNNDEMVVTANRFPQPKSSVLAPVDVVTRADIDRWQSTNINDVLRRLPG
FT                   VDIAQDGGMGQRSSLFIRGTNSSHVLVLIDGVRLNQAGITGASDLSQIPISLVQRIEYI
FT                   RGPRSAVYGSDAIGGVINILTGRDKPGTTLSAGLGSNGYQTYDGSTQQKLGEDTTVTLA
FT                   GNYTYSKGYDVVAGMPGAGGPRQPDRDGFMGKMLWAGLEHQFNEQFNGFARVYGFDNRS
FT                   DYDGYTNYSNPLALIDTRKLSSRTYDTGLRYKNGIYASQFIASYNRTKDYNYSPLFGQH
FT                   DITASLDEAEQYNLQWGNTFQLTNGMISAGADWQEQRTERKSSNQNTTADFTQHNTGIY
FT                   LTGQQQISDVTLEGAVRSDDNSQFGWHSTWQTSAGWEFIDGYRLIGSYGTAYKAPNLMQ
FT                   LYSAYGGNANLKPEESKQWEGGVEGLTGPLTWRLSAYRNDIDQLIDYSNLTNGYFNINK
FT                   ATIKGVEWTGSFDTGPLSHQVTLEYLDPRNADTHEILVRRAKQQVKYQLDWQVADLDWS
FT                   VTYQYLGQRYDKDYSTYPEETVELGGVSLWDLAVSYPVTSHLTVRGRIANLFDKDYEMV
FT                   YGYQTPGREYYFTGSYNF"
FT   gene            354573..355472
FT                   /gene="murI"
FT                   /locus_tag="y0326"
FT   CDS_pept        354573..355472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="y0326"
FT                   /product="glutamate racemase"
FT                   /function="enzyme; murein sacculus, peptidoglycan"
FT                   /note="required for biosynthesis of D-glutamate and
FT                   peptidoglycan; residues 9 to 299 of 299 are 71.13 pct
FT                   identical to residues 1 to 287 of 289 from E. coli K12 :
FT                   B3967; residues 13 to 299 of 299 are 73.17 pct identical to
FT                   residues 1 to 283 of 283 from GenPept : >gb|AAL22969.1|
FT                   (AE008893) glutamate racemase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83917"
FT                   /db_xref="GOA:Q8ZAA2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAA2"
FT                   /protein_id="AAM83917.1"
FT                   /translation="MPTCLIKIMRWFMATKPQDANTTSREAITSKADSPPRPTALIFDS
FT                   GVGGLSVYQEIRQLLPDLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQRHPLAIV
FT                   VIACNTASTVSLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYTLDL
FT                   IARFATDCKIELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSMREPPDTIVLGCTH
FT                   FPLLTEELAQVLPEGTRMVDSGAAIARRTAWLISSQENVISSQDENIAYCMALDEDTDA
FT                   LLPVLQSYGFPKLQKLPI"
FT   gene            355930..357514
FT                   /locus_tag="yr005"
FT   rRNA            355930..357514
FT                   /locus_tag="yr005"
FT                   /product="16S ribosomal RNA"
FT   gene            357608..357680
FT                   /locus_tag="yt003"
FT   tRNA            357608..357680
FT                   /locus_tag="yt003"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: TTC"
FT   gene            357936..360842
FT                   /locus_tag="yr006"
FT   rRNA            357936..360842
FT                   /locus_tag="yr006"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(360878..361270)
FT                   /locus_tag="y0327"
FT   CDS_pept        complement(360878..361270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0327"
FT                   /product="hypothetical"
FT                   /note="residues 5 to 36 of 130 are 50.00 pct identical to
FT                   residues 11 to 48 of 50 from GenPept : >emb|CAB67146.1|
FT                   (AJ271079) hypothetical protein [Oenothera elata subsp.
FT                   hookeri]"
FT                   /db_xref="EnsemblGenomes-Gn:y0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83918"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS5"
FT                   /protein_id="AAM83918.1"
FT                   /translation="MAERTGLEPATPCVTGRYSNQLNYRSTDSFTCIFPILYPIRASAL
FT                   RCAKPLLAILTVTRCHSDNSCLMPGSVLLSHGETPHYHRRYGVSLLSSAWDQVGPPRYG
FT                   RQANSVLINPQTSNTCQPVNTISERR"
FT   gene            360950..361069
FT                   /locus_tag="yr007"
FT   rRNA            360950..361069
FT                   /locus_tag="yr007"
FT                   /product="5S ribosomal RNA"
FT   gene            361193..361272
FT                   /locus_tag="yt004"
FT   tRNA            361193..361272
FT                   /locus_tag="yt004"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: GTC"
FT   gene            361278..361350
FT                   /locus_tag="yt005"
FT   tRNA            361278..361350
FT                   /locus_tag="yt005"
FT                   /product="tRNA-Trp"
FT                   /note="anticodon: CCA"
FT   gene            362330..363286
FT                   /locus_tag="y0328"
FT   CDS_pept        362330..363286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0328"
FT                   /product="solute-binding periplasmic protein of ABC
FT                   transporter"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 318 of 318 are 75.78 pct identical to
FT                   residues 1 to 318 of 318 from E. coli K12 : B4227"
FT                   /db_xref="EnsemblGenomes-Gn:y0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83919"
FT                   /db_xref="GOA:A0A3N4BL09"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BL09"
FT                   /protein_id="AAM83919.1"
FT                   /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKVA
FT                   KQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKEAK
FT                   IPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVAGKPCNVVELQGTVGSSV
FT                   AINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYAHNDD
FT                   MAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPALDALI
FT                   VLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
FT   gene            363372..364862
FT                   /locus_tag="y0329"
FT   CDS_pept        363372..364862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0329"
FT                   /product="putative ATP-binding component of ATP transport
FT                   system"
FT                   /function="putative transport"
FT                   /note="residues 4 to 376 of 496 are 62.73 pct identical to
FT                   residues 9 to 381 of 417 from E. coli K12 : B4228; residues
FT                   4 to 494 of 496 are 67.20 pct identical to residues 9 to
FT                   499 of 500 from GenPept : >gb|AAG59426.1|AE005655_5
FT                   (AE005655) putative ATP-binding component of ABC
FT                   transporter [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83920"
FT                   /db_xref="GOA:A0A2S9PH09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PH09"
FT                   /protein_id="AAM83920.1"
FT                   /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKST
FT                   LIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGR
FT                   EPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLI
FT                   LDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTK
FT                   TVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPG
FT                   EIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRK
FT                   TEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLS
FT                   GGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELE
FT                   ELAGYADRIIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
FT   gene            364874..365893
FT                   /locus_tag="y0330"
FT   CDS_pept        364874..365893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0330"
FT                   /product="putative ABC transport system inner membrane
FT                   permease protein"
FT                   /function="putative transport"
FT                   /note="residues 4 to 326 of 339 are 70.67 pct identical to
FT                   residues 4 to 325 of 341 from E. coli K12 : B4230; residues
FT                   4 to 326 of 339 are 70.37 pct identical to residues 4 to
FT                   325 of 341 from GenPept : >gb|AAG59427.1|AE005655_6
FT                   (AE005655) putative transport system permease protein
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83921"
FT                   /db_xref="GOA:A0A3N4B8M6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8M6"
FT                   /protein_id="AAM83921.1"
FT                   /translation="MGNRSLSMTQRPRKVKWVLPKGATQFGALAVILLIDSLVAPHFFS
FT                   IHIQDGRLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLTSA
FT                   GYPFMTVLALSLAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQIVTF
FT                   DSGGLATLGSSTLMYLPMSVVIACSMLILVWLLTRKTALGLFIESVGINLRSARNAGVS
FT                   TRLVLIAVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASLMGGRF
FT                   NLLLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHLFQRRK"
FT   gene            365893..366885
FT                   /locus_tag="y0331"
FT   CDS_pept        365893..366885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0331"
FT                   /product="putative ABC transporter permease protein"
FT                   /function="putative transport"
FT                   /note="residues 9 to 330 of 330 are 70.18 pct identical to
FT                   residues 1 to 318 of 323 from E. coli K12 : B4231"
FT                   /db_xref="EnsemblGenomes-Gn:y0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83922"
FT                   /db_xref="GOA:A0A3N4B9N6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9N6"
FT                   /protein_id="AAM83922.1"
FT                   /translation="MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAFL
FT                   GIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFGAL
FT                   MGWIIDSLKLPAFIITLAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGGRFT
FT                   LLAFIMLMVVAFGILLAHHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSSTLAA
FT                   LSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQGLIQSY
FT                   ITFDGTLSSWWTKIVIGILLFSFIVIQKAMSAFYLNRRSRPQSSPLTPV"
FT   gene            complement(366872..367753)
FT                   /locus_tag="y0332"
FT   CDS_pept        complement(366872..367753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0332"
FT                   /product="hypothetical protein"
FT                   /note="residues 84 to 280 of 293 are 50.99 pct identical to
FT                   residues 3 to 190 of 198 from E. coli K12 : B3762; residues
FT                   1 to 281 of 293 are 62.32 pct identical to residues 1 to
FT                   272 of 278 from GenPept : >emb|CAD09467.1| (AL627279)
FT                   possible LysR-family transcriptional regulatory protein
FT                   [Salmonella enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83923"
FT                   /db_xref="GOA:Q8ZAA7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAA7"
FT                   /protein_id="AAM83923.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEAYL
FT                   TPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGHFSL
FT                   RLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTTTSAH
FT                   LTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIRQLLKT
FT                   PMNNATQSVTRE"
FT   gene            367788..368210
FT                   /locus_tag="y0333"
FT   CDS_pept        367788..368210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0333"
FT                   /product="hypothetical protein"
FT                   /note="residues 29 to 140 of 140 are 83.03 pct identical to
FT                   residues 1 to 112 of 112 from E. coli K12 : B3764"
FT                   /db_xref="EnsemblGenomes-Gn:y0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83924"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L6"
FT                   /protein_id="AAM83924.1"
FT                   /translation="MFCFTRCQAYLILRAINSTTMRELGACQMADSFITTNRFFDNKHY
FT                   PRGFSRHGDFTIKEAQLLERHGYAFNELDSGKREPVTEEEQRFVAVCRGEREPVSAEEK
FT                   VWSKYVIRTRQPKRFHTLSGGKPQMDAVEDYTDSDD"
FT   gene            complement(368467..370011)
FT                   /locus_tag="y0334"
FT   CDS_pept        complement(368467..370011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0334"
FT                   /product="putative 2-component regulator"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 513 of 514 are 62.76 pct identical to
FT                   residues 4 to 515 of 516 from E. coli K12 : B3765"
FT                   /db_xref="EnsemblGenomes-Gn:y0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83925"
FT                   /db_xref="GOA:Q8D1L5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L5"
FT                   /protein_id="AAM83925.1"
FT                   /translation="MTAKESIMSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLP
FT                   ETTVKEARDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIP
FT                   ADKLAHYEFLGELALSGALRRVSGAIPAALTCSEANRQLILPTANGLEIGLIPQGNSWV
FT                   ADHLLAVCGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLL
FT                   LLGPPGTGKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSA
FT                   SMAALIGGGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKI
FT                   CFPAKVQLIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAG
FT                   MLGAQKNQGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQV
FT                   LLTLGLSVRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
FT   gene            370374..370472
FT                   /gene="ilvL"
FT                   /locus_tag="y0335"
FT   CDS_pept        370374..370472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvL"
FT                   /locus_tag="y0335"
FT                   /product="ilvGEDA operon leader peptide"
FT                   /function="leader; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 1 to 32 of 32 are 81.25 pct identical to
FT                   residues 1 to 32 of 32 from E. coli K12 : B3766"
FT                   /db_xref="EnsemblGenomes-Gn:y0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83926"
FT                   /db_xref="GOA:Q8D1L4"
FT                   /db_xref="InterPro:IPR012567"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1L4"
FT                   /protein_id="AAM83926.1"
FT                   /translation="MKAILQVINLVLISVVVIIIPPCGAALGRRKA"
FT   gene            370613..372259
FT                   /gene="ilvG"
FT                   /locus_tag="y0336"
FT   CDS_pept        370613..372259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="y0336"
FT                   /product="acetohydroxy acid synthase II"
FT                   /function="enzyme; amino acid biosynthesis"
FT                   /note="residues 1 to 548 of 548 are 79.92 pct identical to
FT                   residues 1 to 548 of 548 from GenPept :
FT                   >gb|AAG58963.1|AE005608_4 (AE005608) acetohydroxy acid
FT                   synthase II [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83927"
FT                   /db_xref="GOA:A0A3N4B6N9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6N9"
FT                   /protein_id="AAM83927.1"
FT                   /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDIQL
FT                   AVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRDFIAM
FT                   TGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDRVTGKL
FT                   NTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQSWRDEVMALKQQ
FT                   HHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAALDALFNSEGP
FT                   YLLQVSIDELENVWPLVPPGAGNETMLEKIS"
FT   gene            372461..373462
FT                   /gene="ilvE"
FT                   /locus_tag="y0337"
FT   CDS_pept        372461..373462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="y0337"
FT                   /product="branched-chain amino-acid aminotransferase"
FT                   /function="enzyme; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 27 to 332 of 333 are 91.17 pct identical to
FT                   residues 3 to 308 of 309 from E. coli K12 : B3770; residues
FT                   27 to 332 of 333 are 91.50 pct identical to residues 3 to
FT                   308 of 309 from GenPept : >gb|AAG58965.1|AE005608_6
FT                   (AE005608) branched-chain amino-acid aminotransferase
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83928"
FT                   /db_xref="GOA:Q8D1L3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L3"
FT                   /protein_id="AAM83928.1"
FT                   /translation="MSPVSRSYNLIHYRYAPDAPEGKKRMTKKADYIWFNGEMVPWAEA
FT                   KVHVMSHALHYGTSVFEGVRCYESHKGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELM
FT                   EACRATLRKNNLTSAYIRPLVFIGDVGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQG
FT                   IDAMVSSWNRVAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGE
FT                   NLFEVKDGILFTPPFTSSALPGITRDAIIKLAKDMGLEVREQVLSRESLYLADEVFMSG
FT                   TAAEITPVRSVDGIQVGIGKRGPVTAKIQQAFFGLFTGETEDKWGWLDQVNP"
FT   gene            373725..375623
FT                   /gene="ilvD"
FT                   /locus_tag="y0338"
FT   CDS_pept        373725..375623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="y0338"
FT                   /product="dihydroxyacid dehydratase"
FT                   /function="enzyme; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 37 to 632 of 632 are 86.04 pct identical to
FT                   residues 4 to 605 of 605 from E. coli K12 : B3771"
FT                   /db_xref="EnsemblGenomes-Gn:y0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83929"
FT                   /db_xref="GOA:Q8ZAB3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAB3"
FT                   /protein_id="AAM83929.1"
FT                   /translation="MRQTLICKIKTRSEETMPKYRSHTTTHGRNMAGARALWRATGMTD
FT                   DDFGKPIIAVVNSFTQFVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHG
FT                   GMLYSLPSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGP
FT                   MEAGKTKLSDKIIKLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNC
FT                   LNEALGLALPGNGSLLATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIANKAAF
FT                   ENAMILDIAMGGSTNTVLHLLAAAQEGEIDFSMTDIDHLSRKVPHLCKVAPSTQKYHME
FT                   DVHRAGGVIGILGELDRAGLLNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPA
FT                   GIRTTKAFSQDCRYPSLDTDREEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVD
FT                   KDSLTFRGPAKVFESQDEAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKS
FT                   MGLGKSCALLTDGRFSGGTSGLSIGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDV
FT                   SEAELAARRETEEAHGDAAWSPKGRERQVSYALRAYAMLATSADKGAVRDKSKLGG"
FT   gene            375629..377173
FT                   /gene="ilvA"
FT                   /locus_tag="y0339"
FT   CDS_pept        375629..377173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="y0339"
FT                   /product="threonine deaminase (dehydratase)"
FT                   /function="enzyme; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 1 to 514 of 514 are 84.63 pct identical to
FT                   residues 1 to 514 of 514 from E. coli K12 : B3772; residues
FT                   1 to 514 of 514 are 85.01 pct identical to residues 1 to
FT                   514 of 514 from GenPept : >dbj|BAB38129.1| (AP002566)
FT                   threonine deaminase [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83930"
FT                   /db_xref="GOA:A0A3N4B8L3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8L3"
FT                   /protein_id="AAM83930.1"
FT                   /translation="MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRVG
FT                   NTVLVKREDRQPVHSFKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMGIK
FT                   ALIVMPVATADIKVDAVRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHPAVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSACLRA
FT                   ALDAGQPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKDLFEDV
FT                   RAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADAENACIFVGVRLTRGYAERVEILAEL
FT                   QDKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFELSATEPQFEERLAALGYYCHDETDNPAFKFFLAG"
FT   gene            complement(377304..377789)
FT                   /locus_tag="y0340"
FT   CDS_pept        complement(377304..377789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0340"
FT                   /product="hypothetical"
FT                   /note="residues 7 to 161 of 161 are 33.72 pct identical to
FT                   residues 6 to 167 of 176 from GenPept : >emb|CAD02952.1|
FT                   (AL627277) putative exported protein [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83931"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9M7"
FT                   /protein_id="AAM83931.1"
FT                   /translation="MRLPGAVMKAKSKKIICALLLLGSILLGYFFWLSRHPVEIISVHQ
FT                   RNNYSDILVRNFPFTEKGKINWWLENRDMLKAKYSIPKPASDGFYTIIFWDFGDGYKEE
FT                   GKYDRLCFSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
FT   gene            complement(377848..378330)
FT                   /locus_tag="y0341"
FT   CDS_pept        complement(377848..378330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0341"
FT                   /product="hypothetical"
FT                   /note="residues 7 to 153 of 160 are 37.01 pct identical to
FT                   residues 6 to 152 of 176 from GenPept : >emb|CAD02952.1|
FT                   (AL627277) putative exported protein [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83932"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L443"
FT                   /protein_id="AAM83932.1"
FT                   /translation="MRLPGAVMKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHK
FT                   DGNFSAVLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEE
FT                   GKYDRRCFEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKRE"
FT   gene            complement(378389..378850)
FT                   /locus_tag="y0342"
FT   CDS_pept        complement(378389..378850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0342"
FT                   /product="hypothetical"
FT                   /note="residues 5 to 146 of 153 are 39.35 pct identical to
FT                   residues 8 to 152 of 176 from GenPept : >emb|CAD02952.1|
FT                   (AL627277) putative exported protein [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83933"
FT                   /db_xref="GOA:A0A384KG63"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG63"
FT                   /protein_id="AAM83933.1"
FT                   /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRRC
FT                   FEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
FT   gene            complement(378834..379789)
FT                   /pseudo
FT                   /locus_tag="y0343"
FT                   /note="disrupted by frameshift"
FT   gene            complement(380665..381549)
FT                   /gene="ilvY"
FT                   /locus_tag="y0344"
FT   CDS_pept        complement(380665..381549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="y0344"
FT                   /product="positive regulator for ilvC"
FT                   /function="regulator; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 2 to 294 of 294 are 73.72 pct identical to
FT                   residues 1 to 293 of 297 from E. coli K12 : B3773; residues
FT                   2 to 294 of 294 are 74.06 pct identical to residues 1 to
FT                   293 of 297 from GenPept : >gb|AAG58968.1|AE005608_9
FT                   (AE005608) positive regulator for ilvC [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83934"
FT                   /db_xref="GOA:Q8D1L2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L2"
FT                   /protein_id="AAM83934.1"
FT                   /translation="MMDLRDLKVFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIG
FT                   QPLFLRDNRTVQLTDAGNQLKAFAQQTLLQYQQLLHALGQHGPSLSGELRLFCSVTAAY
FT                   SHLPPILDRFRARHPLVEIKLTTGDAADAVNKVQSNEADLGIAGRPEVLPTSVAFTQIG
FT                   EIPLVLIAPALPCAVRSQVAVEKPDWAMIPFILPEHGPSRKRIDLWFRRQRITNPLIYA
FT                   TVSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCVPKKR
FT                   LQEPLIDAFWGLL"
FT   gene            381832..383310
FT                   /gene="ilvC"
FT                   /locus_tag="y0345"
FT   CDS_pept        381832..383310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="y0345"
FT                   /product="ketol-acid reductoisomerase"
FT                   /function="enzyme; amino acid biosynthesis: Isoleucine,
FT                   Valine"
FT                   /note="residues 1 to 492 of 492 are 92.07 pct identical to
FT                   residues 1 to 491 of 491 from E. coli K12 : B3774; residues
FT                   1 to 492 of 492 are 92.27 pct identical to residues 1 to
FT                   491 of 491 from GenPept : >emb|CAD09408.1| (AL627279)
FT                   ketol-acid reductoisomerase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83935"
FT                   /db_xref="GOA:Q8ZAC2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAC2"
FT                   /protein_id="AAM83935.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSAVVKAVQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFE
FT                   NAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKEKFMDSLQAGDLGKSIPGSAVDNAQ
FT                   LRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
FT   gene            383491..383691
FT                   /locus_tag="y0346"
FT   CDS_pept        383491..383691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0346"
FT                   /product="hypothetical"
FT                   /note="residues 15 to 60 of 66 are 34.78 pct identical to
FT                   residues 525 to 567 of 612 from GenPept : >gb|AAL32622.1|
FT                   (AY062544) Phospholipase like protein [Arabidopsis
FT                   thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83936"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BC12"
FT                   /protein_id="AAM83936.1"
FT                   /translation="MLYYEPEFLGSLRQEAYNTYEIAKTEREVAERNRVQKKPFGLFIE
FT                   EMTLQKTLTDSQVAETAAHII"
FT   gene            383887..385329
FT                   /locus_tag="y0347"
FT   CDS_pept        383887..385329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0347"
FT                   /product="hypothetical"
FT                   /note="residues 340 to 454 of 480 are 44.16 pct identical
FT                   to residues 257 to 376 of 386 from GenPept :
FT                   >emb|CAD16923.1| (AL646075) probable transmembrane protein
FT                   [Ralstonia solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83937"
FT                   /db_xref="GOA:Q8CLS4"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS4"
FT                   /protein_id="AAM83937.1"
FT                   /translation="MGLLMQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRIS
FT                   EEIAATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGS
FT                   AQYSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESS
FT                   ERPPGWNVSPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
FT                   TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGSTP
FT                   ATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKTTA
FT                   KGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERLEKI
FT                   LTNKLTATDIDKRFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKINEKTQP
FT                   LYTSEAEDAYIKAELKNSLGSK"
FT   gene            complement(386990..387808)
FT                   /locus_tag="y0348"
FT   CDS_pept        complement(386990..387808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0348"
FT                   /product="putative pilus chaperone, PapD family"
FT                   /function="putative factor; folding and ushering proteins:
FT                   Chaperones"
FT                   /note="pili assembly; residues 42 to 262 of 272 are 46.46
FT                   pct identical to residues 7 to 227 of 237 from GenPept :
FT                   >gb|AAG05520.1|AE004640_9 (AE004640) probable pili assembly
FT                   chaperone [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83938"
FT                   /db_xref="GOA:Q8D1L1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L1"
FT                   /protein_id="AAM83938.1"
FT                   /translation="MHMRKWLSVSNNIMLSRINRRLRGLLLLMTTCRVLTLPALTIGVL
FT                   IMSALATSAVASVIAERTRIVFSEGSTEESLQLVNSNSYPVAVQVWVDDGNLMATPDKA
FT                   VSPILVLPPVFRLQPQAQRSLRLILSGGSKLPADRESAFWLNIYEIPPKATPKSGDESF
FT                   VTLALRMQYKVFYRPKNLPAPGDILGKALTFSLERNGDSALIKVNNPTPYYASFAALTI
FT                   GSAEGPPEMVAPFSQLDFPLNRAPISDNKTVNFDLIDDLGNRNSFSHELK"
FT   gene            complement(387774..388946)
FT                   /locus_tag="y0349"
FT   CDS_pept        complement(387774..388946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="residues 2 to 390 of 390 are 45.88 pct identical to
FT                   residues 56 to 453 of 453 from GenPept :
FT                   >gb|AAG05519.1|AE004640_8 (AE004640) hypothetical protein
FT                   [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83939"
FT                   /db_xref="GOA:Q8D1L0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1L0"
FT                   /protein_id="AAM83939.1"
FT                   /translation="MGSRDDNNGSLNLPSIVDLSTNANFQPDGTLLASATSDFTTFAVN
FT                   TGYALDQVLFRCDAADVDQLYEMYATNGDSTYGGRYEDGTIAGNVSYGYATTVMNVVIR
FT                   FTNLATGEYYARIWKGRRLTGLDTDSSGRILVKAKNFSNVYTELFRIDYARSGANNTPS
FT                   YLYGRSQPNAYIAFKGPGITGPIEGTDSYSNWPGWYSTWPASLGLYKYVTFRRTTICAV
FT                   SNFTPTVVLPRISVAELNNGNTSSADFNVDFQCQTGINSGVTAGTVAMGFLVPAANAAK
FT                   AQALGLMNGNGGVSHLVSDNYGAAGTAGGVGIRIYRNNSPMYLLSKNVTQTGNNGGWYG
FT                   ILQGAQETTGSVDGGNSYTETFRAELSKISGQTVTAGAVNAHAQVVIRVQ"
FT   gene            complement(389158..391785)
FT                   /gene="fimD"
FT                   /locus_tag="y0350"
FT   CDS_pept        complement(389158..391785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimD"
FT                   /locus_tag="y0350"
FT                   /product="outer membrane usher protein FIMD precursor"
FT                   /function="membrane; cell envelope: outer membrane
FT                   constituents"
FT                   /note="fimbrial biogenesis; residues 31 to 874 of 875 are
FT                   46.38 pct identical to residues 25 to 860 of 872 from
FT                   GenPept : >gb|AAG05518.1|AE004640_7 (AE004640) probable
FT                   fimbrial biogenesis usher protein [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83940"
FT                   /db_xref="GOA:A0A3N4BVS3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BVS3"
FT                   /protein_id="AAM83940.1"
FT                   /translation="MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFDE
FT                   SLFLGTKYASGLTQLNKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPCLS
FT                   DELLTAAGVELGRENSTPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFDQAK
FT                   LRLELSIPQALLQKRPRGYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDFGFIG
FT                   LKSGINLGLWQVRQQSNVRYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGETFTDST
FT                   LFGSMSFLGAKMATDQRMWPVSMRGFSPEVRGVASTNARVIIRQNGREIYETNVAPGPF
FT                   VINDLFSTSSQGDLNVEVIEANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGESRDFTNI
FT                   DNYFTDFTYERGLTNQLTANSGVRLAKDYTALLAGGVLGTPVGALGLNATYSHAKVEND
FT                   KTQDGWRMQATYSQTFNQTGTTFSLAGYRYSTKGYRDLNDVFGVRSMQKNGGTWDSSTY
FT                   KQRSQFTTTINQDLGNWGQLYASASTSDYYNDTARDTQLQLGYSNSYQQISYNLAVSRQ
FT                   RSVYTSTLYNWDSPDTDETATTTRYGNTENIATFTVSIPLNIGSNNQYLSMSASRNPKS
FT                   GNNYQTSLSGTAGERNSFNYALNAGYDDSNFGSSSNNWGANVQKQFPNATVNGSYSRGN
FT                   NYTQYGAGARGAAVIHRQGVTLGPYLGETFGLIEANGAQGARIDSNGFALVPALTPYNY
FT                   NTIGLDTKGINRNTELKENQGRVVPYAGAAVKVKFETLTGYAVLIQAEGEGLPLGADVY
FT                   NSKDELVGMVGQGNQIYARIADNKGTLDVRWGESSGDQCQLPYAFNRQDTEQDIIHITA
FT                   SCRR"
FT   gene            complement(391813..392568)
FT                   /locus_tag="y0351"
FT   CDS_pept        complement(391813..392568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0351"
FT                   /product="chaperone"
FT                   /function="putative factor; folding and ushering proteins:
FT                   Chaperones"
FT                   /note="pilus assembly; residues 24 to 242 of 251 are 43.69
FT                   pct identical to residues 16 to 237 of 248 from GenPept :
FT                   >gb|AAG05517.1|AE004640_6 (AE004640) probable pili assembly
FT                   chaperone [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83941"
FT                   /db_xref="GOA:Q8D1K9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K9"
FT                   /protein_id="AAM83941.1"
FT                   /translation="MTSEGTLIMLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRII
FT                   YPAAASEHSIQLTNNDNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTL
FT                   RLKYTGSGLPTDRESVFYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQ
FT                   VSTALTFSLRKQGTNLVLTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVI
FT                   PNASVSSSATINFLIMNDFGGQDAGSYRI"
FT   gene            complement(392608..393138)
FT                   /locus_tag="y0352"
FT   CDS_pept        complement(392608..393138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0352"
FT                   /product="fimbrial protein (precursor)"
FT                   /function="structural component; cell exterior
FT                   constituents: surface structures"
FT                   /note="fimbrial biogenesis; residues 1 to 175 of 176 are
FT                   49.15 pct identical to residues 3 to 177 of 178 from
FT                   GenPept : >gb|AAL19294.1| (AE008710) putative fimbriae;
FT                   major subunit [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83942"
FT                   /db_xref="GOA:A0A3N4B6M6"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6M6"
FT                   /protein_id="AAM83942.1"
FT                   /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLE
FT                   ANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQ
FT                   NTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPG
FT                   SVIASVQYAVSYL"
FT   mobile_element  complement(393913..395227)
FT                   /mobile_element_type="insertion sequence:IS285"
FT                   /note="insertion element"
FT   gene            complement(393948..395156)
FT                   /locus_tag="y0353"
FT   CDS_pept        complement(393948..395156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0353"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="residues 1 to 402 of 402 are 100.00 pct identical to
FT                   residues 1 to 402 of 402 from GenPept : >gb|AAC13227.1|
FT                   (AF053947) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83943"
FT                   /db_xref="GOA:A0A384LDI8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDI8"
FT                   /protein_id="AAM83943.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(395253..396044)
FT                   /locus_tag="y0354"
FT   CDS_pept        complement(395253..396044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0354"
FT                   /product="glutamine cyclotransferase"
FT                   /function="enzyme; global regulatory functions"
FT                   /note="residues 8 to 258 of 263 are 39.45 pct identical to
FT                   residues 3 to 256 of 288 from GenPept : >gb|AAC27745.1|
FT                   (AF061240) glutamine cyclotransferase precursor [Carica
FT                   papaya]"
FT                   /db_xref="EnsemblGenomes-Gn:y0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83944"
FT                   /db_xref="GOA:A0A3N4BB24"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB24"
FT                   /protein_id="AAM83944.1"
FT                   /translation="MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPHD
FT                   ETSFTQGLVIDDGKLYETTGLYKNSKIRELDLTNGKVIRSVNLPDNIFGEGITKLGDSF
FT                   YVLTWKEKKAFVINPNDLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPADFSI
FT                   IKKISVTFDGRRIEKINELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGLQFML
FT                   DSVNRNTNTLNGIAYDKSKNKIYLTGKNWSNIFEVKFLTSK"
FT   gene            complement(396283..396579)
FT                   /gene="ppiC"
FT                   /locus_tag="y0355"
FT   CDS_pept        complement(396283..396579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="y0355"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /function="enzyme; proteins - translation and modification"
FT                   /note="rotamase C; residues 6 to 98 of 98 are 67.74 pct
FT                   identical to residues 1 to 93 of 93 from E. coli K12 :
FT                   B3775"
FT                   /db_xref="EnsemblGenomes-Gn:y0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83945"
FT                   /db_xref="GOA:Q8D1K8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K8"
FT                   /protein_id="AAM83945.1"
FT                   /translation="MVTVTMANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSN
FT                   CPSKRNGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRS"
FT   gene            396714..398789
FT                   /gene="rep"
FT                   /locus_tag="y0356"
FT   CDS_pept        396714..398789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="y0356"
FT                   /product="rep helicase, a single-stranded DNA dependent
FT                   ATPase"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 19 to 686 of 691 are 85.02 pct identical to
FT                   residues 1 to 668 of 673 from E. coli K12 : B3778; residues
FT                   19 to 686 of 691 are 85.32 pct identical to residues 1 to
FT                   668 of 673 from GenPept : >gb|AAG58972.1|AE005609_4
FT                   (AE005609) rep helicase, a single-stranded DNA dependent
FT                   ATPase [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83946"
FT                   /db_xref="GOA:Q8D1K7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K7"
FT                   /protein_id="AAM83946.1"
FT                   /translation="MAFWYNSLPRKPIEQPSVMRLNPSQQEAVEFVTGPCLVLAGAGSG
FT                   KTRVITNKIAHLIRQCGYQPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHT
FT                   LGLEIIKKEYVALGMKSNFSLFDAQDQMGLLKDLTHKWLEDDKTLLQQLVSAISNWKND
FT                   LLDPAAAAATARSERDKLFVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKNLEVRERW
FT                   QNRLRYLLVDEYQDTNTSQYQMVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLNE
FT                   DFPALRVIKLEQNYRSSGRILKAANILIANNPHVFEKKLFSELSYGDELKVITANNEDH
FT                   EAERVVGELIAHHFVKKTQYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRP
FT                   EIKDLLAYLRVLTNQDDDSAFLRIVNTPKREIGAATVQKLGEWANLRNKSLFRASFDLG
FT                   LGEHLKGRGLESLQRFTHWMDGIIRLVEREPVAAVRDLIHGIDYESWLFETAPSPKAAE
FT                   MRMKNVNLLFSWMTEMLEGSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLH
FT                   ASKGLEFPYVFLVGMEEGLLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQ
FT                   YGELIRPEPSRFLMELPQDDLNWENERKAVSPEERMQKGQSHLANLRAQLANAKKP"
FT   gene            complement(398790..398954)
FT                   /locus_tag="y0357"
FT   CDS_pept        complement(398790..398954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0357"
FT                   /product="hypothetical"
FT                   /note="residues 7 to 46 of 54 are 40.00 pct identical to
FT                   residues 1819 to 1858 of 2565 from GenPept :
FT                   >gb|AAL12620.1| (AY051318) Vitellin [Penaeus semisulcatus]"
FT                   /db_xref="EnsemblGenomes-Gn:y0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS3"
FT                   /protein_id="AAM83947.1"
FT                   /translation="MLVGITHSISATLKTSRLMVNQSRLNAWLTGNRLPVIIFTTVTAA
FT                   FRVNYGFSY"
FT   gene            complement(398957..400452)
FT                   /pseudo
FT                   /locus_tag="y0358"
FT                   /note="gppA; disrupted by frameshift"
FT   gene            complement(400456..401742)
FT                   /gene="rhlB"
FT                   /locus_tag="y0359"
FT   CDS_pept        complement(400456..401742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="y0359"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="residues 1 to 428 of 428 are 88.78 pct identical to
FT                   residues 1 to 421 of 421 from E. coli K12 : B3780"
FT                   /db_xref="EnsemblGenomes-Gn:y0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83948"
FT                   /db_xref="GOA:Q8ZAD8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAD8"
FT                   /protein_id="AAM83948.1"
FT                   /translation="MSKTHLTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTLS
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHSDA
FT                   ESLSQVTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PLQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTDLPAPKRL
FT                   ARTRTGNGPRRNSAPRRSGAPRNNRKRPG"
FT   gene            401861..402187
FT                   /gene="trxA"
FT                   /locus_tag="y0360"
FT   CDS_pept        401861..402187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="y0360"
FT                   /product="thioredoxin 1"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thioredoxin, glutaredoxin, glutathione"
FT                   /note="residues 1 to 108 of 108 are 87.03 pct identical to
FT                   residues 19 to 126 of 127 from E. coli K12 : B3781;
FT                   residues 1 to 108 of 108 are 87.03 pct identical to
FT                   residues 1 to 108 of 109 from GenPept : >gb|AAC40210.1|
FT                   (AF044308) Escherichia coli thioredoxin [Cloning vector
FT                   pBIOTRX-BirA]"
FT                   /db_xref="EnsemblGenomes-Gn:y0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83949"
FT                   /db_xref="GOA:A0A3N4BVQ9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BVQ9"
FT                   /protein_id="AAM83949.1"
FT                   /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDE
FT                   IAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKAFL
FT                   DANL"
FT   gene            402667..403926
FT                   /gene="rho"
FT                   /locus_tag="y0361"
FT   CDS_pept        402667..403926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="y0361"
FT                   /product="transcription termination factor Rho; polarity
FT                   suppressor"
FT                   /function="factor; RNA synthesis, modification, DNA
FT                   transcription"
FT                   /note="residues 1 to 419 of 419 are 95.22 pct identical to
FT                   residues 1 to 419 of 419 from E. coli K12 : B3783"
FT                   /db_xref="EnsemblGenomes-Gn:y0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83950"
FT                   /db_xref="GOA:A0A2S9PGX2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PGX2"
FT                   /protein_id="AAM83950.1"
FT                   /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTDELQKMWILRRILHPMGEIDAMEFL
FT                   ISKLATAKTNDQFFDNMRRS"
FT   gene            404461..405558
FT                   /gene="rfe"
FT                   /locus_tag="y0362"
FT   CDS_pept        404461..405558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="y0362"
FT                   /product="UDP-GlcNAc:undecaprenylphosphate
FT                   GlcNAc-1-phosphate transferase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   residues 1 to 357 of 365 are 80.95 pct identical to
FT                   residues 1 to 357 of 367 from E. coli K12 : B3784; residues
FT                   1 to 357 of 365 are 81.23 pct identical to residues 1 to
FT                   357 of 367 from GenPept : >gb|AAG58979.1|AE005610_3
FT                   (AE005610) UDP-GlcNAc:undecaprenylphosphate
FT                   GlcNAc-1-phosphate transferase; synthesis of
FT                   enterobacterial common antigen (ECA) [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83951"
FT                   /db_xref="GOA:Q8ZAE1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAE1"
FT                   /protein_id="AAM83951.1"
FT                   /translation="MNLLTMSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVFAGVCFAFLITNQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAFVQ
FT                   ALVGIAMMAVAGLYLRSLGHAFGPWEMVLGPFGYVVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVSFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGLLGRRYKVFMGDAGSTL
FT                   IGFTAIWILLQATQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLLYGYCIKR
FT                   AWRVARFIKRFKRRMRRASKNKHES"
FT   gene            405576..406655
FT                   /gene="wzzE"
FT                   /locus_tag="y0363"
FT   CDS_pept        405576..406655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzzE"
FT                   /locus_tag="y0363"
FT                   /product="putative transport protein"
FT                   /function="putative transport"
FT                   /note="residues 22 to 357 of 359 are 68.15 pct identical to
FT                   residues 15 to 349 of 349 from E. coli K12 : B3785"
FT                   /db_xref="EnsemblGenomes-Gn:y0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83952"
FT                   /db_xref="GOA:Q8D1K6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K6"
FT                   /protein_id="AAM83952.1"
FT                   /translation="MMKPESMSTDKTGSTNNEPSVDNELDIRGLCRTLWRGKVWIIGMA
FT                   IIFAAIALGVSYLVKQQWSATAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQPG
FT                   ISDEAYGEFITQLAAYDTRRDFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARDDK
FT                   KIPNDSIKLTAETASDANKLLRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVKRQE
FT                   AVAQAVFDREVAAVKQALKVAGQQGITSSQTDTPAEQLADSKMFMLGKPMLEARLETLL
FT                   ATGPSFDIDYDQNRAMLATLNVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLLIMWGA
FT                   IGALVGAGVVLVRRSSKAL"
FT   gene            406882..408066
FT                   /gene="wecB"
FT                   /locus_tag="y0364"
FT   CDS_pept        406882..408066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="y0364"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   residues 15 to 394 of 394 are 78.15 pct identical to
FT                   residues 11 to 389 of 389 from E. coli K12 : B3786;
FT                   residues 15 to 394 of 394 are 78.42 pct identical to
FT                   residues 11 to 390 of 390 from GenPept :
FT                   >gb|AAG58981.1|AE005610_5 (AE005610) UDP-N-acetyl
FT                   glucosamine -2-epimerase; synthesis of enterobacterial
FT                   common antigen (ECA) [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83953"
FT                   /db_xref="GOA:Q8ZAE3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAE3"
FT                   /protein_id="AAM83953.1"
FT                   /translation="MRPTCRHCLRLTDLKRFTVKVLTVFGTRPEAIKMAPLVHALAQDD
FT                   AFESRVCVTAQHREMLDQVLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFK
FT                   PDVILVHGDTTTTLSASLAGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYH
FT                   FAPTENSRQNLLREWVPENRIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTN
FT                   KKMILVTGHRRESFGGGFERICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGID
FT                   NIILIDPQDYLPFVYLMNHAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTV
FT                   LLVGTNINKIVDAVTRLLTDETAYHQMTRAHNPYGDGYACQRILKALKNHQVTL"
FT   gene            408063..409325
FT                   /gene="wecC"
FT                   /locus_tag="y0365"
FT   CDS_pept        408063..409325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecC"
FT                   /locus_tag="y0365"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   residues 1 to 420 of 420 are 82.14 pct identical to
FT                   residues 1 to 420 of 420 from E. coli K12 : B3787; residues
FT                   1 to 420 of 420 are 83.57 pct identical to residues 1 to
FT                   420 of 420 from GenPept : >emb|CAD09395.1| (AL627279)
FT                   UDP-ManNAc dehydrogenase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83954"
FT                   /db_xref="GOA:Q8ZAE4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAE4"
FT                   /protein_id="AAM83954.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINRG
FT                   AIHIVEPDLDKVVKIAVEGGYLQAVTKPQAADAFLIAVPTPFKGDHEPDMIFVESAAKS
FT                   IAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPERVLP
FT                   GQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAAVADCLAASDKRASEVKIACFGLAFKPDIDDLRES
FT                   PAVGVARLIAEWHVGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVMLVDHKQF
FT                   KAIKPEDIKQQWIVDTKGVWR"
FT   gene            409316..410389
FT                   /gene="rffG"
FT                   /locus_tag="y0366"
FT   CDS_pept        409316..410389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffG"
FT                   /locus_tag="y0366"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="residues 3 to 355 of 357 are 82.15 pct identical to
FT                   residues 1 to 353 of 355 from E. coli K12 : B3788; residues
FT                   1 to 357 of 357 are 85.43 pct identical to residues 1 to
FT                   357 of 357 from GenPept : >gb|AAC12869.1| (AF044332)
FT                   dTDP-D-glucose-4,6-dehydratase; RffG [Pectobacterium
FT                   carotovorum subsp. atrosepticum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83955"
FT                   /db_xref="GOA:Q8D1K5"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K5"
FT                   /protein_id="AAM83955.1"
FT                   /translation="MALRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLES
FT                   LSVVAGSERYAFEQVDICDSSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNV
FT                   VGTYTLLEAARHYWQQLSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYS
FT                   ASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNG
FT                   AQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPAKPA
FT                   GIAHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNNESWW
FT                   RRVQDGSYAGERLGLSD"
FT   gene            410474..411565
FT                   /gene="rffH"
FT                   /locus_tag="y0367"
FT   CDS_pept        410474..411565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffH"
FT                   /locus_tag="y0367"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="residues 71 to 363 of 363 are 86.68 pct identical to
FT                   residues 1 to 293 of 293 from E. coli K12 : B3789"
FT                   /db_xref="EnsemblGenomes-Gn:y0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83956"
FT                   /db_xref="GOA:Q8D1K4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K4"
FT                   /protein_id="AAM83956.1"
FT                   /translation="MLAAFLHLEIYSVYRWATYERHQSRLIIGMASSSRLHDVLPVYSL
FT                   CLMVSGDGMYQEIVCIRRLHVSGERMKGIILAGGSGSRLHPITRGVSKQLLPIYDKPMI
FT                   YYPLSVLMLAGIRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIG
FT                   EAFIDNEPCCLVLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVVEFDDNF
FT                   RALSIEEKPSQPKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYLDRGELT
FT                   VELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDDGVKRAA
FT                   TALAKTGYGKYLLDLLHARPRQY"
FT   gene            411486..412280
FT                   /gene="wecD"
FT                   /locus_tag="y0368"
FT   CDS_pept        411486..412280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="y0368"
FT                   /product="hypothetical protein"
FT                   /note="residues 63 to 263 of 264 are 49.25 pct identical to
FT                   residues 1 to 181 of 181 from E. coli K12 : B3790"
FT                   /db_xref="EnsemblGenomes-Gn:y0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83957"
FT                   /db_xref="GOA:Q8D1K3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K3"
FT                   /protein_id="AAM83957.1"
FT                   /translation="MRQPRWRKPVMANICWIYYMPVHASIEPLGWESEFFQRQSAKLIF
FT                   SDSAPPLNPAELAAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGT
FT                   ENATSEPNMGAYSLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKA
FT                   VLGTFDHQCLLVLDPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQ
FT                   WCQHHGLHRLRVATQMSNIAALRLYIRSGASIESTAYWLCRG"
FT   gene            412207..413412
FT                   /gene="wecE"
FT                   /locus_tag="y0369"
FT   CDS_pept        412207..413412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecE"
FT                   /locus_tag="y0369"
FT                   /product="putative regulator"
FT                   /function="putative regulator"
FT                   /note="residues 26 to 400 of 401 are 84.79 pct identical to
FT                   residues 1 to 375 of 376 from E. coli K12 : B3791"
FT                   /db_xref="EnsemblGenomes-Gn:y0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83958"
FT                   /db_xref="GOA:Q8D1K2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K2"
FT                   /protein_id="AAM83958.1"
FT                   /translation="MLLYVSIFVVVPPLRVPRIGYAGDEMIPFNTPPIVGTELGYMQAA
FT                   MSSGKLCGDGGFTRRCQQWMEKRFNCPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSF
FT                   TFVSTANAFVLRGAKMVFVDIRPDTMNIDETKIEAAITDKTRVIVPVHYAGVACEMDTI
FT                   MALAKKHNLFVVEDAAQGVMSTYKGKALGTIGHIGCFSFHETKNYTAGGEGGATLINDP
FT                   SLIDRAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQAAYLWGQLEAAEQINER
FT                   RLALWHGYYNAFKPLADAGRIDLPVIPGNVVQNAHMFYIKLRDIEERSAFISYLKEADI
FT                   MAVFHYIPLHACPAGEAFGRMAGEDRFTSKESERLVRLPIFYNLTDVNQSTVINTVLSF
FT                   FV"
FT   gene            413414..414670
FT                   /gene="wzxE"
FT                   /locus_tag="y0370"
FT   CDS_pept        413414..414670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzxE"
FT                   /locus_tag="y0370"
FT                   /product="putative cytochrome"
FT                   /function="putative carrier"
FT                   /note="residues 1 to 416 of 418 are 75.00 pct identical to
FT                   residues 1 to 416 of 416 from E. coli K12 : B3792; residues
FT                   1 to 416 of 418 are 75.00 pct identical to residues 1 to
FT                   416 of 416 from GenPept : >emb|CAD09390.1| (AL627279)
FT                   putative lipopolysaccharide biosynthesis protein
FT                   [Salmonella enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83959"
FT                   /db_xref="GOA:A0A3N4B6K8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6K8"
FT                   /protein_id="AAM83959.1"
FT                   /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFRQ
FT                   LIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAAKP
FT                   VSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGVVAY
FT                   YICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLGKFTL
FT                   MALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKDKGAISREIFRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLFAWQLVG
FT                   DVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQAYMATYI
FT                   VYFALCSCAFLVYRRHSAP"
FT   gene            414693..415778
FT                   /gene="wecF"
FT                   /locus_tag="y0371"
FT   CDS_pept        414693..415778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /locus_tag="y0371"
FT                   /product="TDP-Fuc4NAc:lipid II Fuc4NAc transferase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   similar to B3793 in E. coli K-12; residues 1 to 359 of 361
FT                   are 64.90 pct identical to residues 1 to 357 of 359 from
FT                   GenPept : >emb|CAD09389.1| (AL627279) conserved
FT                   hypothetical protein [Salmonella enterica subsp. enterica
FT                   serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83960"
FT                   /db_xref="GOA:Q8ZAF0"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAF0"
FT                   /protein_id="AAM83960.1"
FT                   /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAKE
FT                   TAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNVTLWLALLSGKIKPG
FT                   QVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPASLL
FT                   YFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVIIPMG
FT                   YPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPMIREAQRQLAGLDKQAIAF
FT                   FNPNYIEGWKQALALAAGEHP"
FT   gene            415775..417139
FT                   /gene="wecF"
FT                   /locus_tag="y0372"
FT   CDS_pept        415775..417139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /locus_tag="y0372"
FT                   /product="TDP-Fuc4NAc:lipidII transferase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   residues 1 to 444 of 454 are 77.97 pct identical to
FT                   residues 1 to 445 of 450 from E. coli K12 : B3793; residues
FT                   1 to 444 of 454 are 77.97 pct identical to residues 1 to
FT                   445 of 450 from GenPept : >gb|AAG58989.1|AE005610_13
FT                   (AE005610) TDP-Fuc4NAc:lipidII transferase; synthesis of
FT                   enterobacterial common antigen (ECA) [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83961"
FT                   /db_xref="GOA:Q8ZAF1"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAF1"
FT                   /protein_id="AAM83961.1"
FT                   /translation="MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYLL
FT                   TFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRTPI
FT                   FTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRFFYF
FT                   FIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGW
FT                   ITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNY
FT                   DKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTWDVLDNHSGLAISPTLIGSL
FT                   VVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFNIIVLARE
FT                   GLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTPNAGNQL"
FT   gene            417148..417888
FT                   /gene="wecG"
FT                   /locus_tag="y0373"
FT   CDS_pept        417148..417888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecG"
FT                   /locus_tag="y0373"
FT                   /product="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Sugar-nucleotide biosynthesis, conversions"
FT                   /note="synthesis of enterobacterial common antigen (ECA);
FT                   residues 1 to 246 of 246 are 70.73 pct identical to
FT                   residues 1 to 246 of 246 from E. coli K12 : B3794"
FT                   /db_xref="EnsemblGenomes-Gn:y0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83962"
FT                   /db_xref="GOA:Q8ZAF2"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAF2"
FT                   /protein_id="AAM83962.1"
FT                   /translation="MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAMN
FT                   AEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQRA
FT                   GQQGTPVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASGAAI
FT                   VTVAMGSPKQEIFMRDCRKFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
FT                   AQPSRIRRQLKLLKFVGYYYSGRL"
FT   gene            complement(418178..418261)
FT                   /locus_tag="y0374"
FT   CDS_pept        complement(418178..418261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0374"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83963"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS2"
FT                   /protein_id="AAM83963.1"
FT                   /translation="MNEGLTAPRGTPVAYATTTPTARFPFN"
FT   gene            418412..419803
FT                   /locus_tag="y0375"
FT   CDS_pept        418412..419803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0375"
FT                   /product="putative amino acid/amine symporter"
FT                   /function="putative transport"
FT                   /note="residues 1 to 454 of 463 are 79.73 pct identical to
FT                   residues 1 to 452 of 461 from E. coli K12 : B3795; residues
FT                   1 to 454 of 463 are 80.39 pct identical to residues 1 to
FT                   452 of 461 from GenPept : >gb|AAG58991.1|AE005611_1
FT                   (AE005611) putative amino acid/amine transport protein
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83964"
FT                   /db_xref="GOA:A0A3N4B6L2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6L2"
FT                   /protein_id="AAM83964.1"
FT                   /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGVELVG
FT                   ITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLTFAKIG
FT                   IVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVPVYCIAI
FT                   TILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHKAALQQHP
FT                   FKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVLGMHKPKAM
FT                   EAERL"
FT   gene            419952..420025
FT                   /locus_tag="yt006"
FT   tRNA            419952..420025
FT                   /locus_tag="yt006"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: CCG"
FT   gene            420112..420184
FT                   /locus_tag="yt007"
FT   tRNA            420112..420184
FT                   /locus_tag="yt007"
FT                   /product="tRNA-His"
FT                   /note="anticodon: GTG"
FT   gene            420204..420287
FT                   /locus_tag="yt008"
FT   tRNA            420204..420287
FT                   /locus_tag="yt008"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: CAG"
FT   gene            complement(420253..420741)
FT                   /locus_tag="y0376"
FT   CDS_pept        complement(420253..420741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0376"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:y0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS1"
FT                   /protein_id="AAM83965.1"
FT                   /translation="MIFNIFFNELNVTFSRQCDRLLSWKTNTDAQHNETAQLTVLAAEC
FT                   DQRELIMEVINKVPVARRIRRIKGGKLQVGLSVWQNRIIIFRRKKTPHCGVSSEIGRRE
FT                   RIRTSDPLVPNQLRYQAALLADFLLLTLHGLSTYVHVNINKYLHVCVVRREGLEPSRP"
FT   gene            420366..420439
FT                   /locus_tag="yt009"
FT   tRNA            420366..420439
FT                   /locus_tag="yt009"
FT                   /product="tRNA-Pro"
FT                   /note="anticodon: TGG"
FT   mobile_element  421164..421873
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            421258..421767
FT                   /locus_tag="y0377"
FT   CDS_pept        421258..421767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0377"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 100.00 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83966"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAM83966.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(421960..423180)
FT                   /gene="hemY"
FT                   /locus_tag="y0378"
FT   CDS_pept        complement(421960..423180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="y0378"
FT                   /product="hemY protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="a late step of protoheme IX synthesis; residues 1 to
FT                   395 of 406 are 70.63 pct identical to residues 1 to 395 of
FT                   398 from E. coli K12 : B3802"
FT                   /db_xref="EnsemblGenomes-Gn:y0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83967"
FT                   /db_xref="GOA:A0A2S9PD75"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PD75"
FT                   /protein_id="AAM83967.1"
FT                   /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGLA
FT                   IMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQVE
FT                   KLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRVRIQ
FT                   LAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQIHTPE
FT                   EVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDHDV
FT                   AQKIILDSLKHQYDERLALLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLK
FT                   HGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESS
FT                   ALTKLIH"
FT   gene            complement(423183..424316)
FT                   /gene="hemX"
FT                   /locus_tag="y0379"
FT   CDS_pept        complement(423183..424316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="y0379"
FT                   /product="uroporphyrinogen III methylase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="residues 4 to 369 of 377 are 68.11 pct identical to
FT                   residues 1 to 367 of 393 from E. coli K12 : B3803"
FT                   /db_xref="EnsemblGenomes-Gn:y0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83968"
FT                   /db_xref="GOA:Q8D1K1"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1K1"
FT                   /protein_id="AAM83968.1"
FT                   /translation="MPNMTEQNTPSAPVEEPTTAVERPQQPEPKGHREKRTGPILGVIA
FT                   IALVIALGAGLYYHGQQQAQLQSAENIALQEQLVALKQTLLQEKQQLESLLQQQGKALE
FT                   SAENQQASLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAVTL
FT                   LKSADASLADMNDPSLIDVRRAITEDISALSAVSQVDFDGIILKLNQLSNQVDNLRLAD
FT                   NNIDDSPMDANSDELSSSLSEWRQNLSKSWHSFMSDFISIRRRDSSAEPLLAPNQDVYL
FT                   RENIRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPSTKAFLDELENLSQQP
FT                   ISMDVPDQLKSQPILEKLMQTRVRNLLAQTPVDAQGE"
FT   gene            complement(424338..425087)
FT                   /gene="hemD"
FT                   /locus_tag="y0380"
FT   CDS_pept        complement(424338..425087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="y0380"
FT                   /product="uroporphyrinogen III synthase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="residues 1 to 246 of 249 are 60.97 pct identical to
FT                   residues 1 to 246 of 246 from E. coli K12 : B3804"
FT                   /db_xref="EnsemblGenomes-Gn:y0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83969"
FT                   /db_xref="GOA:A0A3N4B9I4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9I4"
FT                   /protein_id="AAM83969.1"
FT                   /translation="MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPE
FT                   LLQDMQAGDLVFALSQNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVT
FT                   FPPMGETSEMLLSLPLLQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPI
FT                   YYDGSEQSAHWQRAGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALA
FT                   TQMGWTEVRVAENADNDALIRALQDLQ"
FT   gene            complement(425084..426193)
FT                   /gene="hemC"
FT                   /locus_tag="y0381"
FT   CDS_pept        complement(425084..426193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="y0381"
FT                   /product="porphobilinogen deaminase; hydroxymethylbilane
FT                   synthase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="residues 53 to 363 of 369 are 80.70 pct identical to
FT                   residues 4 to 314 of 320 from E. coli K12 : B3805; residues
FT                   53 to 363 of 369 are 81.35 pct identical to residues 4 to
FT                   314 of 320 from GenPept : >gb|AAG58997.1|AE005611_7
FT                   (AE005611) porphobilinogen deaminase = hydroxymethylbilane
FT                   synthase [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83970"
FT                   /db_xref="GOA:P46355"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46355"
FT                   /protein_id="AAM83970.1"
FT                   /translation="MLQTYICCSHASITIVVFIATVVFLGIYPPCSYGYYTDSVHRSVI
FT                   GWAVKYKTVTSMLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTRGDII
FT                   LDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDA
FT                   FVSSHYAHLDDLPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQA
FT                   IILAVAGLKRLGLENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTE
FT                   LRVCAERAMNIRLEGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAE
FT                   QMGIELADELLSRGAREILAAVYLDNPAR"
FT   gene            426519..429071
FT                   /gene="cyaA"
FT                   /locus_tag="y0382"
FT   CDS_pept        426519..429071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="y0382"
FT                   /product="adenylate cyclase"
FT                   /function="enzyme; global regulatory functions"
FT                   /note="residues 1 to 831 of 850 are 83.75 pct identical to
FT                   residues 1 to 831 of 848 from E. coli K12 : B3806; residues
FT                   1 to 850 of 850 are 99.41 pct identical to residues 1 to
FT                   850 of 850 from GenPept : >gb|AAC44324.1| (U22968)
FT                   adenylate cyclase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83971"
FT                   /db_xref="GOA:P40127"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40127"
FT                   /protein_id="AAM83971.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPILLHCH
FT                   HPQMPGYLDGNVPHGVCLFTPNEIQQDYLADVEARWGEPLAPSAGGELPITGVYSMGST
FT                   SSIGQCHTSDLDIWVCHQAWLDTEERNQLQQKCSLLEKWAASMGVEVSFFLVDENRFRH
FT                   NASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVKEEEHYDDYVLSLYAQG
FT                   VLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNSQLL
FT                   AMEIKQHLHAGEIVSFGLDAYCMMLDRVTRYLIQINDTTRLNLVRRCFYLKVCEKLSRT
FT                   PASTGWRREVLSQLVSEWGWSNEKLAVLDNRANWKIERVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLTFIHVPAGR
FT                   ANRPGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLHIKSANLCDT
FT                   VKLQELVTDISHHFPLRLAAPTPKALYSPCEIRHLAIIVNLEHDPTTTFRNQVVHFDFR
FT                   KLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPE
FT                   SVDVFCYSQHLRGLIRTRIQQLVSECIDLRLSSTRQEPGRFKAVRVSGQTWGLFFERLS
FT                   VSVQKLENAVEFYGAISNNKLHGLSVQVETNQIHLPPVVDGFASEGIIQFFFEGTADEK
FT                   GFNIYILDEANRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNTLSQLCANIAEKEASLPTKQCQLH"
FT   gene            complement(429315..429641)
FT                   /gene="cyaY"
FT                   /locus_tag="y0383"
FT   CDS_pept        complement(429315..429641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="y0383"
FT                   /product="hypothetical protein"
FT                   /note="residues 3 to 107 of 108 are 71.42 pct identical to
FT                   residues 1 to 105 of 106 from E. coli K12 : B3807; residues
FT                   3 to 108 of 108 are 100.00 pct identical to residues 1 to
FT                   106 of 106 from GenPept : >gb|AAC44325.1| (U22968) CyaY
FT                   [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83972"
FT                   /db_xref="GOA:P46356"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46356"
FT                   /protein_id="AAM83972.1"
FT                   /translation="MNMNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTF
FT                   ENGSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGEN
FT                   VSFG"
FT   gene            429787..429975
FT                   /locus_tag="y0384"
FT   CDS_pept        429787..429975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0384"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 52 of 62 are 42.30 pct identical to
FT                   residues 1 to 49 of 67 from GenPept : >gb|AAL22790.1|
FT                   (AE008884) putative outer membrane lipoprotein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83973"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6K7"
FT                   /protein_id="AAM83973.1"
FT                   /translation="MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKAPVDAAPQVEKN
FT                   QQDLSATPQTPSTAESQ"
FT   gene            430159..430983
FT                   /gene="dapF"
FT                   /locus_tag="y0385"
FT   CDS_pept        430159..430983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="y0385"
FT                   /product="diaminopimelate epimerase"
FT                   /function="enzyme; amino acid biosynthesis: Lysine"
FT                   /note="residues 1 to 274 of 274 are 85.03 pct identical to
FT                   residues 2 to 275 of 275 from E. coli K12 : B3809"
FT                   /db_xref="EnsemblGenomes-Gn:y0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83974"
FT                   /db_xref="GOA:P46357"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46357"
FT                   /protein_id="AAM83974.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQM
FT                   LVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRM
FT                   ILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHCVMQ
FT                   VDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGVVQDLLNENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL"
FT   gene            431048..431752
FT                   /locus_tag="y0386"
FT   CDS_pept        431048..431752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0386"
FT                   /product="hypothetical protein"
FT                   /note="residues 13 to 234 of 234 are 67.56 pct identical to
FT                   residues 14 to 235 of 235 from E. coli K12 : B3810"
FT                   /db_xref="EnsemblGenomes-Gn:y0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83975"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKT6"
FT                   /protein_id="AAM83975.1"
FT                   /translation="MKNYEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPHP
FT                   VRGSVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFSRLLQLQANLAAADSLQDM
FT                   LNRLQRWARDFGLAGANIRLFSDRWQIGAPSDFTHLALSRHAFEPLRIQRLGNRHHYLG
FT                   SLNGPELLLLLPQAKLVGSVALSLLGADGDLGVVIFSSRDAQHYQQGMGTVMLNQLSTL
FT                   LPGLLARWIEPV"
FT   gene            431734..432660
FT                   /gene="xerC"
FT                   /locus_tag="y0387"
FT   CDS_pept        431734..432660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="y0387"
FT                   /product="site-specific recombinase"
FT                   /function="enzyme; cell division"
FT                   /note="acts on cer sequence of ColE1, effects chromosome
FT                   segregation at cell division; residues 13 to 307 of 308 are
FT                   72.88 pct identical to residues 4 to 298 of 298 from E.
FT                   coli K12 : B3811; residues 6 to 308 of 308 are 80.52 pct
FT                   identical to residues 1 to 303 of 303 from GenPept :
FT                   >gb|AAC46276.1| (AF028736) site specific recombinase
FT                   [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83976"
FT                   /db_xref="GOA:Q8D1K0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1K0"
FT                   /protein_id="AAM83976.1"
FT                   /translation="MDRAGMTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSAL
FT                   MEIGEQMGLAHWQTLDAAQVRSLVSRSKRAGLHASSLALRLSALRSFLNWLVSQGVLPA
FT                   NPAKGVSTPRSGRHLPKNIDVDEVNKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVG
FT                   MNCKHVDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGK
FT                   RISARNVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTT
FT                   QIYTHLDFQHLATVYDAAHPRAKRGKS"
FT   gene            432660..433376
FT                   /locus_tag="y0388"
FT   CDS_pept        432660..433376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0388"
FT                   /product="putative phosphatase"
FT                   /note="residues 1 to 238 of 238 are 64.70 pct identical to
FT                   residues 1 to 238 of 238 from E. coli K12 : B3812; residues
FT                   1 to 238 of 238 are 76.05 pct identical to residues 1 to
FT                   238 of 238 from GenPept : >gb|AAC46277.1| (AF028736) No
FT                   definition line found [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83977"
FT                   /db_xref="GOA:A0A2S9PD39"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PD39"
FT                   /protein_id="AAM83977.1"
FT                   /translation="MHFYRPLERISAITFDLDDTLYDNRPVIARTEQQSVAFLQQYHPN
FT                   LALLQPADFQRLRAELLAQDPGIYHDVTQWRWQAIELGLMRHGLSKAEAQAGADAAMAN
FT                   FALWRSRIDVPQATHDTLSALAEHYPLVAITNGNADPKACGLDRYFQFVLRSGPHGRAK
FT                   PFRDMYHKAANHLDIPLKHILHVGDDLTTDVAGSLRCGMQACWINDRQQNLMTARDSRL
FT                   LPHIEISQLASLTALL"
FT   gene            433472..435640
FT                   /gene="uvrD"
FT                   /locus_tag="y0389"
FT   CDS_pept        433472..435640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="y0389"
FT                   /product="DNA-dependent ATPase I and helicase II"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 3 to 722 of 722 are 88.19 pct identical to
FT                   residues 1 to 720 of 720 from E. coli K12 : B3813; residues
FT                   3 to 722 of 722 are 92.36 pct identical to residues 1 to
FT                   720 of 720 from GenPept : >gb|AAC46278.1| (AF028736) DNA
FT                   helicase II [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83978"
FT                   /db_xref="GOA:Q8D1J9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J9"
FT                   /protein_id="AAM83978.1"
FT                   /translation="MPMDVSDLLDSLNEKQRDAVAAPRGNLLVLAGAGSGKTRVLVHRI
FT                   AWLLSVENASPYSIISVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHH
FT                   LDANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIES
FT                   YGNPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNILVD
FT                   EFQDTNNIQYAWIRLLAGERSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRL
FT                   EQNYRSTSIILAAANALIANNDGRMGKNLWTDGAEGEPISLYCAFNELDEARFVVNRIK
FT                   AWQDNGGALNDCAILYRSNAQSRVLEEALLQTATPYRIYGGQRFFDRQEIKDSLAYLRL
FT                   ISNRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQSTRAMLQEKVLAGRAAS
FT                   ALQRFVELIDSLARETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARIENLEELVTA
FT                   TRQYSYQDEDQDLMPLQAFLSHAALEAGDGQADAYQDAVQLMTLHSAKGLEFPQVFIVG
FT                   MEEGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLCYAESRRLYGKEVNHRPSRFI
FT                   GELPQECVEEVRLRASVSRPVNHRRMGTPMHENDSGFSLGQRVRHPKFGEGTIVNLEGS
FT                   GEHNRLQVAFPGEGIKWLVAAYARLEPV"
FT   gene            complement(435754..436440)
FT                   /locus_tag="y0390"
FT   CDS_pept        complement(435754..436440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0390"
FT                   /product="transcriptional regulator"
FT                   /function="regulator"
FT                   /note="residues 18 to 214 of 228 are 46.19 pct identical to
FT                   residues 27 to 213 of 219 from GenPept : >dbj|BAB50289.1|
FT                   (AP003001) transcriptional regulator [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83979"
FT                   /db_xref="GOA:A0A3N4B6J3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6J3"
FT                   /protein_id="AAM83979.1"
FT                   /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEVA
FT                   SAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRMLQ
FT                   HEGVLRAALHLSLQQWADARNSDSNNNSNDSNNSSNEEKLIRGNRKRLLKLAVEPLEET
FT                   LAPEALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAA
FT                   QDKTHS"
FT   gene            436868..438085
FT                   /locus_tag="y0391"
FT   CDS_pept        436868..438085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0391"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 401 of 405 are 55.75 pct identical to
FT                   residues 2 to 397 of 398 from GenPept : >gb|AAK65387.1|
FT                   (AE007260) conserved hypothetical protein [Sinorhizobium
FT                   meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83980"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAG3"
FT                   /protein_id="AAM83980.1"
FT                   /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQRD
FT                   SGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSGGT
FT                   ALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVLSNA
FT                   AHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATGSGGK
FT                   AMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGALDMVN
FT                   FGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRFLIPEGG
FT                   FSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAAIENFKEI
FT                   VNRPSH"
FT   gene            438099..438941
FT                   /locus_tag="y0392"
FT   CDS_pept        438099..438941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0392"
FT                   /product="hypothetical"
FT                   /note="residues 5 to 276 of 280 are 71.69 pct identical to
FT                   residues 1 to 272 of 280 from GenPept : >gb|AAK65386.1|
FT                   (AE007260) conserved hypothetical protein [Sinorhizobium
FT                   meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83981"
FT                   /db_xref="GOA:A0A0H2W793"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W793"
FT                   /protein_id="AAM83981.1"
FT                   /translation="MEKHMPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAGG
FT                   IDLIVIYNSGRYRMAGRGSLAGLLAYGNANDIVVDMAKEVLPVVKNTPVLAGVNGTDPF
FT                   CQFDHFLDHLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVEMIRLAHQKDLLT
FT                   TPYVFSAEDAIAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINDWAAAAKSVR
FT                   EEVIVLCHGGPISTPEDAQYIMDHCPQCDGFYGASSMERLPTEIALTDTTQKFKNITR"
FT   gene            439542..440540
FT                   /gene="corA"
FT                   /locus_tag="y0393"
FT   CDS_pept        439542..440540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="y0393"
FT                   /product="magnesium and cobalt permease"
FT                   /function="transport; transport of small molecules;
FT                   cations"
FT                   /note="residues 17 to 332 of 332 are 88.29 pct identical to
FT                   residues 1 to 316 of 316 from E. coli K12 : B3816"
FT                   /db_xref="EnsemblGenomes-Gn:y0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83982"
FT                   /db_xref="GOA:Q8ZAG5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAG5"
FT                   /protein_id="AAM83982.1"
FT                   /translation="MLQCVSLSITAREFWHMLSAFKLHNNRLSRLELDESDDLASSLWV
FT                   DLVEPEEGERERVQTELGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAG
FT                   NSTVAFTIRDGRLYTLRERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADE
FT                   IENIYSDLEALSRVIMEGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKA
FT                   RLPSSQLEQAREVLRDIESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVV
FT                   FLPPTLVASSYGMNFEFMPELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL"
FT   gene            complement(440638..441597)
FT                   /gene="rarD"
FT                   /locus_tag="y0394"
FT   CDS_pept        complement(440638..441597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="y0394"
FT                   /product="hypothetical protein"
FT                   /note="residues 41 to 316 of 319 are 69.92 pct identical to
FT                   residues 22 to 297 of 300 from E. coli K12 : B3819;
FT                   residues 24 to 316 of 319 are 75.76 pct identical to
FT                   residues 1 to 293 of 294 from GenPept : >gb|AAL22799.1|
FT                   (AE008884) chloramphenicol resistance [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83983"
FT                   /db_xref="GOA:Q8D1J7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J7"
FT                   /protein_id="AAM83983.1"
FT                   /translation="MIRHAKLSTLTASPFLYSVPSHSMDKQQTRQGIFFALAAYFIWGL
FT                   APAYFKLIQQVPADEILTHRVIWSFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAV
FT                   LIASNWLLFIWAVNHNHMLEASLGYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGV
FT                   LIQLWQFGSLPVIGLGLAITFALYGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIAD
FT                   SPTSHLSANAWSLNLLLAAAGVITTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAV
FT                   TFYGETIGNDKMVTFIFIWAALLLFTLDALYTQRKLRR"
FT   gene            complement(441615..442085)
FT                   /locus_tag="y0395"
FT   CDS_pept        complement(441615..442085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0395"
FT                   /product="hypothetical protein"
FT                   /note="residues 6 to 156 of 156 are 66.88 pct identical to
FT                   residues 11 to 161 of 161 from E. coli K12 : B3820"
FT                   /db_xref="EnsemblGenomes-Gn:y0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83984"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB23"
FT                   /protein_id="AAM83984.1"
FT                   /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEITF
FT                   DNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGTID
FT                   LRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
FT   gene            442307..443185
FT                   /gene="pldA"
FT                   /locus_tag="y0396"
FT   CDS_pept        442307..443185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="y0396"
FT                   /product="outer membrane phospholipase A"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Phosphorus compounds"
FT                   /note="residues 8 to 291 of 292 are 72.18 pct identical to
FT                   residues 8 to 288 of 289 from E. coli K12 : B3821; residues
FT                   1 to 292 of 292 are 100.00 pct identical to residues 1 to
FT                   292 of 292 from GenPept : >emb|CAB51586.1| (AJ245393)
FT                   phospholipase A [Yersinia pseudotuberculosis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83985"
FT                   /db_xref="GOA:A0A3N4BKS3"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKS3"
FT                   /protein_id="AAM83985.1"
FT                   /translation="MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQD
FT                   HDNPFLLYPYETNYLLYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGD
FT                   NSLLGASYTQRSWWQASNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQ
FT                   SNGKADPTSRSWNRVYTRVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKV
FT                   GYALGDSVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTR
FT                   VGVGIMLNDVL"
FT   gene            443263..445095
FT                   /gene="recQ"
FT                   /locus_tag="y0397"
FT   CDS_pept        443263..445095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="y0397"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="enzyme; DNA - replication, repair,
FT                   restriction/modification"
FT                   /note="residues 1 to 610 of 610 are 80.98 pct identical to
FT                   residues 3 to 609 of 610 from E. coli K12 : B3822; residues
FT                   1 to 610 of 610 are 80.98 pct identical to residues 1 to
FT                   608 of 609 from GenPept : >emb|CAD07934.1| (AL627278)
FT                   ATP-dependent DNA helicase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83986"
FT                   /db_xref="GOA:A0A2S9PD53"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PD53"
FT                   /protein_id="AAM83986.1"
FT                   /translation="MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCLV
FT                   VMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTREQQ
FT                   LAVMDGCRSGQIKLLYIAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRPEYR
FT                   ALGQLKQRFPDLPVIALTATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLVEKFK
FT                   PLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRAQVQEA
FT                   FQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPAEAVLLY
FT                   DPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKQQPCGN
FT                   CDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREMGHDKLSVY
FT                   GIGREQTHEHWVSVLRQLIHLGLLSQNIAQFSALQLTEAARPVLRAELPLQLAVPRIQS
FT                   LKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLLEMAEQMPITA
FT                   SELLSVNGVGQRKLERFGAPFMALIRDHVDNNDD"
FT   gene            445202..445822
FT                   /locus_tag="y0398"
FT   CDS_pept        445202..445822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0398"
FT                   /product="threonine efflux protein"
FT                   /function="putative transport"
FT                   /note="related threonine efflux protein RhtC; B3823 in E.
FT                   coli K-12; residues 1 to 206 of 206 are 72.33 pct identical
FT                   to residues 1 to 206 of 206 from GenPept : >emb|CAD07933.1|
FT                   (AL627278) threonine efflux protein [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83987"
FT                   /db_xref="GOA:A0A3N4B8F3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8F3"
FT                   /protein_id="AAM83987.1"
FT                   /translation="MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLGI
FT                   SLGIVIWAGVALMGLNLILQKMAWLHQIIMVGGGMYLCWMGWQLLKSARAKHDVAEEEV
FT                   QVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFVGDDVGAGARWGLFILIVGETFLW
FT                   FTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR"
FT   gene            complement(445873..446493)
FT                   /gene="rhtB"
FT                   /locus_tag="y0399"
FT   CDS_pept        complement(445873..446493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="y0399"
FT                   /product="putative homoserine/homoserine lactone efflux
FT                   protein"
FT                   /note="residues 69 to 204 of 206 are 75.73 pct identical to
FT                   residues 1 to 136 of 138 from E. coli K12 : B3824; residues
FT                   1 to 204 of 206 are 75.49 pct identical to residues 1 to
FT                   204 of 206 from GenPept : >dbj|BAB38177.1| (AP002567)
FT                   homoserine/homoserine lactone effulux protein [Escherichia
FT                   coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83988"
FT                   /db_xref="GOA:A0A3N4B9G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9G2"
FT                   /protein_id="AAM83988.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGG
FT                   LQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMI
FT                   GYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
FT   gene            446689..447702
FT                   /gene="pldB"
FT                   /locus_tag="y0400"
FT   CDS_pept        446689..447702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="y0400"
FT                   /product="lysophospholipase L(2)"
FT                   /function="enzyme; central intermediary metabolism:
FT                   Phosphorus compounds"
FT                   /note="residues 9 to 337 of 337 are 61.09 pct identical to
FT                   residues 7 to 335 of 340 from E. coli K12 : B3825; residues
FT                   9 to 337 of 337 are 61.39 pct identical to residues 7 to
FT                   335 of 340 from GenPept : >gb|AAG59021.1|AE005614_1
FT                   (AE005614) lysophospholipase L(2) [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83989"
FT                   /db_xref="GOA:A0A3N4B6I4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6I4"
FT                   /protein_id="AAM83989.1"
FT                   /translation="MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPI
FT                   RYVRFRAPHHTQVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDH
FT                   NRGHVIKFDDYIEDFAQLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVAL
FT                   CAPMFGIHLPLPGWLARRIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRR
FT                   YLRQYSDTPEIRVGGPTYHWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHD
FT                   AFSQAMTLAGHPCEGGRPQVIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH"
FT   gene            447608..448546
FT                   /locus_tag="y0401"
FT   CDS_pept        447608..448546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0401"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="residues 1 to 308 of 312 are 68.18 pct identical to
FT                   residues 1 to 304 of 305 from GenPept :
FT                   >gb|AAG59022.1|AE005614_2 (AE005614) Z5347 gene product
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83990"
FT                   /db_xref="GOA:Q8D1J6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J6"
FT                   /protein_id="AAM83990.1"
FT                   /translation="MRSCLSGTRCVPRRLAPYCAFSRNINHQSAIRRRRHQRLEHTIMY
FT                   HVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGRHHIDVAQIRDNLEISAF
FT                   MITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDILTNVYLGDEWFMNRECPEQ
FT                   EEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLILEEAINARWGDRVNVSFSFP
FT                   TCLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMNDVEMLSMSGKGCIMRDAHQRL
FT                   KDVLPNLEVIGSNADDAVPHYLRKMFLGKEE"
FT   gene            448811..450022
FT                   /locus_tag="y0402"
FT   CDS_pept        448811..450022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0402"
FT                   /product="hypothetical"
FT                   /note="residues 21 to 218 of 403 are 27.66 pct identical to
FT                   residues 186 to 369 of 777 from GenPept : >gb|AAF45496.1|
FT                   (AE003417) EG:125H10.1 gene product [Drosophila
FT                   melanogaster]"
FT                   /db_xref="EnsemblGenomes-Gn:y0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83991"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLS0"
FT                   /protein_id="AAM83991.1"
FT                   /translation="MELNMSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNK
FT                   LNSIADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKE
FT                   EKIELPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPT
FT                   DIIEADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDS
FT                   TTKLMVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDKQ
FT                   GHITFEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNSFI
FT                   MTSIGIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQNVV
FT                   SHVE"
FT   gene            complement(450096..451214)
FT                   /gene="glpQ"
FT                   /locus_tag="y0403"
FT   CDS_pept        complement(450096..451214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="y0403"
FT                   /product="periplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 6 to 368 of 372 are 73.55 pct identical to
FT                   residues 1 to 358 of 358 from E. coli K12 : B2239; residues
FT                   2 to 367 of 372 are 75.95 pct identical to residues 1 to
FT                   354 of 356 from GenPept : >gb|AAL21183.1| (AE008802)
FT                   glycerophosphodiester phosphodiesterase, periplasmic
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83992"
FT                   /db_xref="GOA:Q8D1J5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J5"
FT                   /protein_id="AAM83992.1"
FT                   /translation="MMQTHVKTLLASLILAASMAAPAYAAKPASADKSASAIDKVVIAH
FT                   RGASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPDR
FT                   ARKDGRYYAIDFTLPEIKSLKFTEGFDIDKNGKKVQSYPNRFPMGKSDFRVHTFQEEIE
FT                   FIQGLNHSTGKNTGIYPEIKAPWFHHQEGKDISTKVLEVLKEYGYTNKDDKVYLQSFDV
FT                   NELKRIKNELEPKMGMDLKLIQLIAYTDWNETYEQLPDGKWVNYNYDWMFKPGAMKEVA
FT                   HYADGIGPDYHMLVVKTSTAKDIKLTDLVKEAHASNMMVHPFTIRADRLPKYATDINQL
FT                   FDIIYNQAQVDGVFTDFPDQGIQFLQKQQQHK"
FT   gene            451836..453491
FT                   /gene="glpA"
FT                   /locus_tag="y0404"
FT   CDS_pept        451836..453491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="y0404"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), large subunit"
FT                   /function="enzyme; energy metabolism, carbon: Anaerobic
FT                   respiration"
FT                   /note="residues 10 to 537 of 551 are 77.84 pct identical to
FT                   residues 9 to 536 of 542 from E. coli K12 : B2241"
FT                   /db_xref="EnsemblGenomes-Gn:y0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83993"
FT                   /db_xref="GOA:A0A380PFS9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PFS9"
FT                   /protein_id="AAM83993.1"
FT                   /translation="MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAY
FT                   QLQFIARCRDAGIEAEAIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAR
FT                   EHGANILTYHEVIGLLRQGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYAD
FT                   LRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDN
FT                   MVVTAQEVDTLIREGAKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHA
FT                   SRDGVEGFITITGGKLMTYRLMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLS
FT                   KVISLPASIRGSAVYRHGDRATQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLL
FT                   DLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGD
FT                   ALRESEFTQWVYQGLCGLDEIPATVNAREKHDEI"
FT   gene            453463..454755
FT                   /gene="glpB"
FT                   /locus_tag="y0405"
FT   CDS_pept        453463..454755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="y0405"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), membrane anchor subunit"
FT                   /function="enzyme; energy metabolism, carbon: Anaerobic
FT                   respiration"
FT                   /note="residues 7 to 422 of 430 are 49.75 pct identical to
FT                   residues 1 to 411 of 419 from E. coli K12 : B2242"
FT                   /db_xref="EnsemblGenomes-Gn:y0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83994"
FT                   /db_xref="GOA:Q8ZAH6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAH6"
FT                   /protein_id="AAM83994.1"
FT                   /translation="MRGRNTMKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSSGQNALH
FT                   FSSGSLDLLAKLPDGQAVSQPLSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRR
FT                   CGLDIVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQP
FT                   QMVASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSRL
FT                   SSTAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLG
FT                   GLVMPGDAVLRAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEP
FT                   ILDLDILSLPHRADWSHSNLFAPQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGY
FT                   DPLQQGCGAGVSLTSAVFVAEQIISEMAVTL"
FT   gene            454677..456047
FT                   /gene="glpC"
FT                   /locus_tag="y0406"
FT   CDS_pept        454677..456047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="y0406"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), K-small subunit"
FT                   /function="enzyme; energy metabolism, carbon: Anaerobic
FT                   respiration"
FT                   /note="residues 51 to 456 of 456 are 72.90 pct identical to
FT                   residues 3 to 396 of 396 from E. coli K12 : B2243"
FT                   /db_xref="EnsemblGenomes-Gn:y0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83995"
FT                   /db_xref="GOA:Q8CWI1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWI1"
FT                   /protein_id="AAM83995.1"
FT                   /translation="MWRGCFIDQCCVCRRTDYQRDGGDIMTGLPKHDASPEQDGMMVGD
FT                   SRLTRDNSFESCIKCTVCTTYCPVAKVNPLYPGPKQAGPDGERLRLKDPALYDDALKYC
FT                   TNCKRCEVACPSDVKIGDIIQRAKASHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAV
FT                   TGLKPVRVLLDKALKIDHRRELPKYSFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYN
FT                   HPQLGKDLVSVFNAMNIGVQLLKREKCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGR
FT                   DIPVVATSSSCTFTLRDEYPHLLDVDTTPVRDKVELATRYLYRLLDQGRELPLKPLFSL
FT                   NPLLASQEAPLRIAYHTPCHMEKMGWTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFK
FT                   SENYATSQGIGASLFQQIEDSGVDLVITDCETCKWQIEMSTSKKCEHPITLLARALA"
FT   gene            complement(456209..456736)
FT                   /locus_tag="y0407"
FT   CDS_pept        complement(456209..456736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0407"
FT                   /product="hypothetical protein"
FT                   /note="residues 3 to 175 of 175 are 55.43 pct identical to
FT                   residues 20 to 203 of 203 from E. coli K12 : B3472;
FT                   residues 3 to 175 of 175 are 58.69 pct identical to
FT                   residues 2 to 185 of 185 from GenPept : >gb|AAL22440.1|
FT                   (AE008865) putative inner membrane lipoprotein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83996"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8E7"
FT                   /protein_id="AAM83996.1"
FT                   /translation="MYKKIVRFLAVGLLVAGLSACDNSSDNNVGQTVSLLDGKVTFNLP
FT                   ADLSDQSGKMGNQANNMHVYANNTGDKAVIVILGEGTNEKLEVLTNRLAEQQRARDANL
FT                   QVVTNKTININGQPFQQLDSIITSSGQKAYSSIVMGTVGNQLMTLQITLPAENQQQAQT
FT                   EAESIISTLKLK"
FT   gene            complement(456866..457609)
FT                   /locus_tag="y0408"
FT   CDS_pept        complement(456866..457609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0408"
FT                   /product="hypothetical protein"
FT                   /note="residues 29 to 235 of 247 are 75.84 pct identical to
FT                   residues 4 to 210 of 221 from E. coli K12 : B3471; residues
FT                   26 to 235 of 247 are 75.23 pct identical to residues 1 to
FT                   210 of 221 from GenPept : >gb|AAL22439.1| (AE008865)
FT                   putative integral membrane protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83997"
FT                   /db_xref="GOA:Q8D1J4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J4"
FT                   /protein_id="AAM83997.1"
FT                   /translation="MPPRRRSCGIFCLGSLTPITKKVTFMFSFTVQQRMTALVWLSLFH
FT                   IVIITSSNYLVQLPIAIFGFHTTWGAFTFPFIFLATDLTVRIFGAPLARRIILSVMVPA
FT                   LLISYLISALFYQGSWQGFPALTSFNLVVARIAVASFMAYVLGQILDVQVFNRLRQRNA
FT                   WWVAPTAAMFFGNISDTMAFFFIAFYRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPA
FT                   YGVMLNVLLKYFARQTGQPVLATER"
FT   gene            457677..458072
FT                   /locus_tag="y0409"
FT   CDS_pept        457677..458072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0409"
FT                   /product="hypothetical protein"
FT                   /note="residues 48 to 127 of 131 are 77.49 pct identical to
FT                   residues 1 to 80 of 81 from E. coli K12 : B3470"
FT                   /db_xref="EnsemblGenomes-Gn:y0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83998"
FT                   /db_xref="GOA:Q8ZAI0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAI0"
FT                   /protein_id="AAM83998.1"
FT                   /translation="MVKLFAFVKPSDFVKLAAFVSLLTFYLSIKPLTDELLNRLLTNKR
FT                   TAMTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIADDPATTRDIPGFCR
FT                   FMDHQLLAQDTEQTPYRYLVRKGITAG"
FT   gene            complement(458172..460538)
FT                   /gene="zntA"
FT                   /locus_tag="y0410"
FT   CDS_pept        complement(458172..460538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="y0410"
FT                   /product="zinc, lead, cadmium, and mercury transporting
FT                   ATPase"
FT                   /function="transport; transport of small molecules;
FT                   cations"
FT                   /note="residues 78 to 786 of 788 are 64.59 pct identical to
FT                   residues 45 to 732 of 732 from E. coli K12 : B3469;
FT                   residues 91 to 784 of 788 are 66.18 pct identical to
FT                   residues 1 to 683 of 692 from GenPept : >emb|CAA04762.1|
FT                   (AJ001437) putative P-type cation-translocating membrane
FT                   ATPase [Proteus mirabilis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAM83999"
FT                   /db_xref="GOA:Q8D1J3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J3"
FT                   /protein_id="AAM83999.1"
FT                   /translation="MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHD
FT                   SVSEHSHHDGESCSHTHADEADEESDRLDTTIVSGTQRFSWQVKGMDCPSCARKIENAI
FT                   SGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATESRL
FT                   REYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIE
FT                   TLMSVAAIGAVFIGATAEAAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLK
FT                   DGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASFDESALTGESIPVERQQGEKV
FT                   AAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILF
FT                   SILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKG
FT                   GAALEQLGRSQIIAFDKTGTLTEGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAI
FT                   AIIQCTQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVVDGLMVRVSAPSKLSPA
FT                   LLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIYALKKLGIQGVM
FT                   LTGDNPRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASS
FT                   IGVAMGSGTDVALETADTALTHNRLTGLAEIILLSRAANANIRQNITIALGLKAIFLVT
FT                   TLLGLTGLWLAVLADSGATALVTANALRLLRKRDV"
FT   gene            complement(460952..461578)
FT                   /locus_tag="y0411"
FT   CDS_pept        complement(460952..461578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0411"
FT                   /product="putative enzyme"
FT                   /note="residues 1 to 208 of 208 are 66.82 pct identical to
FT                   residues 1 to 208 of 208 from E. coli K12 : B3468"
FT                   /db_xref="EnsemblGenomes-Gn:y0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84000"
FT                   /db_xref="GOA:A0A3N4B6I3"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6I3"
FT                   /protein_id="AAM84000.1"
FT                   /translation="MSWPFLAVFFSGWLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQA
FT                   PALGPAGYLIVLGLLATLLADALLLLPSERLLYALGAFFLSHLLYTISFASQMTLTLFW
FT                   PLPLVLIVVGALLLAALWTQLQDMRWPVVAFIGMTLLMVWMAGEQYFARSTDLGFSLLA
FT                   GSVLLLLSHAVWLLNRYRFSFRASDAIAAGCYFIGHFLIVRSLYL"
FT   gene            461868..462188
FT                   /locus_tag="y0412"
FT   CDS_pept        461868..462188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0412"
FT                   /product="hypothetical"
FT                   /note="residues 4 to 103 of 106 are 45.63 pct identical to
FT                   residues 5 to 107 of 110 from GenPept :
FT                   >gb|AAG07366.1|AE004816_2 (AE004816) hypothetical protein
FT                   [Pseudomonas aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84001"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BVL6"
FT                   /protein_id="AAM84001.1"
FT                   /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDSQ
FT                   STLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLPGN
FT                   KP"
FT   gene            462400..462819
FT                   /locus_tag="y0413"
FT   CDS_pept        462400..462819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0413"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 137 of 139 are 38.40 pct identical to
FT                   residues 1 to 120 of 123 from GenPept : >gb|AAL22434.1|
FT                   (AE008864) putative inner membrane protein [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84002"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6G4"
FT                   /protein_id="AAM84002.1"
FT                   /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVEV
FT                   VDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEIKM
FT                   VLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
FT   gene            complement(463006..463278)
FT                   /locus_tag="y0414"
FT   CDS_pept        complement(463006..463278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0414"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 83 of 90 are 64.28 pct identical to
FT                   residues 1 to 84 of 89 from E. coli K12 : B3466"
FT                   /db_xref="EnsemblGenomes-Gn:y0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84003"
FT                   /db_xref="GOA:A0A3N4B6H6"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6H6"
FT                   /protein_id="AAM84003.1"
FT                   /translation="MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMHG
FT                   LQLVLLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPQLPKK"
FT   gene            complement(463268..463930)
FT                   /locus_tag="y0415"
FT   CDS_pept        complement(463268..463930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0415"
FT                   /product="hypothetical protein"
FT                   /note="residues 12 to 201 of 220 are 69.99 pct identical to
FT                   residues 1 to 190 of 198 from E. coli K12 : B3465; residues
FT                   12 to 200 of 220 are 70.37 pct identical to residues 1 to
FT                   189 of 198 from GenPept : >gb|AAL22432.1| (AE008864)
FT                   putative methyltransferase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84004"
FT                   /db_xref="GOA:A0A3N4BAY0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAY0"
FT                   /protein_id="AAM84004.1"
FT                   /translation="MAKQPIAKRSIVKKASPQSAGQIRIIGGKWRGRKLPVPDSPGLRP
FT                   TTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEALSRYASETTLLEADRQVAKQLSD
FT                   NLTLLKAENGQVVNTNSLQWLAQPGQPFNLVFLDPPFRKGLLAETINLLEQFNWLAADA
FT                   WIYVEAEAESAVADVPANWLLHREKIAGQVAYRLFIRQQTDLPACASVAEQEQHHVD"
FT   gene            464212..465873
FT                   /gene="ftsY"
FT                   /locus_tag="y0416"
FT   CDS_pept        464212..465873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="y0416"
FT                   /product="cell division membrane protein"
FT                   /function="membrane; cell division"
FT                   /note="residues 1 to 553 of 553 are 62.34 pct identical to
FT                   residues 1 to 497 of 497 from E. coli K12 : B3464"
FT                   /db_xref="EnsemblGenomes-Gn:y0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84005"
FT                   /db_xref="GOA:Q8D1J2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J2"
FT                   /protein_id="AAM84005.1"
FT                   /translation="MAKEKKRGFFSWLGLGRQSEEPAAEPLATEKEGVTEQEDVIEQTG
FT                   VIEPTDVIEQTVEHVISEKTTEAPAENAFIEVELREQVAAVIPTEPNNAIMSEGVPDTL
FT                   PERAVAESVVAELVETGDNAAIVHDEIIEPITQVTEAGGELSLVKPGIEGDTTEQGGPT
FT                   DNLPKRSLTEDNLIIDVPTPQAVVEESRVDAVEQPTETSEVEEVEEVEEVEEVEEVEEV
FT                   EEVEEVEEVEEKIIPVAAQEQERPTKEGFFARLKRSLIKTKQNLGSGFMGLFSGKKIDD
FT                   DLFEELEEQLLIADVGVETTRKIITSLTEHTSRKQLKDADALYGKLKEEMSEILSKVDK
FT                   PLDVSGKSPYVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVW
FT                   GERNKIAVVAQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVR
FT                   VMKKLDGDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIA
FT                   DQFEIPIRYIGVGEGIEDLRPFKADEFIEALFARED"
FT   gene            465879..466547
FT                   /gene="ftsE"
FT                   /locus_tag="y0417"
FT   CDS_pept        465879..466547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="y0417"
FT                   /product="ATP-binding component of a membrane-associated
FT                   complex involved in cell division"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 1 to 217 of 222 are 89.86 pct identical to
FT                   residues 1 to 217 of 222 from E. coli K12 : B3463"
FT                   /db_xref="EnsemblGenomes-Gn:y0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84006"
FT                   /db_xref="GOA:A0A384LCR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCR8"
FT                   /protein_id="AAM84006.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE
FT                   "
FT   gene            466537..467490
FT                   /gene="ftsX"
FT                   /locus_tag="y0418"
FT   CDS_pept        466537..467490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="y0418"
FT                   /product="cell division membrane protein"
FT                   /function="membrane; cell division"
FT                   /note="residues 17 to 317 of 317 are 73.75 pct identical to
FT                   residues 52 to 352 of 352 from E. coli K12 : B3462;
FT                   residues 17 to 316 of 317 are 75.66 pct identical to
FT                   residues 51 to 350 of 351 from GenPept : >gb|AAL22429.1|
FT                   (AE008864) putative integral membrane cell division protein
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84007"
FT                   /db_xref="GOA:A0A3N4B9E6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9E6"
FT                   /protein_id="AAM84007.1"
FT                   /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVMV
FT                   ISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGVEK
FT                   VNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRISQV
FT                   EGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRDTINV
FT                   MKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGTQFTLH
FT                   GLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
FT   gene            467801..468658
FT                   /gene="rpoH"
FT                   /locus_tag="y0419"
FT   CDS_pept        467801..468658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="y0419"
FT                   /product="RNA polymerase, sigma(32) factor"
FT                   /function="factor; global regulatory functions"
FT                   /note="regulation of proteins induced at high temperatures;
FT                   residues 1 to 285 of 285 are 83.85 pct identical to
FT                   residues 1 to 284 of 284 from E. coli K12 : B3461; residues
FT                   1 to 285 of 285 are 95.43 pct identical to residues 1 to
FT                   285 of 285 from GenPept : >dbj|BAA09442.1| (D50831)
FT                   sigma-32 homolog [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84008"
FT                   /db_xref="GOA:A0A3N4B6G8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6G8"
FT                   /protein_id="AAM84008.1"
FT                   /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQG
FT                   DLGAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKELGV
FT                   TSKDVREMESRMSAQDMTFDPSPDDEARDGQFMAPVLYLQDKTSDFADGIEEDNWDSHA
FT                   ADKLSYALEGLDERSQHIIRARWLDDENKSTLQELADQYGVSAERVRQLEKNAMKKLRM
FT                   AIEA"
FT   mobile_element  468728..469436
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            468821..469330
FT                   /locus_tag="y0420"
FT   CDS_pept        468821..469330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0420"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 99.40 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84009"
FT                   /db_xref="GOA:A0A0H2W6E9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W6E9"
FT                   /protein_id="AAM84009.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(469576..470013)
FT                   /locus_tag="y0421"
FT   CDS_pept        complement(469576..470013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0421"
FT                   /product="hypothetical protein"
FT                   /note="residues 16 to 145 of 145 are 46.92 pct identical to
FT                   residues 1 to 126 of 127 from E. coli K12 : B3459; residues
FT                   16 to 145 of 145 are 46.15 pct identical to residues 1 to
FT                   126 of 127 from GenPept : >gb|AAL22425.1| (AE008864)
FT                   putative acetyltransferase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84010"
FT                   /db_xref="GOA:Q8D1J1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J1"
FT                   /protein_id="AAM84010.1"
FT                   /translation="MNLGAISTLLLWLLAMKLTIERLITLTHQDVIDLAKIWPNQQPAA
FT                   WQQWITEGRPLFAARFNERLLGAVKVAVYDQQAELQDLCVREVTRRRGVGLYLIEETLR
FT                   QLPEIKHWYLNGGDLTAAERPQMNSFMLACGFSHEAQGWRR"
FT   gene            470375..471505
FT                   /gene="livK"
FT                   /locus_tag="y0422"
FT   CDS_pept        470375..471505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="y0422"
FT                   /product="high-affinity
FT                   leucine-specificleucine-specific-binding periplasmic
FT                   protein of high-affinity branched-chain amino acid ABC
FT                   transporter transport system; periplasmic binding protein"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 12 to 376 of 376 are 75.34 pct identical to
FT                   residues 6 to 369 of 369 from E. coli K12 : B3458; residues
FT                   12 to 376 of 376 are 75.61 pct identical to residues 6 to
FT                   369 of 369 from GenPept : >gb|AAG58565.1|AE005569_5
FT                   (AE005569) high-affinity leucine-specific transport system;
FT                   periplasmic binding protein [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84011"
FT                   /db_xref="GOA:Q8D1J0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1J0"
FT                   /protein_id="AAM84011.1"
FT                   /translation="MGNSRMKLTKGKVLLAGCMAMAMSHSVLAQDIKVAIVGAMSGPVA
FT                   QYGDMQFTGARQAIADINASGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIG
FT                   HLCSSSTQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYIVE
FT                   TIKPKRIAVVHDKQQYGEGLARSVRDSLKEQGAEVVLFEGVTAGDKDFSTLVARLKKEN
FT                   VDFVYFGGYYPEMGQILRQAKQAGLTARFMGPEGVGNSSLSNIAGEASEGMLVTLPKRY
FT                   DQVPANQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMERTGSKEPADLANDLKTGKP
FT                   VETVMGPLSWDDKGDLKGFEFGIFEWHADGSSTAVK"
FT   gene            471686..472612
FT                   /gene="livH"
FT                   /locus_tag="y0423"
FT   CDS_pept        471686..472612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="y0423"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transport system membrane permease"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 1 to 308 of 308 are 87.33 pct identical to
FT                   residues 1 to 308 of 308 from E. coli K12 : B3457; residues
FT                   1 to 308 of 308 are 87.66 pct identical to residues 1 to
FT                   308 of 308 from GenPept : >gb|AAL22423.1| (AE008864) ABC
FT                   superfamily (membrane), branched-chain amino acid
FT                   transporter, high-affinity [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84012"
FT                   /db_xref="GOA:A0A3N4B6G2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6G2"
FT                   /protein_id="AAM84012.1"
FT                   /translation="MSEQFLYFLQQMFNGITLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMISSYVSFIVIAALMMVGIDASWLLIGCAFLVSIVIASTYGWSIERVAYKPVRRSKR
FT                   LIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWTLGESNGFAATISTMQLTIWIV
FT                   TFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLSTEYKD
FT                   AVSFALLIVVLLVMPTGILGRPEVEKV"
FT   gene            472609..473895
FT                   /gene="livM"
FT                   /locus_tag="y0424"
FT   CDS_pept        472609..473895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="y0424"
FT                   /product="inner membrane permease of high-affinity
FT                   branched-chain amino acid ABC transport system"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 1 to 428 of 428 are 79.43 pct identical to
FT                   residues 1 to 425 of 425 from E. coli K12 : B3456"
FT                   /db_xref="EnsemblGenomes-Gn:y0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84013"
FT                   /db_xref="GOA:A0A3N4BAW6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAW6"
FT                   /protein_id="AAM84013.1"
FT                   /translation="MKQLNFVNAIISSFVLLVLASFVMGLQLQLDGTRLVVQGASEVRW
FT                   LWIGAGCLVVFCFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAVVIIAAVAWP
FT                   FLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLG
FT                   FWESLPLAGITAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGI
FT                   SQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSHRIIFLYLVALLLVILTLFVINR
FT                   LLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPE
FT                   SFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGALMVLMMI
FT                   WRPQGLLPMKRPQLKLKVADVKAKQGEQA"
FT   gene            473892..474659
FT                   /gene="livG"
FT                   /locus_tag="y0425"
FT   CDS_pept        473892..474659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="y0425"
FT                   /product="ATP-binding component of high-affinity
FT                   branched-chain amino acid ABC transport system"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 4 to 255 of 255 are 82.14 pct identical to
FT                   residues 3 to 254 of 255 from E. coli K12 : B3455; residues
FT                   4 to 255 of 255 are 83.33 pct identical to residues 3 to
FT                   254 of 255 from GenPept : >gb|AAL22421.1| (AE008864) ABC
FT                   superfamily (atp_bind), branched-chain amino acid
FT                   transporter, high-affinity [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84014"
FT                   /db_xref="GOA:A0A2S9PFQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PFQ4"
FT                   /protein_id="AAM84014.1"
FT                   /translation="MNGQPLLTVEGLSMRFGGLLAVNNVGLTLNQGEIVSLIGPNGAGK
FT                   TTIFNCLTGFYRPTGGTIKLRERHLEGLPGQMIARMGVIRTFQHVRLFREMTVIENLLV
FT                   AQHQHLKSGIFAGLLKTPGFRRAEADALARAATWLERVGLLALANRQAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGLPAEIRNNPDVIRAYLGE"
FT   gene            474674..475405
FT                   /gene="livF"
FT                   /locus_tag="y0426"
FT   CDS_pept        474674..475405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="y0426"
FT                   /product="ATP-binding component of leucine transport"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 11 to 243 of 243 are 87.12 pct identical to
FT                   residues 9 to 241 of 241 from E. coli K12 : B3454"
FT                   /db_xref="EnsemblGenomes-Gn:y0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84015"
FT                   /db_xref="GOA:Q8D1I9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I9"
FT                   /protein_id="AAM84015.1"
FT                   /translation="MESGRGINNNMLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGA
FT                   NGAGKTTLLGTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVE
FT                   ENLAMGGFFADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPK
FT                   LLLLDEPSLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIV
FT                   LEDTGAALLANEAVRSAYLGG"
FT   gene            475633..476094
FT                   /locus_tag="y0427"
FT   CDS_pept        475633..476094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0427"
FT                   /product="hypothetical"
FT                   /note="residues 26 to 113 of 153 are 28.40 pct identical to
FT                   residues 181 to 264 of 413 from GenPept : >gb|AAC44570.1|
FT                   (U61140) ORF1 [Mycoplasma mycoides subsp. mycoides SC]"
FT                   /db_xref="EnsemblGenomes-Gn:y0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8C6"
FT                   /protein_id="AAM84016.1"
FT                   /translation="MMDGISNKMDLQGLSAVRSFAFLTADLMLNITNKNGDNHEYKVTS
FT                   SHVNNDKLQGPKGILKATKNHAELKNETIASGEKKTISFDKLHVREIPDREQASYIDNL
FT                   SLNRNIYLDTSADRECRIPTQVLSPDQNVDSGTKKPFWISKYLCITTLY"
FT   gene            complement(476209..477315)
FT                   /locus_tag="y0428"
FT   CDS_pept        complement(476209..477315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0428"
FT                   /product="hypothetical"
FT                   /note="residues 16 to 44 of 368 are 51.61 pct identical to
FT                   residues 242 to 272 of 621 from GenPept : >gb|AAF48396.1|
FT                   (AE003497) CG9521 gene product [Drosophila melanogaster]"
FT                   /db_xref="EnsemblGenomes-Gn:y0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9D6"
FT                   /protein_id="AAM84017.1"
FT                   /translation="MNIKNKPLLIGLLLLFLHPTTAAATKWVGNYFYPLANKYSNCNVT
FT                   LLEDNSVAVSFDVTLVADLFETDRGPHLQRWKKIIGTQQDVLLVQNNALLFLYFYHADG
FT                   SADFSIRPGDIQNMSLNGIPVQEIDYNLQEARFVSTHAFSNQSYHVSFNITANALKHIR
FT                   MGATIGGVLHSEGVSYSVRSPQGVAFNQSGNQCEFFDPTTEIAPSHALYIEPKFRLGSA
FT                   IWQLKSLDLDHLLDSTADNHGLHAPLVNGPANRFCIHYPAIGTQNRRYMISASNLNGLA
FT                   ESSRYFQLKDNQGEHIINYKVTLKNHEDSEADFSLPKEKKFIQLKSDTSSGGEAQMCWS
FT                   PRIRVYSTDTTDKGHYTDTLNFTITPLA"
FT   gene            complement(477393..477911)
FT                   /locus_tag="y0429"
FT   CDS_pept        complement(477393..477911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0429"
FT                   /product="hypothetical"
FT                   /note="residues 61 to 118 of 172 are 29.31 pct identical to
FT                   residues 781 to 838 of 987 from GenPept : >dbj|BAB75624.1|
FT                   (AP003594) ORF_ID:alr3925; hypothetical protein [Nostoc sp.
FT                   PCC 7120]"
FT                   /db_xref="EnsemblGenomes-Gn:y0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6F9"
FT                   /protein_id="AAM84018.1"
FT                   /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKPH
FT                   GGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQTF
FT                   SPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLQISAKAPAGDNTAGKYHGQ
FT                   LTLVFEVNS"
FT   gene            complement(477973..478635)
FT                   /locus_tag="y0430"
FT   CDS_pept        complement(477973..478635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0430"
FT                   /product="hypothetical"
FT                   /note="residues 6 to 174 of 220 are 27.27 pct identical to
FT                   residues 1 to 173 of 238 from GenPept : >emb|CAA87760.1|
FT                   (Z47800) CotB [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84019"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR9"
FT                   /protein_id="AAM84019.1"
FT                   /translation="MVRWTVKNLVFAAISLLPLSAAGVIDIQPQVVELQQVNTVVTVIN
FT                   HGMTAEYITVQLYRLNNPGVASELESLTPVGYQQQPLLFATPLKLTLGPRQSGKIFLHA
FT                   LGAPEQEQVYRLAVVPSNHLKISGNNTAVVGVQISYMGLIRHLPASIQHQWTHRCIAGK
FT                   PELHNTGNTRLYWHQLQAQGQMIDDFTLYPGRYRQLAFNELQGKVEDQAVNLQCPSG"
FT   gene            complement(478592..479311)
FT                   /locus_tag="y0431"
FT   CDS_pept        complement(478592..479311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0431"
FT                   /product="hypothetical"
FT                   /note="residues 11 to 221 of 239 are 21.02 pct identical to
FT                   residues 3 to 206 of 236 from GenPept : >emb|CAD08770.1|
FT                   (AL627266) putative fimbrial protein [Salmonella enterica
FT                   subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84020"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR8"
FT                   /protein_id="AAM84020.1"
FT                   /translation="MPRRLIPIGTFMKYLYSILSIALLLAPGSATHGQLLATPTRIAVE
FT                   AQELKRTVQVYNSGDTPLYLDITLQRVDNPGVNPERKTPISEISQPEMIFNPNRITLGP
FT                   RQKRDITLIPLKSPVQETLYRLYINPVLNIKAVGDGEDKSKVHAPMTISIGYGVLIHHL
FT                   PPAAAQTRHWQHQCSTTGELTLTATGTVHSKFKQLESGGNAALADSLNLYPGTALTLPV
FT                   KQLNGEVDGEKFSLRCH"
FT   gene            complement(479296..481644)
FT                   /locus_tag="y0432"
FT   CDS_pept        complement(479296..481644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0432"
FT                   /product="hypothetical"
FT                   /note="residues 53 to 775 of 782 are 20.33 pct identical to
FT                   residues 49 to 830 of 869 from GenPept : >gb|AAC41416.1|
FT                   (M55661) colonization factor antigen c [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84021"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR7"
FT                   /protein_id="AAM84021.1"
FT                   /translation="MEWNPMAYYSKINHSLLFTLALFTLKLAHAEAVKIEYLVPMGFSA
FT                   AEENNSLQLLGVLDSKTLPSPITFSEEEQQLQFNQQNYRHNNISEESIILLGEILSQIP
FT                   YLQCKTGCDYTLSGHRVALDKVNNTLTITNNNNRYLMPTTTWGLVSNQSLDLRMTAAHY
FT                   RAMSVRGQSYIGLPWQSYGFASWFYNAIQSQNTLQSQNTMPSQSTYQPVNRPQYQRLTQ
FT                   KGIGSWYLQKNFSALYLRTGRQNNLDNNAGSVHTLINPALDQFVTLGSQSYLAIDKPST
FT                   GSIVLYAAQDGDYEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYNVEIRLVDRLGRIVS
FT                   QENQTISNIGNQTNNGWFLTMGKGPAKGKKTPRLVQFGRSRVIESVQTNITLLKDDAHH
FT                   WAVEANVSRPLSLNKVNITPTGGLMSGEKRSGGYVRLNGGNNTLGYFSLARYQSPYVSR
FT                   YAPDSGSTSGSYTRRIGPTQLSYQFNQYRNNRQHRIQSGWDWQLPQFNLALSLGLQNGG
FT                   QWNSHNNYGVFLNTTLSFGQSNASINTAYTQQQLNTSASYQKEFIDNYGASTLGVSGSA
FT                   SGKLNSVGGFAKRSGSRGDISGRVGIDNQITNGGISYNGMLALSSQGVALGRSSYSGAA
FT                   LLIKAPALGGTPYSFHVEDSPITGGGTYAIPVPRYQDRFFVRTHTDRSDMDMNIQLPVN
FT                   IVRAHPGQVFSGEADITLNLLYSGFLKNAQGLPVSGVIEETGDTAYPNGLFSINAQNRL
FT                   QAITVHGPSGRYRCDMHSQPTHIYLCHAD"
FT   gene            complement(481896..482387)
FT                   /locus_tag="y0433"
FT   CDS_pept        complement(481896..482387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0433"
FT                   /product="hypothetical"
FT                   /note="residues 3 to 157 of 163 are 26.06 pct identical to
FT                   residues 4 to 164 of 170 from GenPept : >gb|AAC41415.1|
FT                   (M55661) colonization factor antigen b [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84022"
FT                   /db_xref="GOA:A0A3N4B6F7"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6F7"
FT                   /protein_id="AAM84022.1"
FT                   /translation="MMKKTVIAIITMATLTSTAAYANTIEKDIRVEAEIISLMDVKRAD
FT                   DSNINKIKLTYDTVTNDGTYSHSEAIKVKARKQLGDKLKVSLAAPVILSEPNNNKEFTH
FT                   VEVLLDGKKLLETADTRDLIAFHGSELNAELKVSAKEPNNAVGGEKYSGVIQLRLEPSA
FT                   "
FT   gene            482942..484261
FT                   /gene="ugpB"
FT                   /locus_tag="y0434"
FT   CDS_pept        482942..484261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="y0434"
FT                   /product="periplasmic binding protein"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="sn-glycerol 3-phosphate ABC transport system;
FT                   residues 6 to 439 of 439 are 80.18 pct identical to
FT                   residues 4 to 437 of 438 from E. coli K12 : B3453; residues
FT                   5 to 439 of 439 are 82.06 pct identical to residues 3 to
FT                   437 of 438 from GenPept : >gb|AAL22417.1| (AE008864) ABC
FT                   superfamily (peri_perm), sn-glycerol 3-phosphate transport
FT                   protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84023"
FT                   /db_xref="GOA:Q7CKV7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKV7"
FT                   /protein_id="AAM84023.1"
FT                   /translation="MFNNSIHKVSICIALTLTFSANAMAVTEIPFWHSMEGELGKEVDS
FT                   IADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIK
FT                   PVYQVFKDANIDFDESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKAGLD
FT                   PEQPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTD
FT                   AVLEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSLASIRH
FT                   YAKFNFGVGMMPYDADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAA
FT                   EWHQKTGYLPITTAAYELTKQQGFYEQNPGADVATRQMLNKPPLPYTKGLRLGNMPQIR
FT                   TVVDEELEAVWTAKKTPQAALDNSVKRGDVLLRRFEQANK"
FT   gene            484559..485446
FT                   /gene="ugpA"
FT                   /locus_tag="y0435"
FT   CDS_pept        484559..485446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="y0435"
FT                   /product="integral membrane protein, permease"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="sn-glycerol 3-phosphate ABC transport system;
FT                   residues 1 to 295 of 295 are 79.32 pct identical to
FT                   residues 1 to 295 of 295 from E. coli K12 : B3452; residues
FT                   1 to 295 of 295 are 80.33 pct identical to residues 1 to
FT                   295 of 295 from GenPept : >gb|AAL22416.1| (AE008864) ABC
FT                   superfamily (membrane), sn-glycerol 3-phosphate transport
FT                   protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84024"
FT                   /db_xref="GOA:Q7CKV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKV6"
FT                   /protein_id="AAM84024.1"
FT                   /translation="MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTLD
FT                   PFGLSSEFVGLSNFIQLFQDEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGS
FT                   RLYQTLLILPYAVAPAVAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVL
FT                   ASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVN
FT                   LVYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLT
FT                   VIQFRFVERKVRYQ"
FT   gene            485443..486288
FT                   /gene="ugpE"
FT                   /locus_tag="y0436"
FT   CDS_pept        485443..486288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="y0436"
FT                   /product="inner membrane permease"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="sn-glycerol 3-phosphate ABC transport system;
FT                   residues 1 to 281 of 281 are 77.58 pct identical to
FT                   residues 1 to 281 of 281 from E. coli K12 : B3451; residues
FT                   1 to 281 of 281 are 79.71 pct identical to residues 1 to
FT                   281 of 281 from GenPept : >gb|AAL22415.1| (AE008864) ABC
FT                   superfamily (membrane),sn-glycerol 3-phosphate transport
FT                   protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84025"
FT                   /db_xref="GOA:Q7CKV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKV5"
FT                   /protein_id="AAM84025.1"
FT                   /translation="MIENRRGLDIFCHIMLIIGVLLILFPLYVAFVAASLDDSQVFQAP
FT                   MTLIPGPHLWQNISHIWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAIVY
FT                   FRFPLRNLFFWLIFLTLMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATFLFR
FT                   QFFMTLPDELLEAARIDGAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILIT
FT                   SDASMGTAVAGIRSMISTSGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGLVDSEK
FT                   "
FT   gene            486295..487368
FT                   /gene="ugpC"
FT                   /locus_tag="y0437"
FT   CDS_pept        486295..487368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="y0437"
FT                   /product="ATP-binding component"
FT                   /function="transport; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="sn-glycerol 3-phosphate ABC transport system;
FT                   residues 1 to 355 of 357 are 75.56 pct identical to
FT                   residues 14 to 369 of 369 from E. coli K12 : B3450;
FT                   residues 1 to 355 of 357 are 75.56 pct identical to
FT                   residues 14 to 369 of 369 from GenPept :
FT                   >gb|AAG58556.1|AE005568_6 (AE005568) ATP-binding component
FT                   of sn-glycerol 3-phosphate transport system [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84026"
FT                   /db_xref="GOA:Q74R28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74R28"
FT                   /protein_id="AAM84026.1"
FT                   /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVADGEFIVMVGPSGCGKST
FT                   LLRMVAGLERTTTGDIYIGDQRVTDLEPKDRGIAMVFQNYVLYPHMNVFDNMAYGLKIR
FT                   GFGKEQIRQRVDEAARILELQPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMLLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGTPSEV
FT                   YKRPASLFVASFIGSPAMNLLDGTVSPDGRTFILSDGLTLPLEIPQPQWGGRRLTLGIR
FT                   PEHIQQTTSAQGVPMNLLTLELLGADNLAHGLWGGQSIIARLSHEEMPVAGSTLHLYLP
FT                   PAALHFFDTDSGLRIEP"
FT   gene            487365..488114
FT                   /gene="ugpQ"
FT                   /locus_tag="y0438"
FT   CDS_pept        487365..488114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="y0438"
FT                   /product="cytosolic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /function="enzyme; central intermediary metabolism: Pool,
FT                   multipurpose conversions"
FT                   /note="residues 4 to 247 of 249 are 72.95 pct identical to
FT                   residues 3 to 245 of 247 from E. coli K12 : B3449; residues
FT                   4 to 247 of 249 are 73.77 pct identical to residues 3 to
FT                   245 of 247 from GenPept : >gb|AAG58555.1|AE005568_5
FT                   (AE005568) glycerophosphodiester phosphodiesterase,
FT                   cytosolic [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84027"
FT                   /db_xref="GOA:A0A3N4B9C6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9C6"
FT                   /protein_id="AAM84027.1"
FT                   /translation="MNRDWPYPPIVAHRGGGSLAPENTLAAIDVGARYGHKMIEFDAKL
FT                   SQDGQIFLLHDDTLERTSNGWGVAGELTWEKLIQLDAGDWFSKAFRGERLPLLSEVAAR
FT                   CAQHGMAANIEIKPTTGTDAPTGRAIALAARALWQGQPIPPLLSSFSVDALAAAQLAVP
FT                   ELPRGLLLDKWDDNWAALTTQLDCVSLHINHKQLTAERVALLKAAGLRILVYTVNQPER
FT                   ARELLNWGVDCICTDRIDLLGSDFTGC"
FT   gene            488215..489171
FT                   /locus_tag="y0439"
FT   CDS_pept        488215..489171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0439"
FT                   /product="putative inner membrane permease"
FT                   /function="putative transport"
FT                   /note="residues 16 to 309 of 318 are 27.66 pct identical to
FT                   residues 9 to 308 of 314 from GenPept : >gb|AAL41105.1|
FT                   (AE008982) permease [Agrobacterium tumefaciens str. C58 (U.
FT                   Washington)]"
FT                   /db_xref="EnsemblGenomes-Gn:y0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84028"
FT                   /db_xref="GOA:A0A2U2H2U6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2U2H2U6"
FT                   /protein_id="AAM84028.1"
FT                   /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTRF
FT                   VFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSGSV
FT                   FALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGSPTM
FT                   AGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVLGMGL
FT                   AEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGVNVYLM
FT                   SRQFNVLTGPAAASLVMSTVLAAVTTPLILTIIGVGI"
FT   gene            489491..490423
FT                   /locus_tag="y0440"
FT   CDS_pept        489491..490423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0440"
FT                   /product="hypothetical protein"
FT                   /note="residues 14 to 304 of 310 are 73.88 pct identical to
FT                   residues 3 to 293 of 299 from E. coli K12 : B3827; residues
FT                   14 to 304 of 310 are 73.88 pct identical to residues 3 to
FT                   293 of 299 from GenPept : >gb|AAG59023.1|AE005614_3
FT                   (AE005614) orf, hypothetical protein [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84029"
FT                   /db_xref="GOA:Q8D1I6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I6"
FT                   /protein_id="AAM84029.1"
FT                   /translation="MHFTLSLSQFIVLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLM
FT                   RVGLAALVFLPFLRWRNIPWRVILLYMAVGSIQLGIMYLFSFRAYLYLTVPEFLLFTVM
FT                   TPLYVTLIYDLLRRQRLRWGYALSALLAVLGAAIIRYDQLSEHFWWGLALVQAANICFA
FT                   IGQVGYKRLMEVHPIPQHVAFSWFYLGAFVVAVVAWFAFGNPQRLPTTGLQWGILVWLG
FT                   VGASALGYFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAAVIM
FT                   ASLWVHRRWIAPHPLQTANDRKRADEQNE"
FT   gene            complement(490311..491264)
FT                   /gene="metR"
FT                   /locus_tag="y0441"
FT   CDS_pept        complement(490311..491264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="y0441"
FT                   /product="regulator for metE and metH"
FT                   /function="regulator; amino acid biosynthesis: Methionine"
FT                   /note="residues 1 to 314 of 317 are 88.21 pct identical to
FT                   residues 1 to 314 of 317 from E. coli K12 : B3828; residues
FT                   1 to 314 of 317 are 88.21 pct identical to residues 1 to
FT                   314 of 317 from GenPept : >gb|AAG59024.1|AE005614_4
FT                   (AE005614) regulator for metE and metH [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84030"
FT                   /db_xref="GOA:A0A3N4BVI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BVI8"
FT                   /protein_id="AAM84030.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQWL
FT                   TPALDNFHKHWPQVTMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLANKDRIEPEDLAPEVLMIYPVQRQRLDVWRHFLQPAGVSPSSKNVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVTEAF
FT                   IRSARQHACDHLPFVKDAVRSNAGVPTAKPLSPQLQ"
FT   gene            491355..493646
FT                   /gene="metE"
FT                   /locus_tag="y0442"
FT   CDS_pept        491355..493646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="y0442"
FT                   /product="tetrahydropteroyltriglutamate methyltransferase"
FT                   /function="enzyme; amino acid biosynthesis: Methionine"
FT                   /note="residues 6 to 759 of 763 are 85.01 pct identical to
FT                   residues 1 to 751 of 753 from E. coli K12 : B3829"
FT                   /db_xref="EnsemblGenomes-Gn:y0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84031"
FT                   /db_xref="GOA:Q8ZAL3"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAL3"
FT                   /protein_id="AAM84031.1"
FT                   /translation="MGNKTMTILNHTLGFPRVGLKRELKKAQESYWAGNSTQEELLNVG
FT                   RELRARHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGSIDIDTLFRI
FT                   GRGRAPTGKPAAAAEMTKWFNTNYHYMVPEFQQGQQFKLGWTQLLDEVDEALALGHKIK
FT                   PVLLGPITYLWLGKVKGEQFDRLSLLNDILPVYQQVLAELAKRGIEWVQIDEPALVLEL
FT                   PQEWLDAYQPAYQALQGQVKLLLTTYFDSIGHNIDTIRALPVQGLHVDVVTGHDDLAVL
FT                   NKNLPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRPLWLGSSCSLLHSPIDLNEE
FT                   TRLDAEVKSWFAFALQKCAELALLTQALNAPNDAKLAELAAYSAPIRARRSSSRVHNAQ
FT                   VEQRLAAITSQDIERQLPYEARAETQRKRFNLPAWPTTTIGSFPQTTEIRGLRLDFKQG
FT                   RLDGKNYRTGISEHIKHAIAEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWV
FT                   QSYGSRCVKPPVIIGDISRPEAITVEWAKYAQSLTEKPVKGMLTGPVTILCWSFPREDV
FT                   SRETIAKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRRADWQAYLQWAVDAFKL
FT                   NAAVAQNDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEDFAYPNEI
FT                   GPGVYDIHSPNVPSVEWIEALLRKAAQRIPAERLWVNPDCGLKTRGWPETRQALANMVL
FT                   AAQRLREEQV"
FT   gene            complement(493701..494573)
FT                   /locus_tag="y0443"
FT   CDS_pept        complement(493701..494573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0443"
FT                   /product="putative carboxymethylenebutenolidase"
FT                   /note="residues 15 to 279 of 290 are 71.32 pct identical to
FT                   residues 30 to 288 of 293 from GenPept :
FT                   >gb|AAG59026.1|AE005614_6 (AE005614) putative enzyme
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84032"
FT                   /db_xref="GOA:Q8ZAL4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAL4"
FT                   /protein_id="AAM84032.1"
FT                   /translation="MKTDQLVRLRQAAGGFTPAGTPLMATAHHTDQLHSLQTHGIHCGE
FT                   TTIPSQGDELPAYIAKPDQHTGPYPVVIVVQEIFGVHEHIQDICRRLAKQGYLAIAPEL
FT                   YFRQGDAKDYSNINELVNNLVKKVPDRQVLVDLDHTAHWASRHGGDTKKLAITGFCWGG
FT                   RIAWLYAAHNPQLKAAVAWYGKLVGEKTLFLPKYPVDVAIDLCAPVLGLYGGKDTSIPA
FT                   EHIETMRQALRAANADAEIIVYPEAGHAFNADYRPSYHAESAQDGWQRMLDWFTQHGVS
FT                   AIPIPEETQ"
FT   gene            494956..495762
FT                   /gene="udp"
FT                   /locus_tag="y0444"
FT   CDS_pept        494956..495762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="y0444"
FT                   /product="uridine phosphorylase"
FT                   /function="enzyme; salvage of nucleosides and nucleotides"
FT                   /note="residues 16 to 268 of 268 are 92.09 pct identical to
FT                   residues 1 to 253 of 253 from E. coli K12 : B3831; residues
FT                   16 to 268 of 268 are 100.00 pct identical to residues 1 to
FT                   253 of 253 from GenPept : >emb|CAB94934.1| (AJ278525)
FT                   uridine phosphorylase [Yersinia pseudotuberculosis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84033"
FT                   /db_xref="GOA:Q8D1I4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PDB:4JP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I4"
FT                   /protein_id="AAM84033.1"
FT                   /translation="MSLPTTSLMKRGVSHMAKSDVFHLGLTKNDLQGATLAIVPGDPQR
FT                   VEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTF
FT                   LRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVG
FT                   ATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCA
FT                   SQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL"
FT   gene            495883..496713
FT                   /locus_tag="y0445"
FT   CDS_pept        495883..496713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0445"
FT                   /product="hypothetical"
FT                   /note="residues 11 to 275 of 276 are 31.11 pct identical to
FT                   residues 78 to 331 of 332 from GenPept : >dbj|BAB81658.1|
FT                   (AP003192) protein-tyrosine phosphatase [Clostridium
FT                   perfringens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84034"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAT9"
FT                   /protein_id="AAM84034.1"
FT                   /translation="MTMTTFSHPSLIPLDGGINFRDLGGNLAADGRRIKPGLLFRSGSL
FT                   DRLSTNDCDFLSHSNVTQIIDYRDADEVQAKPDVLWPGAHYHNIPANPLSSEVNANLEK
FT                   LTNETLATFDVRAFMFELYHRLPFNSLAYQQLVNLLQNCASTDPVASSVVHSGDVVHRG
FT                   IVQHCAVGKDRTGVGAALVLFALGADESTVLEDYLLTETTLKPFREHMLAELALKLNDQ
FT                   ALAQFTFVLSAREEFIQTTLRSIHERYGSRERWLKHEFGLGSIEREKLQSYFLE"
FT   gene            497071..498888
FT                   /gene="cstA"
FT                   /locus_tag="y0446"
FT   CDS_pept        497071..498888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="y0446"
FT                   /product="carbon starvation protein"
FT                   /function="phenotype; global regulatory functions"
FT                   /note="residues 5 to 543 of 605 are 42.25 pct identical to
FT                   residues 33 to 598 of 701 from E. coli K12 : B0598;
FT                   residues 5 to 595 of 605 are 71.06 pct identical to
FT                   residues 2 to 592 of 598 from GenPept : >emb|CAB14831.1|
FT                   (Z99118) carbon starvation-induced protein [Bacillus
FT                   subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84035"
FT                   /db_xref="GOA:A0A3N4BKM7"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKM7"
FT                   /protein_id="AAM84035.1"
FT                   /translation="MLMQHAITFVIASACILTICYRLYGIFFVRKVLRVDDSEVTPSHT
FT                   FEDGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAVHD
FT                   TVVLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNPW
FT                   GTFAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEGTWLGEWLMLKA
FT                   DTVSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQFPAVTQ
FT                   FIHGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAE
FT                   CMVGVMALIAATSLHPADYFAINSSAEAWSALGMEVVNLPKLSEEIGLDLYGRTGGAVT
FT                   LAVGMTDIFIRVPWFNSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQDFLGDIWAP
FT                   LKRTDWLPGTLVCSVIACALWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRL
FT                   ATKRVYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIISIIMMTLGVII
FT                   LISALRKWRELWIRRSAEMAGNKVVTANA"
FT   gene            499121..499690
FT                   /locus_tag="y0447"
FT   CDS_pept        499121..499690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0447"
FT                   /product="hypothetical"
FT                   /note="residues 20 to 177 of 189 are 46.20 pct identical to
FT                   residues 5 to 162 of 213 from GenPept : >dbj|BAB47773.1|
FT                   (AP002994) hypothetical protein [Mesorhizobium loti]"
FT                   /db_xref="EnsemblGenomes-Gn:y0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84036"
FT                   /db_xref="GOA:Q8CLR6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR6"
FT                   /protein_id="AAM84036.1"
FT                   /translation="MGIVRLYQSQDISVTFNDAITTTIDFVRVHEAWAIPIVFILAFGE
FT                   SLAFLSLLLPATVILLGLGALIGESGIPFWPIWAAAAAGAFFGDWVSYWVGIHYKDRVA
FT                   TLWPLSRNPQLLVRGHAFFERWGFFGAFFGRFFGPLRAIVPLVAGICAMPQRYFQLANI
FT                   TSALIWAFGILAPGAFGIQWLSNWIG"
FT   gene            499898..501403
FT                   /locus_tag="y0448"
FT   CDS_pept        499898..501403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0448"
FT                   /product="putative alpha helix chain"
FT                   /function="phenotype; Not classified"
FT                   /note="residues 1 to 483 of 501 are 65.63 pct identical to
FT                   residues 1 to 448 of 475 from E. coli K12 : B3832"
FT                   /db_xref="EnsemblGenomes-Gn:y0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84037"
FT                   /db_xref="GOA:Q8ZAL8"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAL8"
FT                   /protein_id="AAM84037.1"
FT                   /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQAL
FT                   QQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQEL
FT                   RAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQTGR
FT                   RADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMARE
FT                   ALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQPDVIVR
FT                   LPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITNLWRYEHQ
FT                   SQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRGNLVGQVES
FT                   FRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
FT   gene            501495..502250
FT                   /gene="ubiE"
FT                   /locus_tag="y0449"
FT   CDS_pept        501495..502250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="y0449"
FT                   /product="COQ5 methyltransferase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Menaquinone, ubiquinone"
FT                   /note="2-octaprenyl-6-methoxy-1,4-benzoquinone -->
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone; residues
FT                   1 to 251 of 251 are 82.86 pct identical to residues 1 to
FT                   251 of 251 from E. coli K12 : B3833; residues 1 to 251 of
FT                   251 are 83.26 pct identical to residues 1 to 251 of 251
FT                   from GenPept : >gb|AAG59029.1|AE005614_9 (AE005614)
FT                   2-octaprenyl-6-methoxy-1,4-benzoquinone -->
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84038"
FT                   /db_xref="GOA:Q8D1I3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1I3"
FT                   /protein_id="AAM84038.1"
FT                   /translation="MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSF
FT                   GVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLRMG
FT                   REKLRDKGIVGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPG
FT                   GRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDAESYRYLAESIRMHPDQETLK
FT                   GMMADAGFENVTYSNLTGGIVALHRGFKF"
FT   gene            502213..502914
FT                   /locus_tag="y0450"
FT   CDS_pept        502213..502914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0450"
FT                   /product="hypothetical protein"
FT                   /note="residues 37 to 233 of 233 are 56.85 pct identical to
FT                   residues 5 to 201 of 201 from E. coli K12 : B3834; residues
FT                   37 to 233 of 233 are 56.85 pct identical to residues 5 to
FT                   201 of 201 from GenPept : >gb|AAL22815.1| (AE008885)
FT                   putative inner membrane protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84039"
FT                   /db_xref="GOA:Q8D1I2"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I2"
FT                   /protein_id="AAM84039.1"
FT                   /translation="MALLRYIGALSSNRNMAMSLRTLMLKPFLLKPRLLTPLITAALET
FT                   VLNGVLFNDKSLKAARSRLVGKVLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVK
FT                   TDVAVLARLRDRQQLSPLMRTGELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVA
FT                   AESLGQAIHKSSGFLSRQLRQQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEA
FT                   LSSRLATMETK"
FT   gene            502914..504545
FT                   /locus_tag="y0451"
FT   CDS_pept        502914..504545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0451"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 542 of 543 are 80.73 pct identical to
FT                   residues 1 to 545 of 546 from E. coli K12 : B3835; residues
FT                   1 to 542 of 543 are 79.52 pct identical to residues 1 to
FT                   541 of 544 from GenPept : >gb|AAB96577.1| (AF002165)
FT                   aminoglycoside acetyltransferase regulator [Providencia
FT                   stuartii]"
FT                   /db_xref="EnsemblGenomes-Gn:y0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84040"
FT                   /db_xref="GOA:Q8ZAM1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAM1"
FT                   /protein_id="AAM84040.1"
FT                   /translation="MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLS
FT                   NRHKDKSLGERLRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGAL
FT                   ARKHIEIAMGGALETWFDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILPIIK
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDS
FT                   PMLYIPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVA
FT                   ELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAE
FT                   KFPELPELVYDSLQQHKLLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTILFL
FT                   ADATEVSTGFIVAGALAWFIGWRRTC"
FT   gene            504725..504991
FT                   /locus_tag="y0452"
FT   CDS_pept        504725..504991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0452"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 87 of 88 are 64.13 pct identical to
FT                   residues 15 to 102 of 103 from E. coli K12 : B3836;
FT                   residues 1 to 87 of 88 are 64.13 pct identical to residues
FT                   15 to 102 of 103 from GenPept : >gb|AAG59032.1|AE005614_12
FT                   (AE005614) twin arginine translocation protein;
FT                   sec-independent protein export [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84041"
FT                   /db_xref="GOA:Q8ZAM2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAM2"
FT                   /protein_id="AAM84041.1"
FT                   /translation="MGSIGWAQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMGD
FT                   DSQTPPTNVDKTSNDADFAKSITEKQQPVAKAEESKSHEKEQG"
FT   gene            504995..505657
FT                   /locus_tag="y0453"
FT   CDS_pept        504995..505657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0453"
FT                   /product="hypothetical protein"
FT                   /note="residues 27 to 164 of 220 are 59.57 pct identical to
FT                   residues 1 to 138 of 145 from E. coli K12 : B3838"
FT                   /db_xref="EnsemblGenomes-Gn:y0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84042"
FT                   /db_xref="GOA:Q8ZAM3"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAM3"
FT                   /protein_id="AAM84042.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAAT
FT                   VQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGSEA
FT                   PHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVVDSVVEAAPVTTVK
FT                   SVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGGDQ"
FT   gene            505660..506436
FT                   /locus_tag="y0454"
FT   CDS_pept        505660..506436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0454"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 253 of 258 are 78.26 pct identical to
FT                   residues 1 to 253 of 258 from E. coli K12 : B3839"
FT                   /db_xref="EnsemblGenomes-Gn:y0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84043"
FT                   /db_xref="GOA:A0A3N4B6D7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6D7"
FT                   /protein_id="AAM84043.1"
FT                   /translation="MAVDDTQPLISHLIELRKRLLNCIITILVVFLVLVFFANDIYNLV
FT                   SAPLIKQLPAGASMIATDVASPFFTPIKLTMMVSVFVSAPMTLYQVWAFIAPALYKHER
FT                   RLMVPLLISSSLLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMALFM
FT                   AFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVGAFVVGMLLTPPDVLSQTLLAIPM
FT                   YLLFEVGVFFARFYTGKQRRAATEEDEGIDSHPKAP"
FT   gene            506492..507031
FT                   /locus_tag="y0455"
FT   CDS_pept        506492..507031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0455"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 165 of 179 are 64.24 pct identical to
FT                   residues 5 to 168 of 206 from E. coli K12 : B3840; residues
FT                   1 to 165 of 179 are 64.84 pct identical to residues 5 to
FT                   168 of 264 from GenPept : >gb|AAG59035.1|AE005615_3
FT                   (AE005615) tatD gene product [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84044"
FT                   /db_xref="GOA:Q8D1I1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I1"
FT                   /protein_id="AAM84044.1"
FT                   /translation="MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLAA
FT                   QTLAAEYPGYCWSTTGVHPHHASSWQDSVEQKIRTLAATASVVGIGECGLDFNRNFSTP
FT                   AQQEVAFTAQLALAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSDCNE
FT                   RCNSDPHPTPEIRSRG"
FT   mobile_element  506972..508925
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            507058..508080
FT                   /locus_tag="y0456"
FT   CDS_pept        507058..508080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0456"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 340 of 340 are 100.00 pct
FT                   identical to residues 1 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84045"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAM84045.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            508077..508859
FT                   /locus_tag="y0457"
FT   CDS_pept        508077..508859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0457"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 260 of 260 are 100.00 pct identical to
FT                   residues 1 to 260 of 260 from GenPept : >gb|AAC69770.1|
FT                   (AF074612) putative transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84046"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM84046.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            508898..509233
FT                   /locus_tag="y0458"
FT   CDS_pept        508898..509233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0458"
FT                   /product="hypothetical protein"
FT                   /note="residues 33 to 108 of 111 are 65.78 pct identical to
FT                   residues 34 to 109 of 113 from E. coli K12 : B3841;
FT                   residues 12 to 111 of 111 are 67.00 pct identical to
FT                   residues 160 to 259 of 260 from GenPept : >gb|AAL22820.1|
FT                   (AE008885) putative hydrolase of PHP superfamily
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84047"
FT                   /db_xref="GOA:Q8D1I0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1I0"
FT                   /protein_id="AAM84047.1"
FT                   /translation="MDHFSSVVDSDELDACLALGLSIGITGWVCDERRGLDLRALLPRI
FT                   PVQQLLLETDAPYLLPRDLNPKPASRRNEPCFLPHIVQQVAAWRQEDPNWLGQKTDENA
FT                   RRVFRLV"
FT   gene            509248..510270
FT                   /gene="hemB"
FT                   /locus_tag="y0459"
FT   CDS_pept        509248..510270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="y0459"
FT                   /product="5-aminolevulinate dehydratase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="porphobilinogen synthase; residues 12 to 331 of 340
FT                   are 43.43 pct identical to residues 17 to 330 of 335 from
FT                   E. coli K12 : B0369; residues 1 to 340 of 340 are 100.00
FT                   pct identical to residues 1 to 340 of 340 from GenPept :
FT                   >emb|CAC93239.1| (AJ414158) delta-aminolevulinic acid
FT                   dehydratase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84048"
FT                   /db_xref="GOA:A0A3N4B8A5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8A5"
FT                   /protein_id="AAM84048.1"
FT                   /translation="MSYAFPGTFPGRRMRRVRCHDFSRRLVAENHLTVNDLIYPVFVME
FT                   GTHQQQAVSSMPGVSRMTIDLLLKEAEAIAKLGVPVISLFPVIEAGKKSLYAEEAYNPD
FT                   GLVQRTVRALKDAVPELGILTDVALDPYTTHGQDGVIDSDGYVINDVTKEILVRQALSH
FT                   AEAGAEIIAPSDMMDGRIGAIRDQLERQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSN
FT                   LKGGDKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
FT                   "
FT   gene            complement(510380..510868)
FT                   /gene="rfaH"
FT                   /locus_tag="y0460"
FT   CDS_pept        complement(510380..510868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="y0460"
FT                   /product="transcriptional activator"
FT                   /function="regulator; macromolecule metabolism:
FT                   Lipopolysaccharide"
FT                   /note="affecting biosynthesis of lipopolysaccharide core, F
FT                   pilin, and haemolysin; residues 1 to 161 of 162 are 63.97
FT                   pct identical to residues 1 to 161 of 162 from E. coli K12
FT                   : B3842; residues 1 to 161 of 162 are 70.18 pct identical
FT                   to residues 1 to 161 of 162 from GenPept : >emb|CAA10615.1|
FT                   (AJ132239) transcriptional activator [Pectobacterium
FT                   chrysanthemi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84049"
FT                   /db_xref="GOA:A0A3N4B9A5"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9A5"
FT                   /protein_id="AAM84049.1"
FT                   /translation="MKSWYLLYCKRGQILRAKEHLERQTVNCWTPIVAIEKIVRGKRIE
FT                   VIEALFPNYLFAEFDPENIHTTTVSATRGGSHFVRFGTQPAVIPATVIADMQAHAVDKI
FT                   IAPEVPKPGDIVKIIDGVFAGLQAIYTEPDGEARSMLLLNMLNSQIKHSLDNRQFEKQ"
FT   gene            511092..512612
FT                   /locus_tag="y0461"
FT   CDS_pept        511092..512612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0461"
FT                   /product="putative oxidoreductase"
FT                   /note="residues 9 to 501 of 506 are 89.04 pct identical to
FT                   residues 1 to 493 of 497 from E. coli K12 : B3843; residues
FT                   9 to 501 of 506 are 89.04 pct identical to residues 1 to
FT                   493 of 497 from GenPept : >gb|AAG59037.1|AE005615_5
FT                   (AE005615) putative oxidoreductase [Escherichia coli
FT                   O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84050"
FT                   /db_xref="GOA:Q0WAP0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WAP0"
FT                   /protein_id="AAM84050.1"
FT                   /translation="MAHPIAAEMISMKYRDLRDFLSLLEQRGELKRISQPIDPYLEMTE
FT                   IADRTLRAGGPALLFENPKGYSMPVLCNLFGTAKRVAMGMGQEDVSALRDVGKLLAFLK
FT                   EPDPPKGFRDLFDKLPKFKQVLNMPTKRLNSAPCQEQVWQGEDVDLSRIPVMHCWPEDA
FT                   APLVSWGLTITRGPHKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDYQEWCEAHPGER
FT                   FPVAVALGADPATILAAVTPVPDTLSEYAFAGLLRGHKTEVVKCLSNDLEVPASAEIVL
FT                   EGYIEQGDMAPEGPYGDHTGYYNEIDNFPVFTVTHITQRQDAIYHSTYTGRPPDEPAVM
FT                   GVALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGIWSFLRQ
FT                   FMYTKFVIVCDDDINARDWNDVIWAITTRMDPSRDTVLIENTPIDYLDFASPVSGLGSK
FT                   MGLDATNKWPAETPREWGRPIKMDEDVRARIDALWDELAIFSDKDAKR"
FT   gene            512625..513368
FT                   /gene="ubiB"
FT                   /locus_tag="y0462"
FT   CDS_pept        512625..513368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="y0462"
FT                   /product="ferrisiderophore reductase"
FT                   /function="enzyme; energy metabolism, carbon: Electron
FT                   transport"
FT                   /note="flavin reductase; NADPH:flavin oxidoreductase;
FT                   residues 15 to 247 of 247 are 77.68 pct identical to
FT                   residues 1 to 233 of 233 from E. coli K12 : B3844; residues
FT                   15 to 247 of 247 are 79.82 pct identical to residues 1 to
FT                   233 of 233 from GenPept : >emb|CAD07913.1| (AL627278)
FT                   flavin reductase [Salmonella enterica subsp. enterica
FT                   serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84051"
FT                   /db_xref="GOA:Q8D1H8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1H8"
FT                   /protein_id="AAM84051.1"
FT                   /translation="MYLVLHLMTRQREGMTTLSCKVTSVEAITDTVYRVQLVPESSFSF
FT                   RAGQYLMVVMDERDKRPFSMASTPFQQDFIELHIGASELNLYAMAVMDRILKEKKLDVD
FT                   IPHGDAWFREGSKRPLVLIAGGTGFSYARSILLAALAEQPDREVSIYWGGREAVHLYDL
FT                   GELEALSIKYPQLKVIPVVEQPEEGWRGRTGTVLSAVLQDYGSLAEQDIYIAGRFEMAK
FT                   IARERFCVERGAQEEHIFGDAFAFI"
FT   gene            complement(513528..514691)
FT                   /gene="fadA"
FT                   /locus_tag="y0463"
FT   CDS_pept        complement(513528..514691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="y0463"
FT                   /product="thiolase I"
FT                   /function="enzyme; degradation of small molecules; Fatty
FT                   acids"
FT                   /note="3-ketoacyl-CoA thiolase; acetyl-CoA transferase;
FT                   residues 1 to 387 of 387 are 80.36 pct identical to
FT                   residues 1 to 387 of 387 from E. coli K12 : B3845; residues
FT                   1 to 387 of 387 are 80.62 pct identical to residues 1 to
FT                   387 of 387 from GenPept : >gb|AAG59039.1|AE005615_7
FT                   (AE005615) thiolase I; 3-ketoacyl-CoA thiolase; acetyl-CoA
FT                   transferase [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84052"
FT                   /db_xref="GOA:Q8ZAM9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAM9"
FT                   /protein_id="AAM84052.1"
FT                   /translation="MENVVIIDAVRTPMGRSKGGAFRHVRAEDLSAHLMRAVISRNPGL
FT                   NAAEIDDIYWGCVQQTLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDGARA
FT                   IMVGDAKISLIGGVEHMGHVPMNHGVDFHPGMGRTVAKAAGMMGLTAEMLAKIHNISRQ
FT                   SQDEFAFRSHQRAYAATQAGHFAKEIVATNGHDAEGVLKRFDFDEVIRPETNLSGLAAL
FT                   RPAFDPVNGTVTAGTSSALSDGASAMLIMSESRAKSLGLTPRARIRSMAVVGCDPSIMG
FT                   YGPVPASQLALKRAGLELADIGLFELNEAFAAQSLACLKGLGLLESMDDKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMERRDVQFGLATMCIGLGQGIATVFERL"
FT   gene            complement(514703..516892)
FT                   /gene="fadB"
FT                   /locus_tag="y0464"
FT   CDS_pept        complement(514703..516892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="y0464"
FT                   /product="4-enzyme protein: 3-hydroxyacyl-CoA
FT                   dehydrogenase; 3-hydroxybutyryl-CoA epimerase;
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; enoyl-CoA
FT                   hydratase"
FT                   /function="enzyme; degradation of small molecules; Fatty
FT                   acids"
FT                   /note="residues 1 to 715 of 729 are 77.34 pct identical to
FT                   residues 1 to 715 of 729 from E. coli K12 : B3846; residues
FT                   1 to 715 of 729 are 77.48 pct identical to residues 1 to
FT                   715 of 729 from GenPept : >dbj|BAB38197.1| (AP002567)
FT                   3-hydroxyacyl-CoA dehydrogenase/ 3-hydroxybutyryl-CoA
FT                   epimerase/ delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/
FT                   enoyl-CoA hydratase [Escherichia coli O157:H7]"
FT                   /db_xref="EnsemblGenomes-Gn:y0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84053"
FT                   /db_xref="GOA:Q8ZAN0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAN0"
FT                   /protein_id="AAM84053.1"
FT                   /translation="MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNV
FT                   LEKQSELKGLLLRSAKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVP
FT                   TISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSA
FT                   LEIIATGKDVTANDALKIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPL
FT                   KLNPTEAAMCFTIAKGRVMQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLA
FT                   GSNEARALVGIFLNDQYVKAQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVI
FT                   MKDINENSLDLGMNEAAKLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEA
FT                   VVENPKVKAAVLAEVEALIGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRM
FT                   PLVEIIRGAKTSDKTLAAVVAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDG
FT                   GDFHQIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMF
FT                   DNQRFGQKNGQGFYRYTQDAKGKPRKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPM
FT                   INEVVRCLEEGIIASAAEGDMALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLG
FT                   ALYHVPAGLRAKAEHNESYYPVAAALLDVSTNQPA"
FT   gene            517216..518550
FT                   /gene="pepQ"
FT                   /locus_tag="y0465"
FT   CDS_pept        517216..518550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="y0465"
FT                   /product="proline dipeptidase"
FT                   /function="enzyme; degradation of proteins, peptides,
FT                   glyco"
FT                   /note="residues 2 to 444 of 444 are 73.58 pct identical to
FT                   residues 1 to 443 of 443 from E. coli K12 : B3847; residues
FT                   2 to 444 of 444 are 74.71 pct identical to residues 1 to
FT                   443 of 443 from GenPept : >gb|AAL22828.1| (AE008886)
FT                   proline dipeptidase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84054"
FT                   /db_xref="GOA:Q0WAP4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WAP4"
FT                   /protein_id="AAM84054.1"
FT                   /translation="MMETLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLD
FT                   DRDYPFKVNPQFKAWVPVTEVPNCWLWVDGVNTPKLWFYSPVDYWHSVEPLPDSFWTKN
FT                   IDVQPLLNADDIAQQLPVQRERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYK
FT                   TDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALN
FT                   EHSAVLHYTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYTADRDSDFAALISDLNTE
FT                   QLALIDTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGH
FT                   PLGLQVHDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWR
FT                   IGEFSKHFNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA"
FT   mobile_element  518719..519428
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            518813..519322
FT                   /locus_tag="y0466"
FT   CDS_pept        518813..519322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0466"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 100.00 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84055"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAM84055.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            519395..519871
FT                   /locus_tag="y0467"
FT   CDS_pept        519395..519871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0467"
FT                   /product="hypothetical protein"
FT                   /note="residues 11 to 157 of 158 are 63.26 pct identical to
FT                   residues 57 to 203 of 205 from E. coli K12 : B3848;
FT                   residues 11 to 157 of 158 are 63.26 pct identical to
FT                   residues 57 to 203 of 205 from GenPept :
FT                   >gb|AAG59042.1|AE005615_10 (AE005615) orf, hypothetical
FT                   protein [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84056"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1H6"
FT                   /protein_id="AAM84056.1"
FT                   /translation="MKNLRLCRRIFIAGPPTDSQQLGFSDDGEPSGTAGKPILAQLMGS
FT                   DIGEITAVVVRYYGGIKLGTGGLVKAYGSGVQQALKQVAVKYKVPQVEYTLQCDYAQLA
FT                   MVEMLLQQVEGQILRGEYTELVTLHLTLPATQASQVGDKLRDLSRGTLQLTPIS"
FT   gene            519911..521362
FT                   /gene="trkH"
FT                   /locus_tag="y0468"
FT   CDS_pept        519911..521362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="y0468"
FT                   /product="potassium uptake protein"
FT                   /function="transport; transport of small molecules;
FT                   cations"
FT                   /note="requires TrkE; residues 1 to 417 of 483 are 88.48
FT                   pct identical to residues 1 to 417 of 432 from E. coli K12
FT                   : B3849; residues 1 to 483 of 483 are 88.61 pct identical
FT                   to residues 1 to 483 of 483 from GenPept :
FT                   >gb|AAG59043.1|AE005615_11 (AE005615) potassium uptake
FT                   protein, requires TrkE [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84057"
FT                   /db_xref="GOA:A0A3N4BKK3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKK3"
FT                   /protein_id="AAM84057.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMFIPGLVALIYRDGAGRAFSETFFV
FT                   AVSIGLLLWLPNRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSLTDAFFE
FT                   SFSGLTTTGATTLVGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWGAGMSVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIGIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRMFIFVQ
FT                   LTLVIVCTLVLWQHSVYKSGIETLNQAFFQVVSMATTAGFTTDSIAKWPLFLPLLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLYLQGSRELKRLVHPNAVYTIKLGRRALPERILEAVWG
FT                   FFSAYALVFIISMLAIVATGVDEFSAFAAVTATLNNLGPGLGVVADNFTSMNPAAKWIL
FT                   VITMLFGRLEVFTLLVLFTPTFWRE"
FT   gene            521384..521917
FT                   /gene="hemG"
FT                   /locus_tag="y0469"
FT   CDS_pept        521384..521917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="y0469"
FT                   /product="protoporphyrin oxidase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="residues 1 to 176 of 177 are 54.80 pct identical to
FT                   residues 1 to 177 of 181 from E. coli K12 : B3850; residues
FT                   1 to 176 of 177 are 55.36 pct identical to residues 1 to
FT                   177 of 181 from GenPept : >emb|CAD07906.1| (AL627278)
FT                   protoporphyrinogen oxidase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84058"
FT                   /db_xref="GOA:A0A3N4BAR2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAR2"
FT                   /protein_id="AAM84058.1"
FT                   /translation="MKILILYSSRDGQTKTIASYIAKQLTEAATCEIQDLSQVGQIDLS
FT                   QYQQVIIGASVRYGHFSPVLNKFVNKHVAQLSQMPSAFFAVNLTARKPEKRSPQTNTYV
FT                   RKFLLNTPWQPTLCSVFAGALRYPRYSWIDRIMIQLIMRMTGGETDTSKEVEYTDWQEV
FT                   SRFTQDFLALQYKK"
FT   gene            522393..523977
FT                   /locus_tag="yr008"
FT   rRNA            522393..523977
FT                   /locus_tag="yr008"
FT                   /product="16S ribosomal RNA"
FT   gene            524037..524110
FT                   /locus_tag="yt010"
FT   tRNA            524037..524110
FT                   /locus_tag="yt010"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon: GAT"
FT   gene            524165..524237
FT                   /locus_tag="yt011"
FT   tRNA            524165..524237
FT                   /locus_tag="yt011"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon: TGC"
FT   gene            524459..527365
FT                   /locus_tag="yr009"
FT   rRNA            524459..527365
FT                   /locus_tag="yr009"
FT                   /product="23S ribosomal RNA"
FT   gene            527473..527592
FT                   /locus_tag="yr010"
FT   rRNA            527473..527592
FT                   /locus_tag="yr010"
FT                   /product="5S ribosomal RNA"
FT   gene            528054..529091
FT                   /gene="murB"
FT                   /locus_tag="y0471"
FT   CDS_pept        528054..529091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="y0471"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /function="enzyme; murein sacculus, peptidoglycan"
FT                   /note="residues 7 to 345 of 345 are 61.94 pct identical to
FT                   residues 4 to 342 of 342 from E. coli K12 : B3972; residues
FT                   7 to 345 of 345 are 62.53 pct identical to residues 4 to
FT                   342 of 342 from GenPept : >gb|AAL22970.1| (AE008893)
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84059"
FT                   /db_xref="GOA:Q8ZAN4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAN4"
FT                   /protein_id="AAM84059.1"
FT                   /translation="MSNQRSSLKHLNTFALPAYASNVISAGSVETLIAAWHESKAKRQP
FT                   VLLLGEGSNVLFIKNFSGTVLLNRIMGITSTEDSAAWYLHVGAGENWHQLVCHSLQNNM
FT                   PGLENLALIPGCVGSAPIQNIGAYGVELKQVCEYVDLLDMDKGTIQRISAEECQFGYRD
FT                   SIFKHRYGNGFAIVSVGIKLMKSWTPTLGYGDLIHMDPLTVTATDIFNSVCTMRRSKLP
FT                   DPMVTGNAGSFFKNPVVSAAIAEEIVHCYPNAPHYLQPDGSVKLAAGWLIDQCSLKGYQ
FT                   IGGAAVHQQQALVLINQSEATGQDVIHLARYIRQQVAQRFSIWLEPEVRFIADNGEVNA
FT                   VEHLS"
FT   gene            528202..528384
FT                   /locus_tag="y0470"
FT   CDS_pept        528202..528384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0470"
FT                   /product="hypothetical"
FT                   /note="residues 9 to 58 of 60 are 34.00 pct identical to
FT                   residues 247 to 295 of 436 from GenPept :
FT                   >gb|AAD22321.1|AC006955_7 (AC006955) hypothetical protein
FT                   [Arabidopsis thaliana]"
FT                   /db_xref="EnsemblGenomes-Gn:y0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84060"
FT                   /db_xref="GOA:Q8CLR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR5"
FT                   /protein_id="AAM84060.1"
FT                   /translation="MKVAMCYLLKISLGQYYSIGLWGLLLPKTVLLGIYMSVLGKIGIN
FT                   WYVIHCKIICRGWKI"
FT   gene            529088..530047
FT                   /gene="birA"
FT                   /locus_tag="y0472"
FT   CDS_pept        529088..530047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="y0472"
FT                   /product="biotin-[acetyl CoA carboxylase] holoenzyme
FT                   synthetase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Biotin"
FT                   /note="biotin operon repressor; residues 1 to 317 of 319
FT                   are 75.70 pct identical to residues 1 to 317 of 321 from E.
FT                   coli K12 : B3973; residues 1 to 317 of 319 are 76.34 pct
FT                   identical to residues 1 to 317 of 321 from GenPept :
FT                   >gb|AAG59173.1|AE005629_2 (AE005629) biotin-[acetylCoA
FT                   carboxylase] holoenzyme synthetase and biotin operon
FT                   repressor [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84061"
FT                   /db_xref="GOA:A0A3N4B6C4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B6C4"
FT                   /protein_id="AAM84061.1"
FT                   /translation="MKDIRVPLRLVSILSDGFFHSGEQLGETLGMSRAAINKHMQTIRD
FT                   WGLDVFTVPGKGYSLPTSIQLLDEQKILSYLPTGHVTVLPVVDSTNQYLLDRITELKSG
FT                   DACVAEYQQAGRGRRGRQWVSPFGANLYLSMYWRLEQGPAAAMGLSLVVGIVMAEVLQN
FT                   LGAEKVRVKWPNDLYLNDKKLAGILVELTGKTGDAAQLVIGAGINLTMRGSETNAINQD
FT                   WINLQDAGVTIDRNKLTAEILSELRLAVVKFENEGLSAFLSRWQKMDNYLNRPVKLIIG
FT                   NQEIFGIARGIDQQGALLLEQDGNIKPYIGGEISLRGV"
FT   gene            complement(530082..531032)
FT                   /gene="coaA"
FT                   /locus_tag="y0473"
FT   CDS_pept        complement(530082..531032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="y0473"
FT                   /product="pantothenate kinase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Pantothenate"
FT                   /note="residues 1 to 316 of 316 are 85.75 pct identical to
FT                   residues 1 to 316 of 316 from E. coli K12 : B3974; residues
FT                   1 to 316 of 316 are 85.75 pct identical to residues 1 to
FT                   316 of 316 from GenPept : >gb|AAL22972.1| (AE008893)
FT                   pantothenate kinase [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84062"
FT                   /db_xref="GOA:Q8ZAN6"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAN6"
FT                   /protein_id="AAM84062.1"
FT                   /translation="MTKREQSLATPYLQFDRTQWAALRDSVPLTLTEEEIVKLKGINED
FT                   LSLDEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQRIPYVIGIAGSVAVGKSTT
FT                   ARLLQALLSRWPEHRSVELITTDGFLHPNKVLNERGLMKKKGFPESYDMHNLVKFVSEV
FT                   KSGADYVTAPVYSHLIYDVVPDGNKVIKQPDILILEGLNVLQSGMDYPHDPHHVFVSDF
FT                   VDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNYAKLPETEAIKIATQLWNEI
FT                   NGLNLKQNILPTRERASLIMTKSANHAVESVRLRK"
FT   gene            complement(531243..531827)
FT                   /locus_tag="y0474"
FT   CDS_pept        complement(531243..531827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0474"
FT                   /product="putative acetyltransferase"
FT                   /note="residues 17 to 182 of 194 are 47.59 pct identical to
FT                   residues 9 to 173 of 177 from GenPept : >emb|CAA35037.1|
FT                   (X17150) acetyltransferase (AA 1-177) [Pseudomonas
FT                   syringae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84063"
FT                   /db_xref="GOA:Q8D1H5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1H5"
FT                   /protein_id="AAM84063.1"
FT                   /translation="MWITIAPFVTIMKIVLLNAATFPIYRSGLASLLIDAVTYGASVGY
FT                   NTHTLSQEEAEGYFHSLRPAIEREALLLWIARDEIGIIGTIQLVLCQKPNGLNRAEIQK
FT                   LLVHSRSRRTGIGHKLIIAAENTAVQLRRGLIYLDTQSGSSAESFYRAQGYRYVGEIPD
FT                   YACTPNGNYHPTAIYFKRLFTVVQPHTAIQN"
FT   mobile_element  531798..533751
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            531884..532906
FT                   /locus_tag="y0475"
FT   CDS_pept        531884..532906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0475"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 340 of 340 are 100.00 pct
FT                   identical to residues 1 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84064"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAM84064.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            532903..533685
FT                   /locus_tag="y0476"
FT   CDS_pept        532903..533685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0476"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 260 of 260 are 100.00 pct identical to
FT                   residues 1 to 260 of 260 from GenPept : >gb|AAC69770.1|
FT                   (AF074612) putative transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84065"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM84065.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            534149..534221
FT                   /locus_tag="yt012"
FT   tRNA            534149..534221
FT                   /locus_tag="yt012"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: TGT"
FT   gene            534243..534324
FT                   /locus_tag="yt013"
FT   tRNA            534243..534324
FT                   /locus_tag="yt013"
FT                   /product="tRNA-Tyr"
FT                   /note="anticodon: GTA"
FT   gene            534477..534548
FT                   /locus_tag="yt014"
FT   tRNA            534477..534548
FT                   /locus_tag="yt014"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: TCC"
FT   gene            534558..534630
FT                   /locus_tag="yt015"
FT   tRNA            534558..534630
FT                   /locus_tag="yt015"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: GGT"
FT   gene            534742..535926
FT                   /gene="tufB"
FT                   /locus_tag="y0477"
FT   CDS_pept        534742..535926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="y0477"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /function="factor; proteins - translation and modification"
FT                   /note="duplicate of tufA; residues 1 to 393 of 394 are
FT                   93.63 pct identical to residues 1 to 393 of 394 from E.
FT                   coli K12 : B3980; residues 1 to 393 of 394 are 93.89 pct
FT                   identical to residues 1 to 393 of 394 from GenPept :
FT                   >gb|AAL22974.1| (AE008893) protein chain elongation factor
FT                   EF-Tu (duplicate of tufA) [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84066"
FT                   /db_xref="GOA:Q8ZAN8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAN8"
FT                   /protein_id="AAM84066.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDDVQRGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNVNMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            536162..536560
FT                   /gene="secE"
FT                   /locus_tag="y0478"
FT   CDS_pept        536162..536560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="y0478"
FT                   /product="preprotein translocase"
FT                   /function="transport; protein, peptide secretion"
FT                   /note="residues 6 to 132 of 132 are 85.82 pct identical to
FT                   residues 1 to 127 of 127 from E. coli K12 : B3981; residues
FT                   6 to 132 of 132 are 86.61 pct identical to residues 1 to
FT                   127 of 127 from GenPept : >gb|AAL22975.1| (AE008893)
FT                   preprotein translocase IISP family, membrane subunit
FT                   [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84067"
FT                   /db_xref="GOA:Q8D1H4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1H4"
FT                   /protein_id="AAM84067.1"
FT                   /translation="MTGWFMSANTEAPGSGRGLETAKWLIVAVLLVVAIVGNYYYREYS
FT                   LPLRALAVVVIIAVAGAVALMTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAA
FT                   VTAVMSLILWGLDGILVRLVSFITGLRF"
FT   gene            536562..537107
FT                   /gene="nusG"
FT                   /locus_tag="y0479"
FT   CDS_pept        536562..537107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="y0479"
FT                   /product="component in transcription antitermination"
FT                   /function="putative factor; RNA synthesis, modification,
FT                   DNA transcription"
FT                   /note="residues 1 to 180 of 181 are 97.22 pct identical to
FT                   residues 1 to 180 of 181 from E. coli K12 : B3982; residues
FT                   1 to 180 of 181 are 97.77 pct identical to residues 1 to
FT                   180 of 181 from GenPept : >gb|AAL22976.1| (AE008893)
FT                   component in transcription antitermination [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84068"
FT                   /db_xref="GOA:Q8ZAP0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP0"
FT                   /protein_id="AAM84068.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHDMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKG"
FT   gene            537298..537726
FT                   /gene="rplK"
FT                   /locus_tag="y0480"
FT   CDS_pept        537298..537726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="y0480"
FT                   /product="50S ribosomal subunit protein L11"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 1 to 141 of 142 are 90.07 pct identical to
FT                   residues 1 to 141 of 142 from E. coli K12 : B3983; residues
FT                   1 to 141 of 142 are 95.74 pct identical to residues 1 to
FT                   141 of 142 from GenPept : >emb|CAA31095.1| (X12584) L11
FT                   protein (AA 1-142) [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84069"
FT                   /db_xref="GOA:Q8ZAP1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP1"
FT                   /protein_id="AAM84069.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVTSA
FT                   QVREIAETKAADMTGSDVDAMMRSIEGTAHSMGLVVEG"
FT   gene            537730..538434
FT                   /gene="rplA"
FT                   /locus_tag="y0481"
FT   CDS_pept        537730..538434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="y0481"
FT                   /product="50S ribosomal subunit protein L1"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="regulates synthesis of L1 and L11; residues 1 to 234
FT                   of 234 are 91.88 pct identical to residues 1 to 234 of 234
FT                   from E. coli K12 : B3984"
FT                   /db_xref="EnsemblGenomes-Gn:y0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84070"
FT                   /db_xref="GOA:Q8ZAP2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP2"
FT                   /protein_id="AAM84070.1"
FT                   /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMDDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDSDKLKENLESLVVALKKAKPATAKGIYIKKISLSTTMGAGV
FT                   AIDQSGLTAVVN"
FT   gene            538799..539296
FT                   /gene="rplJ"
FT                   /locus_tag="y0482"
FT   CDS_pept        538799..539296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="y0482"
FT                   /product="50S ribosomal subunit protein L10"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 1 to 165 of 165 are 90.30 pct identical to
FT                   residues 1 to 165 of 165 from E. coli K12 : B3985; residues
FT                   1 to 165 of 165 are 90.30 pct identical to residues 1 to
FT                   165 of 165 from GenPept : >gb|AAL22979.1| (AE008894) 50S
FT                   ribosomal subunit protein L10 [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84071"
FT                   /db_xref="GOA:Q8ZAP3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP3"
FT                   /protein_id="AAM84071.1"
FT                   /translation="MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRAG
FT                   REAGVHMQVVRNTLLRRIVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            539363..539731
FT                   /gene="rplL"
FT                   /locus_tag="y0483"
FT   CDS_pept        539363..539731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="y0483"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /function="structural component; ribosomal proteins -
FT                   synthesis, modification"
FT                   /note="residues 3 to 122 of 122 are 79.16 pct identical to
FT                   residues 2 to 121 of 121 from E. coli K12 : B3986"
FT                   /db_xref="EnsemblGenomes-Gn:y0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84072"
FT                   /db_xref="GOA:Q8ZAP4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP4"
FT                   /protein_id="AAM84072.1"
FT                   /translation="MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAA
FT                   AVEAAEEQTEFDVVLASFGENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDE
FT                   AETLKKSLEEAGASVEIK"
FT   gene            540074..544102
FT                   /gene="rpoB"
FT                   /locus_tag="y0484"
FT   CDS_pept        540074..544102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="y0484"
FT                   /product="RNA polymerase, beta subunit"
FT                   /function="enzyme; RNA synthesis, modification, DNA
FT                   transcription"
FT                   /note="residues 1 to 1342 of 1342 are 94.63 pct identical
FT                   to residues 1 to 1342 of 1342 from E. coli K12 : B3987;
FT                   residues 1 to 1342 of 1342 are 95.23 pct identical to
FT                   residues 1 to 1342 of 1342 from GenPept : >gb|AAL22981.1|
FT                   (AE008894) RNA polymerase, beta subunit [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84073"
FT                   /db_xref="GOA:Q8ZAP5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP5"
FT                   /protein_id="AAM84073.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNFTTAQILD
FT                   LFFEKVVFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKARRITARHIRQLEKDG
FT                   IDRIEVPVEYIAGKVVAKDYVDASTGELICAANMELSLDLLAKLSQAGHKQIETLFTND
FT                   LDHGAYISETLRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKEDITEVMKKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGVVTDEINYLSAIEEGNFVIAQANSNLDDEGRFLEDLVT
FT                   CRSKGESSLFSREQVDYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGTVQYVDASRIVIKVNEDEMHPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHAVLVSGGIEAEKL
FT                   SKLPRERWLELGLTDEDKQNQLEQLAEQYDEMKSEFEKKMDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKKQEEVAKLREFIQKAYDLGDNVCQKVDLSTFTD
FT                   DEVLRLAENLKKGMPIATPVFDGATEKEIKELLQLGGLPTSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLLKEIRSLGINIELEEE"
FT   gene            544195..548451
FT                   /gene="rpoC"
FT                   /locus_tag="y0485"
FT   CDS_pept        544195..548451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="y0485"
FT                   /product="RNA polymerase, beta prime subunit"
FT                   /function="enzyme; RNA synthesis, modification, DNA
FT                   transcription"
FT                   /note="residues 13 to 1416 of 1418 are 92.80 pct identical
FT                   to residues 1 to 1404 of 1407 from E. coli K12 : B3988"
FT                   /db_xref="EnsemblGenomes-Gn:y0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84074"
FT                   /db_xref="GOA:Q8D1H3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1H3"
FT                   /protein_id="AAM84074.1"
FT                   /translation="MPIRSNSDRSQSVKDLLKFLKAQTKTEEFDAIKIALASPDMIRSW
FT                   SFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEV
FT                   TQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGM
FT                   TNLERRQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKNMDLEAECEILREELNETNS
FT                   ETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLY
FT                   RRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLA
FT                   DMIKGKQGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLEL
FT                   RGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKA
FT                   IQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQD
FT                   VVLGLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEEIRNTEGESI
FT                   TRTSIIDTTVGRAILWMIVPQGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQ
FT                   IMYTGFAYAARSGASVGIDDMVIPEAKAGIIEEAETEVAEIQEQFQSGLVTAGERYNKV
FT                   IDIWAAANERVAKAMMDNLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLA
FT                   GMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRL
FT                   VDVAQDLVVTEDDCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVIKPGSADILVP
FT                   RNTLLDEKWCDLLEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEAVGVI
FT                   AAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLSNVKFVTNAAGKLVITS
FT                   RNTELKLIDEFGRTKESYKVPYGAVMAKGDGAEVQGGETVANWDPHIMPVVTEVSGFIR
FT                   FADMVDGQTITRQTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGNDVLIPGTDM
FT                   PAQYFLPGKAIVQLEDGIQIGAGDTLARIPQESSGTKDITGGLPRVADLFEARRPKEPA
FT                   ILAEISGIISFGKETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVVERGDVVSDG
FT                   PESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVDAGST
FT                   DFLEGEQAEMSRVKIANRKLAAEGKIEATFTRDLLGITKASLATESFISAASFQETTRV
FT                   LTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGEAPVVPQVSADEAT
FT                   ANLAELLNAGFGNNKG"
FT   mobile_element  complement(548472..549181)
FT                   /mobile_element_type="insertion sequence:IS1541a"
FT                   /note="insertion element"
FT   gene            complement(548578..549087)
FT                   /locus_tag="y0486"
FT   CDS_pept        complement(548578..549087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0486"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1541a; residues 1 to 169 of 169 are 100.00 pct
FT                   identical to residues 1 to 169 of 169 from GenPept :
FT                   >gb|AAC82673.1| (AF074611) transposase [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84075"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAM84075.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(549468..550613)
FT                   /gene="thiH"
FT                   /locus_tag="y0487"
FT   CDS_pept        complement(549468..550613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="y0487"
FT                   /product="thiH protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="thiamin biosynthesis, thiazole moiety; residues 10
FT                   to 379 of 381 are 79.72 pct identical to residues 4 to 373
FT                   of 377 from E. coli K12 : B3990; residues 10 to 379 of 381
FT                   are 80.27 pct identical to residues 4 to 373 of 377 from
FT                   GenPept : >gb|AAG59186.1|AE005631_1 (AE005631) thiamin
FT                   biosynthesis, thiazole moiety [Escherichia coli O157:H7
FT                   EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84076"
FT                   /db_xref="GOA:Q8D1H2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1H2"
FT                   /protein_id="AAM84076.1"
FT                   /translation="MRSKTMSEDFNQRWQQLDWDDISLTINSKKPADVERALNAIKPTR
FT                   EDLMALISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSN
FT                   RIKRKTLDEAEIIRECEAIKALGFEHLLLVTGEHQTKVGMDYFRRHLPTIRSRFSSLMM
FT                   EVQPLAEDEYTELKALGLDGVMVYQETYHPATYQQHHLRGHKQDFHWRLATPDRLGRAG
FT                   IDKIGLGALIGLSNSWRTDCYMLAEHLFYLQQTYWQTRYSISFPRLRPCAGGIEPASIM
FT                   SEPQLLQLICAFRLFAPDVELSLSTRESPFFRDNVIPVAINNVSAGSKTQPGGYADDHP
FT                   ELEQFAPHDNRSPEQVAQALTKAGLQPVWKDWDSHLGRSLR"
FT   gene            complement(550591..551592)
FT                   /gene="thiG"
FT                   /locus_tag="y0488"
FT   CDS_pept        complement(550591..551592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="y0488"
FT                   /product="thiG protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="thiamin biosynthesis, thiazole moiety; residues 41
FT                   to 324 of 333 are 70.42 pct identical to residues 4 to 277
FT                   of 281 from E. coli K12 : B3991; residues 63 to 327 of 333
FT                   are 75.09 pct identical to residues 1 to 255 of 256 from
FT                   GenPept : >gb|AAL22988.1| (AE008894) deoxyxylulose-5-P +
FT                   thi-S-COSH + tyrosine =
FT                   4-methyl-5-(beta-hydroxyethyl)thiazole-P +
FT                   4-hydroxy-benzyl-alcohol + C1 of tyrosine [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84077"
FT                   /db_xref="GOA:Q8ZAP9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAP9"
FT                   /protein_id="AAM84077.1"
FT                   /translation="MTSHWRWSAISPPRCCLINLNTTSREPHWLLIRSLFRAPIGKIIG
FT                   CKRVIIFCCSKPLPEDDMLKIADTTFTSRLFTGTGKFSSPELMLEALRASGSQLITMAM
FT                   KRVDLQSGNDAILAPLRQLGVRLLPNTSGAKTAEEAIFAARLAREALNTHWVKLEIHPD
FT                   VRYLLPDPIETLKAAEVLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGSPIGSNLG
FT                   LRTRDFLQIIIEQSKVPVVVDAGIGAPSHALEALELGADAVLVNTAIAVAHSPVQMAHA
FT                   FRLAVESGERARLAGLGASPFNPSQPDTLQLRATATSPLTGFLSQLEEQDHV"
FT   gene            complement(551620..552417)
FT                   /gene="thiF"
FT                   /locus_tag="y0489"
FT   CDS_pept        complement(551620..552417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="y0489"
FT                   /product="thiF protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="thiamin biosynthesis, thiazole moiety; residues 13
FT                   to 263 of 265 are 60.55 pct identical to residues 1 to 239
FT                   of 245 from E. coli K12 : B3992; residues 7 to 263 of 265
FT                   are 59.92 pct identical to residues 1 to 245 of 252 from
FT                   GenPept : >emb|CAD09482.1| (AL627279) thiamine biosynthesis
FT                   protein [Salmonella enterica subsp. enterica serovar
FT                   Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84078"
FT                   /db_xref="GOA:A0A2S9PDE6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PDE6"
FT                   /protein_id="AAM84078.1"
FT                   /translation="MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGL
FT                   GSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILYRTADIGQTLSNPTSSVSHNKARLA
FT                   QRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQKPL
FT                   ISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRNCRTAGVLGPVVGVIGTLQALEA
FT                   IKMLAGIPLALSGKLRLFDGKQQSWSTLQLTRAAHCPACGGGL"
FT   gene            complement(552407..553096)
FT                   /gene="thiE"
FT                   /locus_tag="y0490"
FT   CDS_pept        complement(552407..553096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="y0490"
FT                   /product="thiE protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="thiamin biosynthesis, thiazole moiety; residues 18
FT                   to 219 of 229 are 71.28 pct identical to residues 4 to 205
FT                   of 211 from E. coli K12 : B3993; residues 18 to 217 of 229
FT                   are 71.49 pct identical to residues 4 to 203 of 211 from
FT                   GenPept : >emb|CAD09481.1| (AL627279) thiamine-phosphate
FT                   pyrophosphorylase [Salmonella enterica subsp. enterica
FT                   serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84079"
FT                   /db_xref="GOA:Q8ZAQ1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAQ1"
FT                   /protein_id="AAM84079.1"
FT                   /translation="MRRPIMSQLDALSPVATPGFPSTEQRLGLYPVVDSLLWIERLLAA
FT                   GVTTLQLRIKNADDAQVEQDIVAAIELGKRYQARLFINDYWQLAVKHGAYGVHLGQEDL
FT                   EAADLAAIQQAGLRLGISTHDEHELAVAKTLRPSYIALGHIFPTQTKQMPSSPQGLASL
FT                   SRQVKNTPDYPTVAIGGISIERVPHVLATGVGSVAVVSAITLASDWQRATAQLLHLIEG
FT                   KELADEK"
FT   gene            complement(553068..555113)
FT                   /gene="thiC"
FT                   /locus_tag="y0491"
FT   CDS_pept        complement(553068..555113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="y0491"
FT                   /product="thiC protein"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Thiamin"
FT                   /note="thiamin biosynthesis, pyrimidine moiety; residues 23
FT                   to 668 of 681 are 83.12 pct identical to residues 8 to 627
FT                   of 631 from E. coli K12 : B3994"
FT                   /db_xref="EnsemblGenomes-Gn:y0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84080"
FT                   /db_xref="GOA:Q8ZAQ2"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAQ2"
FT                   /protein_id="AAM84080.1"
FT                   /translation="MSNNTTSLPAENSSHPRKGTPIRKKQREEAQQFINTLQGVTFPNS
FT                   QRIYLQGSRPDIQVPMREIQLSPTQIGGSKNEPRYEDNEAIPVYDTSGPYGDPQAKLDV
FT                   HNGLPKLRAAWVADRQDTEALASVSSGFTQQRLADEGLDHLRFEHLPRPRKAATGQCVT
FT                   QLHYARQGKITPEMEFIALRENMGRERIRGEVLLQQHPGQAFGAHLPENITAEFVRQEV
FT                   AAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADT
FT                   VMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTLLEQAEQ
FT                   GVDYFTLHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICQICA
FT                   AYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMI
FT                   RRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHL
FT                   GLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPAT
FT                   ARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAAQEQAAAQAQAATPTTAA
FT                   QPIDITQPINMLQSGMEKMSAEFRSRGSELYHRPANLSAEANNEPT"
FT   gene            complement(555489..555998)
FT                   /locus_tag="y0492"
FT   CDS_pept        complement(555489..555998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0492"
FT                   /product="putative transcriptional regulator"
FT                   /function="putative regulator"
FT                   /note="residues 1 to 147 of 169 are 55.78 pct identical to
FT                   residues 1 to 145 of 158 from E. coli K12 : B3995; residues
FT                   1 to 147 of 169 are 57.14 pct identical to residues 1 to
FT                   145 of 162 from GenPept : >gb|AAL22993.1| (AE008894)
FT                   regulator of sigma D, has binding activity to the major
FT                   sigma subunit of RNAP [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84081"
FT                   /db_xref="GOA:Q7CKT7"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKT7"
FT                   /protein_id="AAM84081.1"
FT                   /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEK
FT                   HTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQT
FT                   IMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADAD
FT                   KKSQVN"
FT   gene            556080..556877
FT                   /locus_tag="y0493"
FT   CDS_pept        556080..556877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0493"
FT                   /product="hypothetical protein"
FT                   /note="residues 14 to 258 of 265 are 76.73 pct identical to
FT                   residues 9 to 253 of 257 from E. coli K12 : B3996; residues
FT                   14 to 262 of 265 are 77.51 pct identical to residues 9 to
FT                   257 of 257 from GenPept : >gb|AAL22994.1| (AE008894)
FT                   putative NTP pyrophosphohydrolases containing a Zn-finger,
FT                   probably nucleic-acid-binding [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84082"
FT                   /db_xref="GOA:Q8ZAQ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAQ5"
FT                   /protein_id="AAM84082.1"
FT                   /translation="MCNNDMELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQG
FT                   TTARQIGEWQGQSVWLIRQMMPSGMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRFCG
FT                   YCGHEMHASRTEWASLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLA
FT                   GFVEVGETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMADYDSGELCHDP
FT                   KELLNAGWYRYDQLPLLPPPGTVARRLIEDTVVLCREHSDLSQ"
FT   gene            556970..557755
FT                   /locus_tag="y0495"
FT   CDS_pept        556970..557755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0495"
FT                   /product="hypothetical"
FT                   /note="residues 65 to 238 of 261 are 24.10 pct identical to
FT                   residues 785 to 972 of 1330 from GenPept : >gb|AAC64407.1|
FT                   (AF095786) kinectin [Vulpes vulpes]"
FT                   /db_xref="EnsemblGenomes-Gn:y0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B694"
FT                   /protein_id="AAM84083.1"
FT                   /translation="MRPIITQTVQPVTSMYPSLPKAFIQDKVMLSLHNKAALDSTIKGD
FT                   AVRALLLHAYVDIKGNEVERRTTAVGIQKLYEEVLQELLYQDPKCISVMISHTANPPTP
FT                   LSIASPERVMQMMHQNIRQDIASQKTITDRTQTLHNLLSYKNQFQYKAIYDQPRLKPEE
FT                   NYNFKMVNDVHENLHSIQTDSCCKAGALTGATYFLQDSPGEIHVFGIRITQANEESGKV
FT                   ELFQGLKSDVQTNNKLDSLYLLLRGNSHQSPDDISSSVG"
FT   gene            complement(557243..557386)
FT                   /locus_tag="y0494"
FT   CDS_pept        complement(557243..557386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0494"
FT                   /product="hypothetical"
FT                   /note="residues 1 to 28 of 47 are 39.28 pct identical to
FT                   residues 274 to 301 of 348 from GenPept : >gb|AAA32198.1|
FT                   (M34832) integrase (int) [Staphylococcus aureus phage phi
FT                   11]"
FT                   /db_xref="EnsemblGenomes-Gn:y0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR4"
FT                   /protein_id="AAM84084.1"
FT                   /translation="MESLRAVSYCFLAGNILPNILVHHLHHSLRASNTQGGWWVSGVRY
FT                   HD"
FT   gene            557874..558941
FT                   /gene="hemE"
FT                   /locus_tag="y0496"
FT   CDS_pept        557874..558941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="y0496"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /function="enzyme; biosynthesis of cofactors, carriers:
FT                   Heme, porphyrin"
FT                   /note="residues 1 to 354 of 355 are 88.41 pct identical to
FT                   residues 1 to 354 of 354 from E. coli K12 : B3997; residues
FT                   1 to 353 of 355 are 89.80 pct identical to residues 1 to
FT                   353 of 354 from GenPept : >emb|CAD09477.1| (AL627279)
FT                   uroporphyrinogen decarboxylase [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84085"
FT                   /db_xref="GOA:Q8ZAQ7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAQ7"
FT                   /protein_id="AAM84085.1"
FT                   /translation="MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRAIAGD
FT                   FMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSPIT
FT                   CRADVEKLPIPDPEQELGYVMNAVRTIRRELAGSVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRDYHEF
FT                   SLNYMHKIVDGLIRENEGRRVPVTLFTKGGGPWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSVLYAPPARIEQEVSTILASFGQGEGHVFNLGHGIHQDVPPAHAGA
FT                   FVNAVHALSRPYHQK"
FT   gene            558971..559711
FT                   /gene="nfi"
FT                   /locus_tag="y0497"
FT   CDS_pept        558971..559711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="y0497"
FT                   /product="endonuclease V (deoxyinosine 3'endoduclease)"
FT                   /function="enzyme; degradation of DNA"
FT                   /note="residues 13 to 236 of 246 are 68.75 pct identical to
FT                   residues 2 to 225 of 225 from E. coli K12 : B3998; residues
FT                   15 to 231 of 246 are 70.96 pct identical to residues 2 to
FT                   218 of 223 from GenPept : >gb|AAL22996.1| (AE008894)
FT                   endonuclease V (deoxyinosine 3'endoduclease) [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84086"
FT                   /db_xref="GOA:Q8ZAQ8"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAQ8"
FT                   /protein_id="AAM84086.1"
FT                   /translation="MVKTKSRVETKSMFDTKALQAEQRQRASEISLHDGIDNQSVRFIA
FT                   GADVGFEQHGEITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWA
FT                   QLQQRPDLILVDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQ
FT                   PLFDNDEQLGWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIA
FT                   SNRPQFQRWLRKNPDFLGKRRDMI"
FT   gene            559757..560347
FT                   /locus_tag="y0498"
FT   CDS_pept        559757..560347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0498"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 196 of 196 are 78.57 pct identical to
FT                   residues 1 to 196 of 196 from E. coli K12 : B3999; residues
FT                   1 to 196 of 196 are 80.10 pct identical to residues 1 to
FT                   196 of 196 from GenPept : >gb|AAL22997.1| (AE008894)
FT                   putative cytoplasmic protein [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84087"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPE7"
FT                   /protein_id="AAM84087.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFIACLCERMYPNYQQFCLETGFGDP
FT                   AVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSSDDYAIYGVYPAIDACIALSEAI
FT                   HSRLSGETLEHAIAISEASIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEIFRL
FT                   LADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
FT   gene            560536..560811
FT                   /gene="hupA"
FT                   /locus_tag="y0499"
FT   CDS_pept        560536..560811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="y0499"
FT                   /product="DNA-binding protein HU-alpha (HU-2)"
FT                   /function="factor; basic proteins - synthesis,
FT                   modification"
FT                   /note="residues 1 to 90 of 91 are 94.44 pct identical to
FT                   residues 1 to 90 of 90 from E. coli K12 : B4000; residues 1
FT                   to 90 of 91 are 95.55 pct identical to residues 1 to 90 of
FT                   90 from GenPept : >gb|AAA65987.1| (U25149) HU alpha
FT                   [Serratia marcescens]"
FT                   /db_xref="EnsemblGenomes-Gn:y0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84088"
FT                   /db_xref="GOA:A0A3N4BAP0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAP0"
FT                   /protein_id="AAM84088.1"
FT                   /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
FT   gene            560813..561514
FT                   /locus_tag="y0500"
FT   CDS_pept        560813..561514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0500"
FT                   /product="hypothetical protein"
FT                   /note="residues 7 to 228 of 233 are 40.88 pct identical to
FT                   residues 5 to 226 of 231 from E. coli K12 : B4001; residues
FT                   9 to 232 of 233 are 42.22 pct identical to residues 7 to
FT                   229 of 230 from GenPept : >gb|AAL22999.1| (AE008895)
FT                   putative inner membrane protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84089"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WAS8"
FT                   /protein_id="AAM84089.1"
FT                   /translation="MSVKIISRGGIKPLLFMQRVLITFGLTLGLSACSSLSDPPQFSAS
FT                   GYIADSGVVRLWRQDNAQQQPQVLMSVYSPYFGGNTRVTFYEYQNGILREIRRNDLGAT
FT                   PQSVQLRFDEQGQVSFMQRQLASRRESLSADDIAVYQLEAKRILELSRVLRAGDVRLIQ
FT                   GRWQDGMLTTCAGKTLRLNLDDNSQAWLTTRGEKNTQPLGVAWLDSSEGQQLLLVANQD
FT                   FCRWEPQAGSL"
FT   gene            complement(561662..562972)
FT                   /gene="purD"
FT                   /locus_tag="y0501"
FT   CDS_pept        complement(561662..562972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="y0501"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /function="enzyme; purine ribonucleotide biosynthesis"
FT                   /note="GAR synthetase; residues 9 to 434 of 436 are 80.75
FT                   pct identical to residues 1 to 426 of 429 from E. coli K12
FT                   : B4005; residues 9 to 434 of 436 are 80.75 pct identical
FT                   to residues 1 to 426 of 429 from GenPept :
FT                   >gb|AAG59202.1|AE005632_3 (AE005632)
FT                   phosphoribosylglycinamide synthetase = GAR synthetase
FT                   [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84090"
FT                   /db_xref="GOA:Q8ZAR2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="PDB:3MJF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAR2"
FT                   /protein_id="AAM84090.1"
FT                   /translation="MPLHGVIQMNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGT
FT                   ALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQ
FT                   AAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGV
FT                   IVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQD
FT                   HKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAG
FT                   LMISADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSL
FT                   GVVLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALG
FT                   ETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK"
FT   gene            complement(563008..564642)
FT                   /gene="purH"
FT                   /locus_tag="y0502"
FT   CDS_pept        complement(563008..564642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="y0502"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /function="enzyme; purine ribonucleotide biosynthesis"
FT                   /note="AICAR formyltransferase; IMP cyclohydrolase;
FT                   residues 16 to 544 of 544 are 87.14 pct identical to
FT                   residues 1 to 529 of 529 from E. coli K12 : B4006; residues
FT                   16 to 544 of 544 are 87.52 pct identical to residues 1 to
FT                   529 of 529 from GenPept : >gb|AAG59203.1|AE005632_4
FT                   (AE005632) phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase = AICAR formyltransferase; IMP
FT                   cyclohydrolase [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84091"
FT                   /db_xref="GOA:Q8ZAR3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZAR3"
FT                   /protein_id="AAM84091.1"
FT                   /translation="MIMKKTATPNPRDKTMQQRRPIRRALLSVSDKAGIIEFAQALSQR
FT                   GIELLSTGGTARLLADAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGI
FT                   MAQHGIQPIDIVVVNLYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVV
FT                   KSSDYPAIITELDNNDGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQ
FT                   PSGHFPRTLNLNYIKKQDMRYGENSHQQAAFYIEEDVKEASVATAQQLQGKALSYNNIA
FT                   DTDAALECVKEFSEPACVIVKHANPCGVAIGDSILAAYERAYQTDPTSAFGGIIAFNRE
FT                   LDAATASAIISRQFVEVIIAPTVSSDALALLAAKQNVRVLTCGQWQARSAGLDFKRVNG
FT                   GLLVQERDLGMVTAADLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGI
FT                   GAGQMSRVYSAKIAGIKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGS
FT                   IRDDEVIAAADEHSIAMIFTDMRHFRH"
FT   gene            565257..566841
FT                   /locus_tag="yr011"
FT   rRNA            565257..566841
FT                   /locus_tag="yr011"
FT                   /product="16S ribosomal RNA"
FT   gene            566935..567007
FT                   /locus_tag="yt016"
FT   tRNA            566935..567007
FT                   /locus_tag="yt016"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: TTC"
FT   gene            567263..570169
FT                   /locus_tag="yr012"
FT   rRNA            567263..570169
FT                   /locus_tag="yr012"
FT                   /product="23S ribosomal RNA"
FT   gene            570277..570396
FT                   /locus_tag="yr013"
FT   rRNA            570277..570396
FT                   /locus_tag="yr013"
FT                   /product="5S ribosomal RNA"
FT   gene            570861..571127
FT                   /locus_tag="y0503"
FT   CDS_pept        570861..571127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0503"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1617; residues 1 to 88 of 88 are 100.00 pct
FT                   identical to residues 1 to 88 of 88 from GenPept :
FT                   >gb|AAC69821.1| (AF074612) putative IS1617 transposase
FT                   [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84092"
FT                   /db_xref="GOA:A0A384KT65"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT65"
FT                   /protein_id="AAM84092.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT   gene            571151..571960
FT                   /locus_tag="y0504"
FT   CDS_pept        571151..571960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0504"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS1222; residues 1 to 269 of 269 are 96.65 pct
FT                   identical to residues 1 to 269 of 269 from GenPept :
FT                   >emb|CAB54971.1| (AL117189) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84093"
FT                   /db_xref="GOA:Q8D1G9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G9"
FT                   /protein_id="AAM84093.1"
FT                   /translation="MEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREIA
FT                   ETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRWHVTARHRHASPEVT
FT                   ALDQCWSMDFVADNLFNGRRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSL
FT                   GRIPQRLQTDNGSEFISKSMDRWAYENRVSMDFSGPGKPTDNAFIESFNGSLRDECLNV
FT                   HGFLSLEDAQEKIEQWRQEYNHFRPYSSLNNLTPAEFARSHQKGPDL"
FT   mobile_element  complement(572559..574512)
FT                   /mobile_element_type="insertion sequence:IS100"
FT                   /note="insertion element"
FT   gene            complement(572625..573407)
FT                   /locus_tag="y0505"
FT   CDS_pept        complement(572625..573407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0505"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfB; residues 1 to 260 of 260 are 100.00 pct
FT                   identical to residues 1 to 260 of 260 from GenPept :
FT                   >gb|AAC69770.1| (AF074612) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84094"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAM84094.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(573404..574426)
FT                   /locus_tag="y0506"
FT   CDS_pept        complement(573404..574426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0506"
FT                   /product="putative transposase"
FT                   /function="IS and transposon related functions"
FT                   /note="IS100; orfA; residues 1 to 340 of 340 are 100.00 pct
FT                   identical to residues 1 to 340 of 340 from GenPept :
FT                   >gb|AAC13168.1| (AF053947) putative transposase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84095"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAM84095.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            574479..575471
FT                   /locus_tag="y0507"
FT   CDS_pept        574479..575471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0507"
FT                   /product="hypothetical"
FT                   /note="residues 12 to 297 of 330 are 28.91 pct identical to
FT                   residues 2 to 268 of 299 from GenPept : >emb|CAB15003.1|
FT                   (Z99119) ytaP [Bacillus subtilis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84096"
FT                   /db_xref="GOA:Q8CLR3"
FT                   /db_xref="InterPro:IPR025890"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR3"
FT                   /protein_id="AAM84096.1"
FT                   /translation="MGVDHYCTVRYRSDTRKILRQALLTPNSTITFSAEKIEQQDRGSY
FT                   IAEKIALNITDESRVLGLLLTPKTKGPHPAIVLLHDHGSKFDIGKEKMIRPWGDSAKLA
FT                   SAQAWSDKFFSGKFVGDELAKRGYVVFSIDSIGWGDRGPMSYERQQALASNFFNLGRSL
FT                   AGTMAYEDMRTVDFMTTLPSVDRKRIGVLGFSMGAYRAWQLAALSDQVAATAAISWFGN
FT                   YKGLMTPDNNVLRGQSSFYMLHPGIANKLDFPDIASLAAPRPMLLFNGGKDKLFPAQAV
FT                   EQAYDKVHAIWRSQNAEPRLVTRSWPTLGHVFYQEQQDVVFLWLDRWLK"
FT   gene            complement(575545..577200)
FT                   /locus_tag="y0508"
FT   CDS_pept        complement(575545..577200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0508"
FT                   /product="putative sodium/proline symporter"
FT                   /function="putative transport"
FT                   /note="residues 7 to 551 of 551 are 81.28 pct identical to
FT                   residues 6 to 549 of 549 from E. coli K12 : B4067; residues
FT                   1 to 551 of 551 are 82.94 pct identical to residues 1 to
FT                   551 of 551 from GenPept : >gb|AAG06622.1|AE004746_6
FT                   (AE004746) probable sodium:solute symporter [Pseudomonas
FT                   aeruginosa]"
FT                   /db_xref="EnsemblGenomes-Gn:y0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84097"
FT                   /db_xref="GOA:Q8ZJ73"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ73"
FT                   /protein_id="AAM84097.1"
FT                   /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFVG
FT                   GTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGYDG
FT                   LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALYL
FT                   IAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATF
FT                   MAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   ILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAAGALLGG
FT                   NNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKAN
FT                   ERDELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKL
FT                   TTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFS
FT                   ITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
FT   gene            complement(577197..577508)
FT                   /locus_tag="y0509"
FT   CDS_pept        complement(577197..577508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0509"
FT                   /product="hypothetical protein"
FT                   /note="residues 1 to 102 of 103 are 64.70 pct identical to
FT                   residues 1 to 102 of 104 from E. coli K12 : B4068; residues
FT                   1 to 102 of 103 are 66.66 pct identical to residues 1 to
FT                   102 of 104 from GenPept : >gb|AAL23098.1| (AE008900)
FT                   putative inner membrane protein [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84098"
FT                   /db_xref="GOA:A0A3N4AX67"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX67"
FT                   /protein_id="AAM84098.1"
FT                   /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLIA
FT                   FEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVKQ"
FT   gene            complement(577565..579529)
FT                   /gene="acs"
FT                   /locus_tag="y0510"
FT   CDS_pept        complement(577565..579529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="y0510"
FT                   /product="acetyl CoA synthetase"
FT                   /function="enzyme; fatty acid and phosphatidic acid
FT                   biosynthesis"
FT                   /note="residues 3 to 654 of 654 are 84.66 pct identical to
FT                   residues 1 to 652 of 652 from E. coli K12 : B4069"
FT                   /db_xref="EnsemblGenomes-Gn:y0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84099"
FT                   /db_xref="GOA:Q8D1G8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1G8"
FT                   /protein_id="AAM84099.1"
FT                   /translation="MTMSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQG
FT                   KIIDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDP
FT                   NQSKTVTYKQLHHDVCQFANVLKSLSVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSV
FT                   IFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVF
FT                   QRTGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTG
FT                   GYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPG
FT                   VNRLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEW
FT                   YYNKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQ
FT                   EGVAEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGR
FT                   VDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPE
FT                   LYTEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLA
FT                   DPSVVEKLLEEKQSMQTPS"
FT   gene            580378..581694
FT                   /gene="gltP"
FT                   /locus_tag="y0511"
FT   CDS_pept        580378..581694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="y0511"
FT                   /product="glutamate-aspartate symport protein"
FT                   /function="transport; transport of small molecules; amino
FT                   acids, amines"
FT                   /note="residues 1 to 437 of 438 are 81.00 pct identical to
FT                   residues 1 to 437 of 437 from E. coli K12 : B4077; residues
FT                   1 to 437 of 438 are 81.00 pct identical to residues 1 to
FT                   437 of 437 from GenPept : >gb|AAG59275.1|AE005640_9
FT                   (AE005640) glutamate-aspartate symport protein [Escherichia
FT                   coli O157:H7 EDL933]"
FT                   /db_xref="EnsemblGenomes-Gn:y0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84100"
FT                   /db_xref="GOA:A0A3N4AX72"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX72"
FT                   /protein_id="AAM84100.1"
FT                   /translation="MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPAG
FT                   DIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITLAN
FT                   VFQPGVGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPI
FT                   IFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANF
FT                   GFASLIPLAKLVILVYAAILFFALVILGTVARLCKLRIWILIRILKDELILAYSTASSE
FT                   TVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQE
FT                   IILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWENQFDDKKAKAYEKTLFAVEQTPANQS"
FT   gene            complement(581872..582504)
FT                   /locus_tag="y0512"
FT   CDS_pept        complement(581872..582504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0512"
FT                   /product="response regulator/transcription activator"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 4 to 208 of 210 are 54.14 pct identical to
FT                   residues 5 to 209 of 212 from GenPept : >emb|CAC08853.1|
FT                   (AX023463) unnamed protein product [Salmonella sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:y0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84101"
FT                   /db_xref="GOA:A0A3N4AX86"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX86"
FT                   /protein_id="AAM84101.1"
FT                   /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLCR
FT                   QTEPDMVILDLGLPGMDGLDVIIQLLRRWPALKILTLTARNEEHYASRTFNSGALGYVL
FT                   KKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGSDNTPPVLTPRERQILKLITEG
FT                   SCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
FT   gene            complement(582517..585306)
FT                   /locus_tag="y0513"
FT   CDS_pept        complement(582517..585306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0513"
FT                   /product="putative response regulator"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 1 to 909 of 929 are 44.15 pct identical to
FT                   residues 18 to 915 of 920 from GenPept : >emb|CAD01973.1|
FT                   (AL627271) putative two-component sensor kinase [Salmonella
FT                   enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84102"
FT                   /db_xref="GOA:Q8D1G7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G7"
FT                   /protein_id="AAM84102.1"
FT                   /translation="MTLLMGVTLTVIWLILIATTAFFSYENTRQILINELTHMASMRAD
FT                   LSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSYYIPFNLDSCNINQHKNDLW
FT                   IIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLLLLPKFPTHNNIYW
FT                   GAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRDINLLLDKNGELLPI
FT                   SQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGWQQLVIYPRMGFAWEA
FT                   LKPALYQLPFALAILLLLTSVLSLLLRYYLAIPLWNFINIIGATGPQAMEPRLPINRID
FT                   ELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAEAKRAAEQANRRKSDHLTTISHEI
FT                   RTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAIINNLLDFSRIESGQMTLSL
FT                   EKTALLPLLDQAMLTIHSQALSKSLALSTFISANIPLELELDTLRLRQILVNLLGNAVK
FT                   FTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQGTGLGLAIAD
FT                   NLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFHGELFAPQRLHAQLSAWGMTCQ
FT                   PELANQPSRHFVDNALCYLPGRLYAKLKQYLQGAETEALKSLPLQPWQMHILLVDDSET
FT                   NRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGLATTARWRHDP
FT                   ANIDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLTAQFQLERGVD
FT                   LSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQAKDAIENLPVLSHTLHTIKGCAGQAG
FT                   LIELQDAVIQLEHALDTHETLTQQEIIQLDEIIHVLLQPPTTCESTFIISQGQSLMVK"
FT   gene            585508..587079
FT                   /locus_tag="y0514"
FT   CDS_pept        585508..587079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0514"
FT                   /product="putative secretin"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 24 to 522 of 523 are 51.50 pct identical to
FT                   residues 2 to 493 of 497 from GenPept : >gb|AAL20318.1|
FT                   (AE008761) Secretion system apparatus [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84103"
FT                   /db_xref="GOA:A0A3N4AYK6"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYK6"
FT                   /protein_id="AAM84103.1"
FT                   /translation="MIVGLRQKPYLNLRNYKWMSLIYIMRKITGLILLFFATLLPYGKF
FT                   SYVKAIPWQGEPFFIYSRGMTVSELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPEKI
FT                   LSELAGRYNITWYYDGETLYFYPVQSIKREFISPDGLAANTLVKYLQRGDVLAGKNCAI
FT                   KAIPHLDTLEVKGVPICIERVKSVSKMLSEQVRHQNQNKETVKVFPLKYASAADSDYQY
FT                   RDQNVRLPGLVSVLRELNQGNNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRDRQANM
FT                   PIYRSLITQLDQRPIQIEISVTIIDVDAGDISQLGVDWSASASIGGTGVSFNSTFAKNN
FT                   AEGFSTVIGDTGNFMVRLNALQKNSRARILSQPSVVTLNNIQAVLDKNVTFYTKLQGEK
FT                   VAKLESVTSGSLLRVTPRMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPEIRNSDIST
FT                   QATLQVGQSLLLGGFIQDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSVVRLFLIKAV
FT                   PVNAGE"
FT   gene            587066..588292
FT                   /locus_tag="y0515"
FT   CDS_pept        587066..588292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0515"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="probable translocator protein; residues 5 to 408 of
FT                   408 are 30.95 pct identical to residues 7 to 402 of 403
FT                   from GenPept : >emb|CAD01970.1| (AL627271) putative
FT                   pathogenicity island protein [Salmonella enterica subsp.
FT                   enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84104"
FT                   /db_xref="GOA:Q8D1G6"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G6"
FT                   /protein_id="AAM84104.1"
FT                   /translation="MQGNNMTTVFKLRLLNGDLNGLELILPEGEFTLGEQGCDVLLPLS
FT                   DGNIVTLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSG
FT                   IKVTHRARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREP
FT                   ALQGIKGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLL
FT                   HQHGYHDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQ
FT                   LVERLRAAGLLGFLSMTESNKELAISGVLSSEQQQLKETLAALSQQQPGFPSVRYQNIP
FT                   ASDRTDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLLKAN
FT                   NLVHIPMDF"
FT   gene            588311..588532
FT                   /locus_tag="y0516"
FT   CDS_pept        588311..588532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0516"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 1 to 71 of 73 are 30.98 pct identical to
FT                   residues 1 to 71 of 80 from GenPept : >emb|CAC08847.1|
FT                   (AX023451) unnamed protein product [Salmonella sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:y0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84105"
FT                   /db_xref="GOA:A0A3N4BB58"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB58"
FT                   /protein_id="AAM84105.1"
FT                   /translation="MQHITVLEEDIKHDPTAIKQRKEILARGRRLITCQLSLLQTPENY
FT                   QSLNNMMLALQRAEEIIEILTLRYGNKE"
FT   gene            588706..589326
FT                   /locus_tag="y0517"
FT   CDS_pept        588706..589326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0517"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 108 to 202 of 206 are 37.89 pct identical
FT                   to residues 169 to 263 of 271 from GenPept :
FT                   >gb|AAK69232.1|AF336309_27 (AF336309) transcriptional
FT                   activator VirF [Yersinia enterocolitica]"
FT                   /db_xref="EnsemblGenomes-Gn:y0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84106"
FT                   /db_xref="GOA:A0A3N4B0T6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0T6"
FT                   /protein_id="AAM84106.1"
FT                   /translation="MIADEQASASAFANSAITSILCYPIDLFPIYQDLARRTLPLNKGH
FT                   LPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDNVYFSKLLDSIVGT
FT                   NNELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQWLLDQRLKKGCEL
FT                   LLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE"
FT   gene            589333..589551
FT                   /locus_tag="y0518"
FT   CDS_pept        589333..589551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0518"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 2 to 72 of 72 are 33.80 pct identical to
FT                   residues 1 to 71 of 71 from GenPept : >emb|CAC08848.1|
FT                   (AX023453) unnamed protein product [Salmonella sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:y0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84107"
FT                   /db_xref="GOA:Q8D1G5"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G5"
FT                   /protein_id="AAM84107.1"
FT                   /translation="MMQISSPMGQLTNDIQQARQAYQNQMAAVNINDPEQMLTSQFTMN
FT                   QYSAFLDFKSIEMKMINDIRNRILSRI"
FT   gene            589548..589796
FT                   /locus_tag="y0519"
FT   CDS_pept        589548..589796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0519"
FT                   /product="hypothetical"
FT                   /note="residues 18 to 77 of 82 are 38.33 pct identical to
FT                   residues 3 to 62 of 75 from GenPept : >emb|CAC08849.1|
FT                   (AX023455) unnamed protein product [Salmonella sp.]"
FT                   /db_xref="EnsemblGenomes-Gn:y0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84108"
FT                   /db_xref="InterPro:IPR010437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX77"
FT                   /protein_id="AAM84108.1"
FT                   /translation="MSLLSADCRQLVVEAALAGVNHSLLAEAHDIVNALPLLIPDPQVR
FT                   LVCEAMLRFGLGDKVQARALLATSGEEDAQILLGLLQ"
FT   gene            589951..590145
FT                   /locus_tag="y0520"
FT   CDS_pept        589951..590145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0520"
FT                   /product="hypothetical"
FT                   /note="residues 24 to 64 of 64 are 31.70 pct identical to
FT                   residues 102 to 142 of 142 from GenPept :
FT                   >gb|AAL57538.1|AF453441_22 (AF453441) unknown [Escherichia
FT                   coli]"
FT                   /db_xref="EnsemblGenomes-Gn:y0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84109"
FT                   /db_xref="GOA:Q8CLR2"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR2"
FT                   /protein_id="AAM84109.1"
FT                   /translation="MGNTQQVAKFTQLMAQPASTELMMTPESLLMQQAEWMHASLAIDL
FT                   TAKVAGVMGQNINKLVNMQ"
FT   gene            590142..590874
FT                   /pseudo
FT                   /locus_tag="y0521"
FT                   /note="disrupted by frameshift"
FT   gene            complement(590824..590994)
FT                   /locus_tag="y0522"
FT   CDS_pept        complement(590824..590994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0522"
FT                   /product="hypothetical"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 5 to 48 of 56 are 38.29 pct identical to
FT                   residues 37 to 83 of 533 from GenPept :
FT                   >gb|AAD25761.1|AC007060_19 (AC007060) Strong similarity to
FT                   F19I3.2 gi|3033375 putative berberine bridge enzyme from
FT                   Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:y0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84110"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR1"
FT                   /protein_id="AAM84110.1"
FT                   /translation="MYDRTDMSDLLSDTVLLTDTVLLTPALYLRRPSFTDAARPLPTSI
FT                   VKPAYKHQYNK"
FT   gene            591046..591642
FT                   /locus_tag="y0523"
FT   CDS_pept        591046..591642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0523"
FT                   /product="hypothetical"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 13 to 177 of 198 are 34.73 pct identical to
FT                   residues 4 to 166 of 182 from GenPept : >emb|CAD01955.1|
FT                   (AL627271) putative pathogenicity island protein
FT                   [Salmonella enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84111"
FT                   /db_xref="InterPro:IPR025292"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR0"
FT                   /protein_id="AAM84111.1"
FT                   /translation="MMAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSR
FT                   ALDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLRL
FT                   RRYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNIIW
FT                   QAVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
FT   gene            591726..592286
FT                   /locus_tag="y0524"
FT   CDS_pept        591726..592286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0524"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 3 to 177 of 186 are 28.00 pct identical to
FT                   residues 43 to 217 of 224 from GenPept : >gb|AAL20335.1|
FT                   (AE008761) Secretion system apparatus [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84112"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G4"
FT                   /protein_id="AAM84112.1"
FT                   /translation="MHSQDLLAQANAQAAEILQAAEQARVLLLDQAAEQADALISQARE
FT                   QMETALLAQHVRWLVGAEQLESLLITQVRHRILAAITTVVTTWSGEQPMSQILIQRLGD
FT                   QAEKMAQQGELTLRVHPQHLPAVTTALGERLRCVGDTEMAADQAQLSSPMLQLTLSLHH
FT                   HLSQLVLWLQQSPDLFDEENVYE"
FT   gene            592273..594327
FT                   /locus_tag="y0525"
FT   CDS_pept        592273..594327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0525"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 12 to 680 of 684 are 58.05 pct identical to
FT                   residues 15 to 676 of 681 from GenPept : >gb|AAL20338.1|
FT                   (AE008761) Secretion system apparatus: homology with the
FT                   LcrD family of proteins [Salmonella typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84113"
FT                   /db_xref="GOA:Q8D1G3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G3"
FT                   /protein_id="AAM84113.1"
FT                   /translation="MFMSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDL
FT                   LIAINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEI
FT                   VEAFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSIDG
FT                   DMRAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILINIIGGITIGV
FT                   MQHKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELAVQV
FT                   GRQPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRANGGS
FT                   EEGGATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEIRCDPT
FT                   LAENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQVLGAKMGSFDWLDAKQAMQA
FT                   RTLGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKELQRQIPV
FT                   GKVAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRHLCRRFSHN
FT                   KTWISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAENQDAVLLTT
FT                   LDVRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA"
FT   gene            594314..595651
FT                   /gene="fliI"
FT                   /locus_tag="y0526"
FT   CDS_pept        594314..595651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="y0526"
FT                   /product="flagellum-specific ATP synthase"
FT                   /function="enzyme; surface structures"
FT                   /note="residues 9 to 420 of 445 are 45.39 pct identical to
FT                   residues 1 to 434 of 457 from E. coli K12 : B1941; residues
FT                   1 to 445 of 445 are 100.00 pct identical to residues 1 to
FT                   445 of 445 from GenPept : >emb|CAC89129.1| (AJ414141)
FT                   putative type III secretion system ATP synthase [Yersinia
FT                   pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84114"
FT                   /db_xref="GOA:A0A380PIY8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PIY8"
FT                   /protein_id="AAM84114.1"
FT                   /translation="MKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRASL
FT                   PNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGAD
FT                   LAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEG
FT                   QRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVV
FT                   VVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPA
FT                   AGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLS
FT                   RRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAG
FT                   EDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
FT   gene            595648..596049
FT                   /locus_tag="y0527"
FT   CDS_pept        595648..596049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0527"
FT                   /product="hypothetical"
FT                   /note="residues 9 to 119 of 133 are 33.33 pct identical to
FT                   residues 1991 to 2101 of 2994 from GenPept :
FT                   >emb|CAC41976.1| (AJ314911) putative RNaseIII
FT                   [Dictyostelium discoideum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1P4"
FT                   /protein_id="AAM84115.1"
FT                   /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENGR
FT                   RRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQVSA
FT                   IERQQARLRRNQREQEKLRMLTEDESNRY"
FT   gene            596030..596428
FT                   /locus_tag="y0528"
FT   CDS_pept        596030..596428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0528"
FT                   /product="hypothetical"
FT                   /note="residues 45 to 115 of 132 are 30.26 pct identical to
FT                   residues 528 to 596 of 1079 from GenPept : >gb|AAF96433.1|
FT                   (AE004384) pyruvate-flavoredoxin oxidoreductase [Vibrio
FT                   cholerae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB64"
FT                   /protein_id="AAM84116.1"
FT                   /translation="MSRIDIEGALPPLREQGYSKERSTHWDHERQRQQFARCFSSPLPR
FT                   IQNIACTVAGYDDNGLMETHYRIVSGPLCGTKVSVSMTAHGLRIVLSNTESKLIERLQR
FT                   IQNRWQRQLHQLGFPCLLEVTCADESDA"
FT   gene            596406..597368
FT                   /locus_tag="y0529"
FT   CDS_pept        596406..597368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0529"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 35 to 312 of 320 are 25.60 pct identical to
FT                   residues 36 to 317 of 322 from GenPept : >gb|AAL20342.1|
FT                   (AE008761) Secretion system apparatus [Salmonella
FT                   typhimurium LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84117"
FT                   /db_xref="GOA:A0A3N4B0U4"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0U4"
FT                   /protein_id="AAM84117.1"
FT                   /translation="MLTNLTPELRALSTLIGSGRQTAGVSVALTEIDGEGVYLPLHYGG
FT                   QECGLWLSQSCWQHWLNTTLATDNPQLLAAELVIAMANWAVTPLLALFTDLVVLAESPQ
FT                   KRSLPKQWAVTVAFELEGQPIIGVLQDWPQAALADTLSHWPCEAVTAPDLLWQSGLVAG
FT                   WCHLSLRQLQQLRPGEGLRLSMAAELDKEACWLWHHASPQIYIKLEGGNRMTIQQINEA
FT                   SDPLACGSRAESPPLAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQTHCYGE
FT                   VNICLNGQSVGRGSLLRCDEKLVVRIAQWGLQNGENIME"
FT   gene            597435..598145
FT                   /locus_tag="y0530"
FT   CDS_pept        597435..598145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0530"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 21 to 235 of 236 are 59.53 pct identical to
FT                   residues 1 to 214 of 215 from GenPept : >gb|AAL20343.1|
FT                   (AE008761) Secretion system apparatus: homology with YscR
FT                   of the secretion system of Yersinia [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84118"
FT                   /db_xref="GOA:Q8D1G1"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G1"
FT                   /protein_id="AAM84118.1"
FT                   /translation="MRNSLLFILSETDDLYETDHMELLNSSYQLIALLFMLSVLPLLVV
FT                   MGTAFLKLSVVFSLLRNALGVQQVPPNIAIYGLALVLTIFIMAPVGLDVQARLQNEELS
FT                   NDIGALAHQIDQNALVPYRDFLQRNTDIEQVTFFNDIVQNKWPERYRDSVKPDSLLILM
FT                   PAFTLSQLNEAFKIGLLLFLPFVAIDLIVSNILLAMGMMMVSPMTLSLPFKLLVFVLVD
FT                   GWSLVLGQLVGSYL"
FT   gene            598154..598435
FT                   /locus_tag="y0531"
FT   CDS_pept        598154..598435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0531"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 10 to 88 of 93 are 60.75 pct identical to
FT                   residues 6 to 84 of 88 from GenPept : >gb|AAL20344.1|
FT                   (AE008761) Secretion system apparatus: homology with YscS
FT                   of the secretion system of Yersinia [Salmonella typhimurium
FT                   LT2]"
FT                   /db_xref="EnsemblGenomes-Gn:y0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84119"
FT                   /db_xref="GOA:Q8D1G0"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G0"
FT                   /protein_id="AAM84119.1"
FT                   /translation="MSSYHENAIIVHLATELLWLVLLLSLPVVVVASTVGLVISLVQAL
FT                   TQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNYTQQSFLQITSMRP"
FT   gene            598437..599231
FT                   /locus_tag="y0532"
FT   CDS_pept        598437..599231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0532"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 8 to 240 of 264 are 51.70 pct identical to
FT                   residues 9 to 242 of 259 from GenPept : >emb|CAD01944.1|
FT                   (AL627271) putative type III secretion protein [Salmonella
FT                   enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84120"
FT                   /db_xref="GOA:A0A3N4AX87"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX87"
FT                   /protein_id="AAM84120.1"
FT                   /translation="MTDVLPGLTALALAMMRPYGILLILPLFTARSLGSSLLRNGLIVA
FT                   IALPVTPLFLSAPIITNSSPVTWIGVLCTELLIGVVMGFVAALPFWAMNMAGFLIDTLR
FT                   GATMSTLFNPGMGVESSLFGVLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQGIQP
FT                   AADLLLFLQTEWQMMFELCLCFALPALLVMVLADLSLGLINRSARQLNVFFLAMPIKSA
FT                   LALFLLLISLPYGLHHYLSRMSDTEQKIGTLIPLIKGGNDVH"
FT   gene            599218..600288
FT                   /locus_tag="y0533"
FT   CDS_pept        599218..600288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0533"
FT                   /product="putative type III secretion system component"
FT                   /function="extracellular functions; secreted proteins"
FT                   /note="residues 4 to 354 of 356 are 48.14 pct identical to
FT                   residues 2 to 352 of 352 from GenPept : >emb|CAD01943.1|
FT                   (AL627271) putative type III secretion protein [Salmonella
FT                   enterica subsp. enterica serovar Typhi]"
FT                   /db_xref="EnsemblGenomes-Gn:y0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84121"
FT                   /db_xref="GOA:Q8D1F9"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F9"
FT                   /protein_id="AAM84121.1"
FT                   /translation="MMSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLL
FT                   TGYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAGI
FT                   AQVGPLLATKAVSFKGERINPIQNAKQLFSLRSVFELMKSLLKVGVLTLIFGYLLMQYA
FT                   PSFGYLTHCGSRCALPVFSTLMGWLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSHDEV
FT                   KREYKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPEETPL
FT                   PIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPVAALLR
FT                   MALELDYQPSSDDPPR"
FT   gene            600671..601885
FT                   /locus_tag="y0534"
FT   CDS_pept        600671..601885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0534"
FT                   /product="putative integral membrane protein"
FT                   /function="putative transport"
FT                   /note="residues 1 to 397 of 404 are 78.33 pct identical to
FT                   residues 1 to 397 of 401 from E. coli K12 : B1929"
FT                   /db_xref="EnsemblGenomes-Gn:y0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84122"
FT                   /db_xref="GOA:A0A3N4AX96"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX96"
FT                   /protein_id="AAM84122.1"
FT                   /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEF
FT                   TRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIKLR
FT                   KPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLG
FT                   IAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVE
FT                   PKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGATLLAYY
FT                   WDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSAL
FT                   IKESL"
FT   gene            601882..602151
FT                   /locus_tag="y0535"
FT   CDS_pept        601882..602151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0535"
FT                   /product="hypothetical protein"
FT                   /note="residues 16 to 89 of 89 are 94.59 pct identical to
FT                   residues 4 to 77 of 77 from E. coli K12 : B1930"
FT                   /db_xref="EnsemblGenomes-Gn:y0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84123"
FT                   /db_xref="GOA:A0A3N4AX99"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX99"
FT                   /protein_id="AAM84123.1"
FT                   /translation="MSHSPSVETPQLAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLKP
FT                   GEILEVISDCPQSINNIPLDARNYGYTVLDIQQDGPTIRYLIQR"
FT   gene            complement(602229..603215)
FT                   /locus_tag="y0536"
FT   CDS_pept        complement(602229..603215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0536"
FT                   /product="hypothetical"
FT                   /note="possible transcription regulator, LysR family;
FT                   residues 24 to 321 of 328 are 31.02 pct identical to
FT                   residues 7 to 309 of 309 from GenPept : >emb|CAD18061.1|
FT                   (AL646081) probable transcription regulator protein
FT                   [Ralstonia solanacearum]"
FT                   /db_xref="EnsemblGenomes-Gn:y0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84124"
FT                   /db_xref="GOA:A0A3N4AZZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZZ3"
FT                   /protein_id="AAM84124.1"
FT                   /translation="MMSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNI
FT                   TPSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSFY
FT                   NHPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALRIT
FT                   SIPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYKSTE
FT                   GESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYNAKDK
FT                   EYGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
FT   gene            603382..604668
FT                   /locus_tag="y0537"
FT   CDS_pept        603382..604668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="y0537"
FT                   /product="putative transporter protein"
FT                   /function="putative transport"
FT                   /note="residues 11 to 428 of 428 are 62.67 pct identical to
FT                   residues 6 to 423 of 423 from E. coli K12 : B3539"
FT                   /db_xref="EnsemblGenomes-Gn:y0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84125"
FT                   /db_xref="GOA:A0A3N4AYM6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYM6"
FT                   /protein_id="AAM84125.1"
FT                   /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMPV
FT                   QVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGLGI
FT                   AYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQGEKI
FT                   LFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFSILFV
FT                   QILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQAVSAF
FT                   EQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNIISRFIP
FT                   EENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPV
FT                   LHKLKGPTIWFISFFGILLCLSPFFKFFE"
FT   gene            604714..605895
FT                   /gene="metC"
FT                   /locus_tag="y0538"
FT   CDS_pept        604714..605895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="y0538"
FT                   /product="cystathionine beta-lyase (beta-cystathionase)"
FT                   /function="enzyme; amino acid biosynthesis: Methionine"
FT                   /note="residues 11 to 389 of 393 are 42.41 pct identical to
FT                   residues 6 to 394 of 395 from E. coli K12 : B3008; residues
FT                   1 to 340 of 393 are 64.11 pct identical to residues 2 to
FT                   340 of 340 from GenPept : >dbj|BAA09295.1| (D50617) YFR055W
FT                   [Saccharomyces cerevisiae]"
FT                   /db_xref="EnsemblGenomes-Gn:y0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84126"
FT                   /db_xref="GOA:A0A3N4B1Q3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1Q3"
FT                   /protein_id="AAM84126.1"
FT                   /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVD
FT                   DIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHL
FT                   LMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEI
FT                   QDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVS
FT                   ANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEV
FT                   LRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAMGFSWGG
FT                   YESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS"
FT   gene            complement(606036..606722)
FT                   /gene="hmuV"
FT                   /locus_tag="y0539"
FT   CDS_pept        complement(606036..606722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="y0539"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /function="transport of small molecules; cations"
FT                   /note="for hemin uptake; residues 1 to 228 of 228 are
FT                   100.00 pct identical to residues 39 to 266 of 266 from
FT                   GenPept : >gb|AAC64870.1| (U60647) ATP-binding protein
FT                   [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:y0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAM84127"
FT                   /db_xref="GOA:Q56993"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4G1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56993"
FT                   /protein_id="AAM84127.1"
FT                   /translation="MVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKAL
FT                   ARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVL
FT                   SGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAV
FT                   CCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALP
FT                   QIYLRQ"
FT   gene            complement(606829..607833)
FT                   /gene="hmuU"
FT                   /locus_tag="y0540"
FT   CDS_pept        complement(606829..607833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="y0540"
FT                   /product="ABC-type permease"
FT                   /function="transport of small molecules; cations"
FT                   /note="for hemin uptake; residues 1 to 334 of 334 are
FT                   100.00 pct identical to residues 1 to 334 of 334 from
FT                   GenPept : >gb|AAC