(data stored in SCRATCH3701 zone)

EMBL: AE014613

ID   AE014613; SV 1; circular; genomic DNA; STD; PRO; 4791961 BP.
XX
AC   AE014613; AE016834-AE016849;
XX
PR   Project:PRJNA371;
XX
DT   17-JAN-2006 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4791961
RX   DOI; 10.1128/JB.185.7.2330-2337.2003.
RX   PUBMED; 12644504.
RA   Deng W., Liou S.R., Plunkett G.III., Mayhew G.F., Rose D.J., Burland V.,
RA   Kodoyianni V., Schwartz D.C., Blattner F.R.;
RT   "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and
RT   CT18";
RL   J. Bacteriol. 185(7):2330-2337(2003).
XX
RN   [2]
RP   1-4791961
RA   Deng W., Liou S.-R., Plunkett G.III., Mayhew G.F., Rose D.J., Burland V.,
RA   Kodoyianni V., Schwartz D.C., Blattner F.R.;
RT   ;
RL   Submitted (25-SEP-2002) to the INSDC.
RL   Laboratory of Genetics, University of Wisconsin - Madison, 445 Henry Mall,
RL   Madison, WI 53706, USA
XX
DR   MD5; 0e0e0ba9567449731c7774cadc778ded.
DR   BioSample; SAMN02604095.
DR   COMPARE-RefGenome; Ty2.
DR   EnsemblGenomes-Gn; EBG00001210591.
DR   EnsemblGenomes-Gn; EBG00001210592.
DR   EnsemblGenomes-Gn; EBG00001210593.
DR   EnsemblGenomes-Gn; EBG00001210594.
DR   EnsemblGenomes-Gn; EBG00001210595.
DR   EnsemblGenomes-Gn; EBG00001210596.
DR   EnsemblGenomes-Gn; EBG00001210597.
DR   EnsemblGenomes-Gn; EBG00001210598.
DR   EnsemblGenomes-Gn; EBG00001210599.
DR   EnsemblGenomes-Gn; EBG00001210600.
DR   EnsemblGenomes-Gn; EBG00001210601.
DR   EnsemblGenomes-Gn; EBG00001210602.
DR   EnsemblGenomes-Gn; EBG00001210603.
DR   EnsemblGenomes-Gn; EBG00001210604.
DR   EnsemblGenomes-Gn; EBG00001210605.
DR   EnsemblGenomes-Gn; EBG00001210606.
DR   EnsemblGenomes-Gn; EBG00001210607.
DR   EnsemblGenomes-Gn; EBG00001210608.
DR   EnsemblGenomes-Gn; EBG00001210609.
DR   EnsemblGenomes-Gn; EBG00001210610.
DR   EnsemblGenomes-Gn; EBG00001210611.
DR   EnsemblGenomes-Gn; EBG00001210612.
DR   EnsemblGenomes-Gn; EBG00001210613.
DR   EnsemblGenomes-Gn; EBG00001210614.
DR   EnsemblGenomes-Gn; EBG00001210615.
DR   EnsemblGenomes-Gn; EBG00001210616.
DR   EnsemblGenomes-Gn; EBG00001210617.
DR   EnsemblGenomes-Gn; EBG00001210618.
DR   EnsemblGenomes-Gn; EBG00001210619.
DR   EnsemblGenomes-Gn; EBG00001210620.
DR   EnsemblGenomes-Gn; EBG00001210621.
DR   EnsemblGenomes-Gn; EBG00001210622.
DR   EnsemblGenomes-Gn; EBG00001210623.
DR   EnsemblGenomes-Gn; EBG00001210624.
DR   EnsemblGenomes-Gn; EBG00001210625.
DR   EnsemblGenomes-Gn; EBG00001210626.
DR   EnsemblGenomes-Gn; EBG00001210627.
DR   EnsemblGenomes-Gn; EBG00001210628.
DR   EnsemblGenomes-Gn; EBG00001210629.
DR   EnsemblGenomes-Gn; EBG00001210630.
DR   EnsemblGenomes-Gn; EBG00001210631.
DR   EnsemblGenomes-Gn; EBG00001210632.
DR   EnsemblGenomes-Gn; EBG00001210633.
DR   EnsemblGenomes-Gn; EBG00001210634.
DR   EnsemblGenomes-Gn; EBG00001210635.
DR   EnsemblGenomes-Gn; EBG00001210636.
DR   EnsemblGenomes-Gn; EBG00001210637.
DR   EnsemblGenomes-Gn; EBG00001210638.
DR   EnsemblGenomes-Gn; EBG00001210639.
DR   EnsemblGenomes-Gn; EBG00001210640.
DR   EnsemblGenomes-Gn; EBG00001210641.
DR   EnsemblGenomes-Gn; EBG00001210642.
DR   EnsemblGenomes-Gn; EBG00001210643.
DR   EnsemblGenomes-Gn; EBG00001210644.
DR   EnsemblGenomes-Gn; EBG00001210645.
DR   EnsemblGenomes-Gn; EBG00001210646.
DR   EnsemblGenomes-Gn; EBG00001210647.
DR   EnsemblGenomes-Gn; EBG00001210648.
DR   EnsemblGenomes-Gn; EBG00001210649.
DR   EnsemblGenomes-Gn; EBG00001210650.
DR   EnsemblGenomes-Gn; EBG00001210651.
DR   EnsemblGenomes-Gn; EBG00001210652.
DR   EnsemblGenomes-Gn; EBG00001210653.
DR   EnsemblGenomes-Gn; EBG00001210654.
DR   EnsemblGenomes-Gn; EBG00001210655.
DR   EnsemblGenomes-Gn; EBG00001210656.
DR   EnsemblGenomes-Gn; EBG00001210657.
DR   EnsemblGenomes-Gn; EBG00001210658.
DR   EnsemblGenomes-Gn; EBG00001210659.
DR   EnsemblGenomes-Gn; EBG00001210660.
DR   EnsemblGenomes-Gn; EBG00001210661.
DR   EnsemblGenomes-Gn; EBG00001210662.
DR   EnsemblGenomes-Gn; EBG00001210663.
DR   EnsemblGenomes-Gn; EBG00001210664.
DR   EnsemblGenomes-Gn; EBG00001210665.
DR   EnsemblGenomes-Gn; EBG00001210666.
DR   EnsemblGenomes-Gn; EBG00001210667.
DR   EnsemblGenomes-Gn; EBG00001210668.
DR   EnsemblGenomes-Gn; EBG00001210669.
DR   EnsemblGenomes-Gn; EBG00001210670.
DR   EnsemblGenomes-Gn; EBG00001210671.
DR   EnsemblGenomes-Gn; EBG00001210672.
DR   EnsemblGenomes-Gn; EBG00001210673.
DR   EnsemblGenomes-Gn; EBG00001210674.
DR   EnsemblGenomes-Gn; EBG00001210675.
DR   EnsemblGenomes-Gn; EBG00001210676.
DR   EnsemblGenomes-Gn; EBG00001210677.
DR   EnsemblGenomes-Gn; EBG00001210678.
DR   EnsemblGenomes-Gn; EBG00001210679.
DR   EnsemblGenomes-Gn; EBG00001210680.
DR   EnsemblGenomes-Gn; EBG00001210681.
DR   EnsemblGenomes-Gn; EBG00001210682.
DR   EnsemblGenomes-Gn; EBG00001210683.
DR   EnsemblGenomes-Gn; EBG00001210684.
DR   EnsemblGenomes-Gn; EBG00001210685.
DR   EnsemblGenomes-Gn; EBG00001210686.
DR   EnsemblGenomes-Gn; EBG00001210687.
DR   EnsemblGenomes-Gn; EBG00001210688.
DR   EnsemblGenomes-Gn; EBG00001210689.
DR   EnsemblGenomes-Gn; EBG00001210690.
DR   EnsemblGenomes-Gn; EBG00001210691.
DR   EnsemblGenomes-Gn; EBG00001210692.
DR   EnsemblGenomes-Gn; EBG00001210693.
DR   EnsemblGenomes-Gn; EBG00001210694.
DR   EnsemblGenomes-Gn; EBG00001210695.
DR   EnsemblGenomes-Gn; EBG00001210696.
DR   EnsemblGenomes-Gn; EBG00001210697.
DR   EnsemblGenomes-Gn; EBG00001210698.
DR   EnsemblGenomes-Gn; EBG00001210699.
DR   EnsemblGenomes-Gn; EBG00001210700.
DR   EnsemblGenomes-Gn; EBG00001210701.
DR   EnsemblGenomes-Gn; EBG00001210702.
DR   EnsemblGenomes-Gn; EBG00001210703.
DR   EnsemblGenomes-Gn; EBG00001210704.
DR   EnsemblGenomes-Gn; EBG00001210705.
DR   EnsemblGenomes-Gn; EBG00001210706.
DR   EnsemblGenomes-Gn; EBG00001210707.
DR   EnsemblGenomes-Gn; EBG00001210708.
DR   EnsemblGenomes-Gn; EBG00001210709.
DR   EnsemblGenomes-Gn; EBG00001210710.
DR   EnsemblGenomes-Gn; EBG00001210711.
DR   EnsemblGenomes-Gn; EBG00001210712.
DR   EnsemblGenomes-Gn; EBG00001210713.
DR   EnsemblGenomes-Gn; EBG00001210714.
DR   EnsemblGenomes-Gn; EBG00001210715.
DR   EnsemblGenomes-Gn; EBG00001210716.
DR   EnsemblGenomes-Gn; EBG00001210717.
DR   EnsemblGenomes-Gn; EBG00001210718.
DR   EnsemblGenomes-Gn; EBG00001210719.
DR   EnsemblGenomes-Gn; EBG00001210720.
DR   EnsemblGenomes-Gn; EBG00001210721.
DR   EnsemblGenomes-Gn; EBG00001210722.
DR   EnsemblGenomes-Gn; EBG00001210723.
DR   EnsemblGenomes-Gn; EBG00001210724.
DR   EnsemblGenomes-Gn; EBG00001210725.
DR   EnsemblGenomes-Gn; EBG00001210726.
DR   EnsemblGenomes-Gn; EBG00001210727.
DR   EnsemblGenomes-Gn; EBG00001210728.
DR   EnsemblGenomes-Gn; EBG00001210729.
DR   EnsemblGenomes-Gn; EBG00001210730.
DR   EnsemblGenomes-Gn; EBG00001210731.
DR   EnsemblGenomes-Gn; EBG00001210732.
DR   EnsemblGenomes-Gn; EBG00001210733.
DR   EnsemblGenomes-Gn; EBG00001210734.
DR   EnsemblGenomes-Gn; EBG00001210735.
DR   EnsemblGenomes-Gn; EBG00001210736.
DR   EnsemblGenomes-Gn; EBG00001210737.
DR   EnsemblGenomes-Gn; EBG00001210738.
DR   EnsemblGenomes-Gn; EBG00001210739.
DR   EnsemblGenomes-Gn; EBG00001210740.
DR   EnsemblGenomes-Gn; EBG00001210741.
DR   EnsemblGenomes-Gn; EBG00001210742.
DR   EnsemblGenomes-Gn; EBG00001210743.
DR   EnsemblGenomes-Gn; EBG00001210744.
DR   EnsemblGenomes-Gn; EBG00001210745.
DR   EnsemblGenomes-Gn; EBG00001210746.
DR   EnsemblGenomes-Gn; EBG00001210747.
DR   EnsemblGenomes-Gn; EBG00001210748.
DR   EnsemblGenomes-Gn; EBG00001210749.
DR   EnsemblGenomes-Gn; EBG00001210750.
DR   EnsemblGenomes-Gn; EBG00001210751.
DR   EnsemblGenomes-Gn; EBG00001210752.
DR   EnsemblGenomes-Gn; EBG00001210753.
DR   EnsemblGenomes-Gn; EBG00001210754.
DR   EnsemblGenomes-Gn; EBG00001210755.
DR   EnsemblGenomes-Gn; EBG00001210756.
DR   EnsemblGenomes-Gn; EBG00001210757.
DR   EnsemblGenomes-Gn; EBG00001210758.
DR   EnsemblGenomes-Gn; EBG00001210759.
DR   EnsemblGenomes-Gn; EBG00001210760.
DR   EnsemblGenomes-Gn; EBG00001210761.
DR   EnsemblGenomes-Gn; EBG00001210762.
DR   EnsemblGenomes-Gn; EBG00001210763.
DR   EnsemblGenomes-Gn; EBG00001210764.
DR   EnsemblGenomes-Gn; EBG00001210765.
DR   EnsemblGenomes-Gn; EBG00001210766.
DR   EnsemblGenomes-Gn; EBG00001210767.
DR   EnsemblGenomes-Gn; EBG00001210768.
DR   EnsemblGenomes-Gn; EBG00001210769.
DR   EnsemblGenomes-Gn; EBG00001210770.
DR   EnsemblGenomes-Gn; EBG00001210771.
DR   EnsemblGenomes-Gn; EBG00001210772.
DR   EnsemblGenomes-Gn; EBG00001210773.
DR   EnsemblGenomes-Gn; EBG00001210774.
DR   EnsemblGenomes-Gn; EBG00001210775.
DR   EnsemblGenomes-Gn; EBG00001210776.
DR   EnsemblGenomes-Gn; EBG00001210777.
DR   EnsemblGenomes-Gn; EBG00001210778.
DR   EnsemblGenomes-Gn; EBG00001210779.
DR   EnsemblGenomes-Gn; EBG00001210780.
DR   EnsemblGenomes-Gn; EBG00001210781.
DR   EnsemblGenomes-Gn; EBG00001210782.
DR   EnsemblGenomes-Gn; EBG00001210783.
DR   EnsemblGenomes-Gn; EBG00001210784.
DR   EnsemblGenomes-Gn; EBG00001210785.
DR   EnsemblGenomes-Gn; EBG00001210786.
DR   EnsemblGenomes-Gn; EBG00001210787.
DR   EnsemblGenomes-Gn; EBG00001210788.
DR   EnsemblGenomes-Gn; EBG00001210789.
DR   EnsemblGenomes-Gn; EBG00001210790.
DR   EnsemblGenomes-Gn; EBG00001210791.
DR   EnsemblGenomes-Gn; EBG00001210792.
DR   EnsemblGenomes-Gn; EBG00001210793.
DR   EnsemblGenomes-Gn; EBG00001210794.
DR   EnsemblGenomes-Gn; EBG00001210795.
DR   EnsemblGenomes-Gn; EBG00001210796.
DR   EnsemblGenomes-Gn; EBG00001210797.
DR   EnsemblGenomes-Gn; EBG00001210798.
DR   EnsemblGenomes-Gn; EBG00001210799.
DR   EnsemblGenomes-Gn; EBG00001210800.
DR   EnsemblGenomes-Gn; EBG00001210801.
DR   EnsemblGenomes-Gn; EBG00001210802.
DR   EnsemblGenomes-Gn; EBG00001210803.
DR   EnsemblGenomes-Gn; EBG00001210804.
DR   EnsemblGenomes-Gn; EBG00001210805.
DR   EnsemblGenomes-Gn; EBG00001210806.
DR   EnsemblGenomes-Gn; EBG00001210807.
DR   EnsemblGenomes-Gn; EBG00001210808.
DR   EnsemblGenomes-Gn; EBG00001210809.
DR   EnsemblGenomes-Gn; EBG00001210810.
DR   EnsemblGenomes-Gn; EBG00001210811.
DR   EnsemblGenomes-Gn; EBG00001210812.
DR   EnsemblGenomes-Gn; EBG00001210813.
DR   EnsemblGenomes-Gn; EBG00001210814.
DR   EnsemblGenomes-Gn; EBG00001210815.
DR   EnsemblGenomes-Gn; EBG00001210816.
DR   EnsemblGenomes-Gn; EBG00001210817.
DR   EnsemblGenomes-Gn; EBG00001210818.
DR   EnsemblGenomes-Gn; EBG00001210819.
DR   EnsemblGenomes-Gn; EBG00001210820.
DR   EnsemblGenomes-Gn; EBG00001210821.
DR   EnsemblGenomes-Gn; EBG00001210822.
DR   EnsemblGenomes-Gn; EBG00001210823.
DR   EnsemblGenomes-Gn; EBG00001210824.
DR   EnsemblGenomes-Gn; EBG00001210825.
DR   EnsemblGenomes-Gn; EBG00001210826.
DR   EnsemblGenomes-Gn; EBG00001210827.
DR   EnsemblGenomes-Gn; EBG00001210828.
DR   EnsemblGenomes-Gn; EBG00001210829.
DR   EnsemblGenomes-Gn; EBG00001210830.
DR   EnsemblGenomes-Gn; EBG00001210831.
DR   EnsemblGenomes-Gn; EBG00001210832.
DR   EnsemblGenomes-Gn; EBG00001210833.
DR   EnsemblGenomes-Gn; EBG00001210834.
DR   EnsemblGenomes-Gn; EBG00001210835.
DR   EnsemblGenomes-Gn; EBG00001210836.
DR   EnsemblGenomes-Gn; EBG00001210837.
DR   EnsemblGenomes-Gn; EBG00001210838.
DR   EnsemblGenomes-Gn; EBG00001210839.
DR   EnsemblGenomes-Gn; EBG00001210840.
DR   EnsemblGenomes-Gn; EBG00001210841.
DR   EnsemblGenomes-Gn; EBG00001210842.
DR   EnsemblGenomes-Gn; EBG00001210843.
DR   EnsemblGenomes-Gn; EBG00001210844.
DR   EnsemblGenomes-Gn; EBG00001210845.
DR   EnsemblGenomes-Gn; EBG00001210846.
DR   EnsemblGenomes-Gn; EBG00001210847.
DR   EnsemblGenomes-Gn; t0252.
DR   EnsemblGenomes-Gn; t0253.
DR   EnsemblGenomes-Gn; t0254.
DR   EnsemblGenomes-Gn; t0438.
DR   EnsemblGenomes-Gn; t0439.
DR   EnsemblGenomes-Gn; t0440.
DR   EnsemblGenomes-Gn; t0441.
DR   EnsemblGenomes-Gn; t0445.
DR   EnsemblGenomes-Gn; t0446.
DR   EnsemblGenomes-Gn; t0470.
DR   EnsemblGenomes-Gn; t0625.
DR   EnsemblGenomes-Gn; t0861.
DR   EnsemblGenomes-Gn; t0863.
DR   EnsemblGenomes-Gn; t0873.
DR   EnsemblGenomes-Gn; t0876.
DR   EnsemblGenomes-Gn; t0878.
DR   EnsemblGenomes-Gn; t0932.
DR   EnsemblGenomes-Gn; t0933.
DR   EnsemblGenomes-Gn; t0934.
DR   EnsemblGenomes-Gn; t1121.
DR   EnsemblGenomes-Gn; t1140.
DR   EnsemblGenomes-Gn; t1291.
DR   EnsemblGenomes-Gn; t1292.
DR   EnsemblGenomes-Gn; t1786.
DR   EnsemblGenomes-Gn; t1833.
DR   EnsemblGenomes-Gn; t1984.
DR   EnsemblGenomes-Gn; t2123.
DR   EnsemblGenomes-Gn; t2124.
DR   EnsemblGenomes-Gn; t2125.
DR   EnsemblGenomes-Gn; t2196.
DR   EnsemblGenomes-Gn; t2197.
DR   EnsemblGenomes-Gn; t2198.
DR   EnsemblGenomes-Gn; t2199.
DR   EnsemblGenomes-Gn; t2200.
DR   EnsemblGenomes-Gn; t2201.
DR   EnsemblGenomes-Gn; t2310.
DR   EnsemblGenomes-Gn; t2527.
DR   EnsemblGenomes-Gn; t2600.
DR   EnsemblGenomes-Gn; t2611.
DR   EnsemblGenomes-Gn; t2612.
DR   EnsemblGenomes-Gn; t2613.
DR   EnsemblGenomes-Gn; t2614.
DR   EnsemblGenomes-Gn; t2615.
DR   EnsemblGenomes-Gn; t2719.
DR   EnsemblGenomes-Gn; t2721.
DR   EnsemblGenomes-Gn; t2723.
DR   EnsemblGenomes-Gn; t2725.
DR   EnsemblGenomes-Gn; t2726.
DR   EnsemblGenomes-Gn; t2897.
DR   EnsemblGenomes-Gn; t2898.
DR   EnsemblGenomes-Gn; t2955.
DR   EnsemblGenomes-Gn; t3029.
DR   EnsemblGenomes-Gn; t3133.
DR   EnsemblGenomes-Gn; t3207.
DR   EnsemblGenomes-Gn; t3209.
DR   EnsemblGenomes-Gn; t3306.
DR   EnsemblGenomes-Gn; t3307.
DR   EnsemblGenomes-Gn; t3308.
DR   EnsemblGenomes-Gn; t3309.
DR   EnsemblGenomes-Gn; t3310.
DR   EnsemblGenomes-Gn; t3363.
DR   EnsemblGenomes-Gn; t3364.
DR   EnsemblGenomes-Gn; t3365.
DR   EnsemblGenomes-Gn; t3366.
DR   EnsemblGenomes-Gn; t3450.
DR   EnsemblGenomes-Gn; t3451.
DR   EnsemblGenomes-Gn; t3452.
DR   EnsemblGenomes-Gn; t3453.
DR   EnsemblGenomes-Gn; t3454.
DR   EnsemblGenomes-Gn; t3482.
DR   EnsemblGenomes-Gn; t3483.
DR   EnsemblGenomes-Gn; t3484.
DR   EnsemblGenomes-Gn; t3485.
DR   EnsemblGenomes-Gn; t3490.
DR   EnsemblGenomes-Gn; t3491.
DR   EnsemblGenomes-Gn; t3492.
DR   EnsemblGenomes-Gn; t3493.
DR   EnsemblGenomes-Gn; t3628.
DR   EnsemblGenomes-Gn; t3629.
DR   EnsemblGenomes-Gn; t3630.
DR   EnsemblGenomes-Gn; t3768.
DR   EnsemblGenomes-Gn; t3880.
DR   EnsemblGenomes-Gn; t4106.
DR   EnsemblGenomes-Gn; t4107.
DR   EnsemblGenomes-Gn; t4108.
DR   EnsemblGenomes-Gn; t4372.
DR   EnsemblGenomes-Gn; t4404.
DR   EnsemblGenomes-Gn; t4405.
DR   EnsemblGenomes-Gn; t4517.
DR   EnsemblGenomes-Gn; t4596.
DR   EnsemblGenomes-Gn; t4597.
DR   EnsemblGenomes-Gn; t4598.
DR   EnsemblGenomes-Gn; t4649.
DR   EnsemblGenomes-Gn; t4650.
DR   EnsemblGenomes-Gn; t4651.
DR   EnsemblGenomes-Gn; t4652.
DR   EnsemblGenomes-Gn; t4653.
DR   EnsemblGenomes-Gn; t4654.
DR   EnsemblGenomes-Gn; t4655.
DR   EnsemblGenomes-Gn; t4656.
DR   EnsemblGenomes-Tr; EBT00001779740.
DR   EnsemblGenomes-Tr; EBT00001779741.
DR   EnsemblGenomes-Tr; EBT00001779742.
DR   EnsemblGenomes-Tr; EBT00001779743.
DR   EnsemblGenomes-Tr; EBT00001779744.
DR   EnsemblGenomes-Tr; EBT00001779745.
DR   EnsemblGenomes-Tr; EBT00001779746.
DR   EnsemblGenomes-Tr; EBT00001779747.
DR   EnsemblGenomes-Tr; EBT00001779748.
DR   EnsemblGenomes-Tr; EBT00001779749.
DR   EnsemblGenomes-Tr; EBT00001779750.
DR   EnsemblGenomes-Tr; EBT00001779751.
DR   EnsemblGenomes-Tr; EBT00001779752.
DR   EnsemblGenomes-Tr; EBT00001779753.
DR   EnsemblGenomes-Tr; EBT00001779754.
DR   EnsemblGenomes-Tr; EBT00001779755.
DR   EnsemblGenomes-Tr; EBT00001779756.
DR   EnsemblGenomes-Tr; EBT00001779757.
DR   EnsemblGenomes-Tr; EBT00001779758.
DR   EnsemblGenomes-Tr; EBT00001779759.
DR   EnsemblGenomes-Tr; EBT00001779760.
DR   EnsemblGenomes-Tr; EBT00001779761.
DR   EnsemblGenomes-Tr; EBT00001779762.
DR   EnsemblGenomes-Tr; EBT00001779763.
DR   EnsemblGenomes-Tr; EBT00001779764.
DR   EnsemblGenomes-Tr; EBT00001779765.
DR   EnsemblGenomes-Tr; EBT00001779766.
DR   EnsemblGenomes-Tr; EBT00001779767.
DR   EnsemblGenomes-Tr; EBT00001779768.
DR   EnsemblGenomes-Tr; EBT00001779769.
DR   EnsemblGenomes-Tr; EBT00001779770.
DR   EnsemblGenomes-Tr; EBT00001779771.
DR   EnsemblGenomes-Tr; EBT00001779772.
DR   EnsemblGenomes-Tr; EBT00001779773.
DR   EnsemblGenomes-Tr; EBT00001779774.
DR   EnsemblGenomes-Tr; EBT00001779775.
DR   EnsemblGenomes-Tr; EBT00001779776.
DR   EnsemblGenomes-Tr; EBT00001779777.
DR   EnsemblGenomes-Tr; EBT00001779778.
DR   EnsemblGenomes-Tr; EBT00001779779.
DR   EnsemblGenomes-Tr; EBT00001779780.
DR   EnsemblGenomes-Tr; EBT00001779781.
DR   EnsemblGenomes-Tr; EBT00001779782.
DR   EnsemblGenomes-Tr; EBT00001779783.
DR   EnsemblGenomes-Tr; EBT00001779784.
DR   EnsemblGenomes-Tr; EBT00001779785.
DR   EnsemblGenomes-Tr; EBT00001779786.
DR   EnsemblGenomes-Tr; EBT00001779787.
DR   EnsemblGenomes-Tr; EBT00001779788.
DR   EnsemblGenomes-Tr; EBT00001779789.
DR   EnsemblGenomes-Tr; EBT00001779790.
DR   EnsemblGenomes-Tr; EBT00001779791.
DR   EnsemblGenomes-Tr; EBT00001779792.
DR   EnsemblGenomes-Tr; EBT00001779793.
DR   EnsemblGenomes-Tr; EBT00001779794.
DR   EnsemblGenomes-Tr; EBT00001779795.
DR   EnsemblGenomes-Tr; EBT00001779796.
DR   EnsemblGenomes-Tr; EBT00001779797.
DR   EnsemblGenomes-Tr; EBT00001779798.
DR   EnsemblGenomes-Tr; EBT00001779799.
DR   EnsemblGenomes-Tr; EBT00001779800.
DR   EnsemblGenomes-Tr; EBT00001779801.
DR   EnsemblGenomes-Tr; EBT00001779802.
DR   EnsemblGenomes-Tr; EBT00001779803.
DR   EnsemblGenomes-Tr; EBT00001779804.
DR   EnsemblGenomes-Tr; EBT00001779805.
DR   EnsemblGenomes-Tr; EBT00001779806.
DR   EnsemblGenomes-Tr; EBT00001779807.
DR   EnsemblGenomes-Tr; EBT00001779808.
DR   EnsemblGenomes-Tr; EBT00001779809.
DR   EnsemblGenomes-Tr; EBT00001779810.
DR   EnsemblGenomes-Tr; EBT00001779811.
DR   EnsemblGenomes-Tr; EBT00001779812.
DR   EnsemblGenomes-Tr; EBT00001779813.
DR   EnsemblGenomes-Tr; EBT00001779814.
DR   EnsemblGenomes-Tr; EBT00001779815.
DR   EnsemblGenomes-Tr; EBT00001779816.
DR   EnsemblGenomes-Tr; EBT00001779817.
DR   EnsemblGenomes-Tr; EBT00001779818.
DR   EnsemblGenomes-Tr; EBT00001779819.
DR   EnsemblGenomes-Tr; EBT00001779820.
DR   EnsemblGenomes-Tr; EBT00001779821.
DR   EnsemblGenomes-Tr; EBT00001779822.
DR   EnsemblGenomes-Tr; EBT00001779823.
DR   EnsemblGenomes-Tr; EBT00001779824.
DR   EnsemblGenomes-Tr; EBT00001779825.
DR   EnsemblGenomes-Tr; EBT00001779826.
DR   EnsemblGenomes-Tr; EBT00001779827.
DR   EnsemblGenomes-Tr; EBT00001779828.
DR   EnsemblGenomes-Tr; EBT00001779829.
DR   EnsemblGenomes-Tr; EBT00001779830.
DR   EnsemblGenomes-Tr; EBT00001779831.
DR   EnsemblGenomes-Tr; EBT00001779832.
DR   EnsemblGenomes-Tr; EBT00001779833.
DR   EnsemblGenomes-Tr; EBT00001779834.
DR   EnsemblGenomes-Tr; EBT00001779835.
DR   EnsemblGenomes-Tr; EBT00001779836.
DR   EnsemblGenomes-Tr; EBT00001779837.
DR   EnsemblGenomes-Tr; EBT00001779838.
DR   EnsemblGenomes-Tr; EBT00001779839.
DR   EnsemblGenomes-Tr; EBT00001779840.
DR   EnsemblGenomes-Tr; EBT00001779841.
DR   EnsemblGenomes-Tr; EBT00001779842.
DR   EnsemblGenomes-Tr; EBT00001779843.
DR   EnsemblGenomes-Tr; EBT00001779844.
DR   EnsemblGenomes-Tr; EBT00001779845.
DR   EnsemblGenomes-Tr; EBT00001779846.
DR   EnsemblGenomes-Tr; EBT00001779847.
DR   EnsemblGenomes-Tr; EBT00001779848.
DR   EnsemblGenomes-Tr; EBT00001779849.
DR   EnsemblGenomes-Tr; EBT00001779850.
DR   EnsemblGenomes-Tr; EBT00001779851.
DR   EnsemblGenomes-Tr; EBT00001779852.
DR   EnsemblGenomes-Tr; EBT00001779853.
DR   EnsemblGenomes-Tr; EBT00001779854.
DR   EnsemblGenomes-Tr; EBT00001779855.
DR   EnsemblGenomes-Tr; EBT00001779856.
DR   EnsemblGenomes-Tr; EBT00001779857.
DR   EnsemblGenomes-Tr; EBT00001779858.
DR   EnsemblGenomes-Tr; EBT00001779859.
DR   EnsemblGenomes-Tr; EBT00001779860.
DR   EnsemblGenomes-Tr; EBT00001779861.
DR   EnsemblGenomes-Tr; EBT00001779862.
DR   EnsemblGenomes-Tr; EBT00001779863.
DR   EnsemblGenomes-Tr; EBT00001779864.
DR   EnsemblGenomes-Tr; EBT00001779865.
DR   EnsemblGenomes-Tr; EBT00001779866.
DR   EnsemblGenomes-Tr; EBT00001779867.
DR   EnsemblGenomes-Tr; EBT00001779868.
DR   EnsemblGenomes-Tr; EBT00001779869.
DR   EnsemblGenomes-Tr; EBT00001779870.
DR   EnsemblGenomes-Tr; EBT00001779871.
DR   EnsemblGenomes-Tr; EBT00001779872.
DR   EnsemblGenomes-Tr; EBT00001779873.
DR   EnsemblGenomes-Tr; EBT00001779874.
DR   EnsemblGenomes-Tr; EBT00001779875.
DR   EnsemblGenomes-Tr; EBT00001779876.
DR   EnsemblGenomes-Tr; EBT00001779877.
DR   EnsemblGenomes-Tr; EBT00001779878.
DR   EnsemblGenomes-Tr; EBT00001779879.
DR   EnsemblGenomes-Tr; EBT00001779880.
DR   EnsemblGenomes-Tr; EBT00001779881.
DR   EnsemblGenomes-Tr; EBT00001779882.
DR   EnsemblGenomes-Tr; EBT00001779883.
DR   EnsemblGenomes-Tr; EBT00001779884.
DR   EnsemblGenomes-Tr; EBT00001779885.
DR   EnsemblGenomes-Tr; EBT00001779886.
DR   EnsemblGenomes-Tr; EBT00001779887.
DR   EnsemblGenomes-Tr; EBT00001779888.
DR   EnsemblGenomes-Tr; EBT00001779889.
DR   EnsemblGenomes-Tr; EBT00001779890.
DR   EnsemblGenomes-Tr; EBT00001779891.
DR   EnsemblGenomes-Tr; EBT00001779892.
DR   EnsemblGenomes-Tr; EBT00001779893.
DR   EnsemblGenomes-Tr; EBT00001779894.
DR   EnsemblGenomes-Tr; EBT00001779895.
DR   EnsemblGenomes-Tr; EBT00001779896.
DR   EnsemblGenomes-Tr; EBT00001779897.
DR   EnsemblGenomes-Tr; EBT00001779898.
DR   EnsemblGenomes-Tr; EBT00001779899.
DR   EnsemblGenomes-Tr; EBT00001779900.
DR   EnsemblGenomes-Tr; EBT00001779901.
DR   EnsemblGenomes-Tr; EBT00001779902.
DR   EnsemblGenomes-Tr; EBT00001779903.
DR   EnsemblGenomes-Tr; EBT00001779904.
DR   EnsemblGenomes-Tr; EBT00001779905.
DR   EnsemblGenomes-Tr; EBT00001779906.
DR   EnsemblGenomes-Tr; EBT00001779907.
DR   EnsemblGenomes-Tr; EBT00001779908.
DR   EnsemblGenomes-Tr; EBT00001779909.
DR   EnsemblGenomes-Tr; EBT00001779910.
DR   EnsemblGenomes-Tr; EBT00001779911.
DR   EnsemblGenomes-Tr; EBT00001779912.
DR   EnsemblGenomes-Tr; EBT00001779913.
DR   EnsemblGenomes-Tr; EBT00001779914.
DR   EnsemblGenomes-Tr; EBT00001779915.
DR   EnsemblGenomes-Tr; EBT00001779916.
DR   EnsemblGenomes-Tr; EBT00001779917.
DR   EnsemblGenomes-Tr; EBT00001779918.
DR   EnsemblGenomes-Tr; EBT00001779919.
DR   EnsemblGenomes-Tr; EBT00001779920.
DR   EnsemblGenomes-Tr; EBT00001779921.
DR   EnsemblGenomes-Tr; EBT00001779922.
DR   EnsemblGenomes-Tr; EBT00001779923.
DR   EnsemblGenomes-Tr; EBT00001779924.
DR   EnsemblGenomes-Tr; EBT00001779925.
DR   EnsemblGenomes-Tr; EBT00001779926.
DR   EnsemblGenomes-Tr; EBT00001779927.
DR   EnsemblGenomes-Tr; EBT00001779928.
DR   EnsemblGenomes-Tr; EBT00001779929.
DR   EnsemblGenomes-Tr; EBT00001779930.
DR   EnsemblGenomes-Tr; EBT00001779931.
DR   EnsemblGenomes-Tr; EBT00001779932.
DR   EnsemblGenomes-Tr; EBT00001779933.
DR   EnsemblGenomes-Tr; EBT00001779934.
DR   EnsemblGenomes-Tr; EBT00001779935.
DR   EnsemblGenomes-Tr; EBT00001779936.
DR   EnsemblGenomes-Tr; EBT00001779937.
DR   EnsemblGenomes-Tr; EBT00001779938.
DR   EnsemblGenomes-Tr; EBT00001779939.
DR   EnsemblGenomes-Tr; EBT00001779940.
DR   EnsemblGenomes-Tr; EBT00001779941.
DR   EnsemblGenomes-Tr; EBT00001779942.
DR   EnsemblGenomes-Tr; EBT00001779943.
DR   EnsemblGenomes-Tr; EBT00001779944.
DR   EnsemblGenomes-Tr; EBT00001779945.
DR   EnsemblGenomes-Tr; EBT00001779946.
DR   EnsemblGenomes-Tr; EBT00001779947.
DR   EnsemblGenomes-Tr; EBT00001779948.
DR   EnsemblGenomes-Tr; EBT00001779949.
DR   EnsemblGenomes-Tr; EBT00001779950.
DR   EnsemblGenomes-Tr; EBT00001779951.
DR   EnsemblGenomes-Tr; EBT00001779952.
DR   EnsemblGenomes-Tr; EBT00001779953.
DR   EnsemblGenomes-Tr; EBT00001779954.
DR   EnsemblGenomes-Tr; EBT00001779955.
DR   EnsemblGenomes-Tr; EBT00001779956.
DR   EnsemblGenomes-Tr; EBT00001779957.
DR   EnsemblGenomes-Tr; EBT00001779958.
DR   EnsemblGenomes-Tr; EBT00001779959.
DR   EnsemblGenomes-Tr; EBT00001779960.
DR   EnsemblGenomes-Tr; EBT00001779961.
DR   EnsemblGenomes-Tr; EBT00001779962.
DR   EnsemblGenomes-Tr; EBT00001779963.
DR   EnsemblGenomes-Tr; EBT00001779964.
DR   EnsemblGenomes-Tr; EBT00001779965.
DR   EnsemblGenomes-Tr; EBT00001779966.
DR   EnsemblGenomes-Tr; EBT00001779967.
DR   EnsemblGenomes-Tr; EBT00001779968.
DR   EnsemblGenomes-Tr; EBT00001779969.
DR   EnsemblGenomes-Tr; EBT00001779970.
DR   EnsemblGenomes-Tr; EBT00001779971.
DR   EnsemblGenomes-Tr; EBT00001779972.
DR   EnsemblGenomes-Tr; EBT00001779973.
DR   EnsemblGenomes-Tr; EBT00001779974.
DR   EnsemblGenomes-Tr; EBT00001779975.
DR   EnsemblGenomes-Tr; EBT00001779976.
DR   EnsemblGenomes-Tr; EBT00001779977.
DR   EnsemblGenomes-Tr; EBT00001779978.
DR   EnsemblGenomes-Tr; EBT00001779979.
DR   EnsemblGenomes-Tr; EBT00001779980.
DR   EnsemblGenomes-Tr; EBT00001779981.
DR   EnsemblGenomes-Tr; EBT00001779982.
DR   EnsemblGenomes-Tr; EBT00001779983.
DR   EnsemblGenomes-Tr; EBT00001779984.
DR   EnsemblGenomes-Tr; EBT00001779985.
DR   EnsemblGenomes-Tr; EBT00001779986.
DR   EnsemblGenomes-Tr; EBT00001779987.
DR   EnsemblGenomes-Tr; EBT00001779988.
DR   EnsemblGenomes-Tr; EBT00001779989.
DR   EnsemblGenomes-Tr; EBT00001779990.
DR   EnsemblGenomes-Tr; EBT00001779991.
DR   EnsemblGenomes-Tr; EBT00001779992.
DR   EnsemblGenomes-Tr; EBT00001779993.
DR   EnsemblGenomes-Tr; EBT00001779994.
DR   EnsemblGenomes-Tr; EBT00001779995.
DR   EnsemblGenomes-Tr; EBT00001779996.
DR   EnsemblGenomes-Tr; t0252-1.
DR   EnsemblGenomes-Tr; t0253-1.
DR   EnsemblGenomes-Tr; t0254-1.
DR   EnsemblGenomes-Tr; t0438-1.
DR   EnsemblGenomes-Tr; t0439-1.
DR   EnsemblGenomes-Tr; t0440-1.
DR   EnsemblGenomes-Tr; t0441-1.
DR   EnsemblGenomes-Tr; t0445-1.
DR   EnsemblGenomes-Tr; t0446-1.
DR   EnsemblGenomes-Tr; t0470-1.
DR   EnsemblGenomes-Tr; t0625-1.
DR   EnsemblGenomes-Tr; t0861-1.
DR   EnsemblGenomes-Tr; t0863-1.
DR   EnsemblGenomes-Tr; t0873-1.
DR   EnsemblGenomes-Tr; t0876-1.
DR   EnsemblGenomes-Tr; t0878-1.
DR   EnsemblGenomes-Tr; t0932-1.
DR   EnsemblGenomes-Tr; t0933-1.
DR   EnsemblGenomes-Tr; t0934-1.
DR   EnsemblGenomes-Tr; t1121-1.
DR   EnsemblGenomes-Tr; t1140-1.
DR   EnsemblGenomes-Tr; t1291-1.
DR   EnsemblGenomes-Tr; t1292-1.
DR   EnsemblGenomes-Tr; t1786-1.
DR   EnsemblGenomes-Tr; t1833-1.
DR   EnsemblGenomes-Tr; t1984-1.
DR   EnsemblGenomes-Tr; t2123-1.
DR   EnsemblGenomes-Tr; t2124-1.
DR   EnsemblGenomes-Tr; t2125-1.
DR   EnsemblGenomes-Tr; t2196-1.
DR   EnsemblGenomes-Tr; t2197-1.
DR   EnsemblGenomes-Tr; t2198-1.
DR   EnsemblGenomes-Tr; t2199-1.
DR   EnsemblGenomes-Tr; t2200-1.
DR   EnsemblGenomes-Tr; t2201-1.
DR   EnsemblGenomes-Tr; t2310-1.
DR   EnsemblGenomes-Tr; t2527-1.
DR   EnsemblGenomes-Tr; t2600-1.
DR   EnsemblGenomes-Tr; t2611-1.
DR   EnsemblGenomes-Tr; t2612-1.
DR   EnsemblGenomes-Tr; t2613-1.
DR   EnsemblGenomes-Tr; t2614-1.
DR   EnsemblGenomes-Tr; t2615-1.
DR   EnsemblGenomes-Tr; t2719-1.
DR   EnsemblGenomes-Tr; t2721-1.
DR   EnsemblGenomes-Tr; t2723-1.
DR   EnsemblGenomes-Tr; t2725-1.
DR   EnsemblGenomes-Tr; t2726-1.
DR   EnsemblGenomes-Tr; t2897-1.
DR   EnsemblGenomes-Tr; t2898-1.
DR   EnsemblGenomes-Tr; t2955-1.
DR   EnsemblGenomes-Tr; t3029-1.
DR   EnsemblGenomes-Tr; t3133-1.
DR   EnsemblGenomes-Tr; t3207-1.
DR   EnsemblGenomes-Tr; t3209-1.
DR   EnsemblGenomes-Tr; t3306-1.
DR   EnsemblGenomes-Tr; t3307-1.
DR   EnsemblGenomes-Tr; t3308-1.
DR   EnsemblGenomes-Tr; t3309-1.
DR   EnsemblGenomes-Tr; t3310-1.
DR   EnsemblGenomes-Tr; t3363-1.
DR   EnsemblGenomes-Tr; t3364-1.
DR   EnsemblGenomes-Tr; t3365-1.
DR   EnsemblGenomes-Tr; t3366-1.
DR   EnsemblGenomes-Tr; t3450-1.
DR   EnsemblGenomes-Tr; t3451-1.
DR   EnsemblGenomes-Tr; t3452-1.
DR   EnsemblGenomes-Tr; t3453-1.
DR   EnsemblGenomes-Tr; t3454-1.
DR   EnsemblGenomes-Tr; t3482-1.
DR   EnsemblGenomes-Tr; t3483-1.
DR   EnsemblGenomes-Tr; t3484-1.
DR   EnsemblGenomes-Tr; t3485-1.
DR   EnsemblGenomes-Tr; t3490-1.
DR   EnsemblGenomes-Tr; t3491-1.
DR   EnsemblGenomes-Tr; t3492-1.
DR   EnsemblGenomes-Tr; t3493-1.
DR   EnsemblGenomes-Tr; t3628-1.
DR   EnsemblGenomes-Tr; t3629-1.
DR   EnsemblGenomes-Tr; t3630-1.
DR   EnsemblGenomes-Tr; t3768-1.
DR   EnsemblGenomes-Tr; t3880-1.
DR   EnsemblGenomes-Tr; t4106-1.
DR   EnsemblGenomes-Tr; t4107-1.
DR   EnsemblGenomes-Tr; t4108-1.
DR   EnsemblGenomes-Tr; t4372-1.
DR   EnsemblGenomes-Tr; t4404-1.
DR   EnsemblGenomes-Tr; t4405-1.
DR   EnsemblGenomes-Tr; t4517-1.
DR   EnsemblGenomes-Tr; t4596-1.
DR   EnsemblGenomes-Tr; t4597-1.
DR   EnsemblGenomes-Tr; t4598-1.
DR   EnsemblGenomes-Tr; t4649-1.
DR   EnsemblGenomes-Tr; t4650-1.
DR   EnsemblGenomes-Tr; t4651-1.
DR   EnsemblGenomes-Tr; t4652-1.
DR   EnsemblGenomes-Tr; t4653-1.
DR   EnsemblGenomes-Tr; t4654-1.
DR   EnsemblGenomes-Tr; t4655-1.
DR   EnsemblGenomes-Tr; t4656-1.
DR   EuropePMC; PMC1291290; 16291663.
DR   EuropePMC; PMC1456234; 16204219.
DR   EuropePMC; PMC151493; 12644504.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC1797678; 17088481.
DR   EuropePMC; PMC2049048; 17975028.
DR   EuropePMC; PMC2168493; 17728466.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2394748; 17547764.
DR   EuropePMC; PMC2395068; 18367574.
DR   EuropePMC; PMC2443934; 18443113.
DR   EuropePMC; PMC2652035; 17124322.
DR   EuropePMC; PMC2652037; 18660809.
DR   EuropePMC; PMC2658671; 19159446.
DR   EuropePMC; PMC2704369; 19609351.
DR   EuropePMC; PMC2792183; 19826075.
DR   EuropePMC; PMC2886058; 20492644.
DR   EuropePMC; PMC2928814; 20865122.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC2954527; 20409393.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3294861; 22247511.
DR   EuropePMC; PMC3318496; 22461552.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3358197; 21749778.
DR   EuropePMC; PMC3372160; 22442318.
DR   EuropePMC; PMC3500351; 23166822.
DR   EuropePMC; PMC3586657; 23190111.
DR   EuropePMC; PMC3632133; 23470992.
DR   EuropePMC; PMC3751609; 23969054.
DR   EuropePMC; PMC3771896; 24069274.
DR   EuropePMC; PMC3875573; 24386394.
DR   EuropePMC; PMC3907412; 24498453.
DR   EuropePMC; PMC3910800; 24145538.
DR   EuropePMC; PMC4010983; 24659774.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4289253; 25412680.
DR   EuropePMC; PMC4361174; 25774907.
DR   EuropePMC; PMC4558774; 26336060.
DR   EuropePMC; PMC4807491; 26831468.
DR   EuropePMC; PMC4921243; 25961941.
DR   EuropePMC; PMC5039429; 27420101.
DR   EuropePMC; PMC5059462; 27703135.
DR   EuropePMC; PMC5121207; 27896141.
DR   EuropePMC; PMC5126401; 27975062.
DR   EuropePMC; PMC5320704; 28348832.
DR   EuropePMC; PMC5826628; 29444431.
DR   EuropePMC; PMC6035254; 29980701.
DR   GOA; P58744.
DR   GOA; P59765.
DR   GOA; P61472.
DR   GOA; P69737.
DR   GOA; Q8Z6G0.
DR   InterPro; IPR001303; Aldolase_II/adducin_N.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR007041; Arg_succinylTrfase_AstA/AruG.
DR   InterPro; IPR013447; Rhamnulose-1-P_Aldolase.
DR   InterPro; IPR016181; Acyl_CoA_acyltransferase.
DR   InterPro; IPR017650; Arginine_N-succinylTrfase.
DR   InterPro; IPR018170; Aldo/ket_reductase_CS.
DR   InterPro; IPR018232; Glyco_hydro_37_CS.
DR   InterPro; IPR020887; UPF0509.
DR   InterPro; IPR023720; Trehalase_periplasmic.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01390; isrG.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; AE014613.
DR   SILVA-SSU; AE014613.
DR   StrainInfo; 581835; 0.
DR   UniProtKB/Swiss-Prot; P0C5Y5; YCIZ_SALTI.
DR   UniProtKB/Swiss-Prot; P58744; DKGA_SALTI.
DR   UniProtKB/Swiss-Prot; P59765; TREA_SALTI.
DR   UniProtKB/Swiss-Prot; P61472; YIDD_SALTI.
DR   UniProtKB/Swiss-Prot; P69737; RHAD_SALTI.
DR   UniProtKB/Swiss-Prot; Q8Z6G0; ASTA_SALTI.
XX
CC   On or before Jan 13, 2006 this sequence version replaced
CC   gi:29136167, gi:29136420, gi:29136667, gi:29136933, gi:29137221,
CC   gi:29137536, gi:29137797, gi:29138096, gi:29138362, gi:29138627,
CC   gi:29138899, gi:29139182, gi:29139451, gi:29139701, gi:29139952,
CC   gi:29140243.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4791961
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhi str. Ty2"
FT                   /sub_species="enterica"
FT                   /strain="Ty2"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Typhi"
FT                   /db_xref="taxon:209261"
FT   gene            190..255
FT                   /gene="thrL"
FT                   /locus_tag="t0001"
FT   CDS_pept        190..255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="t0001"
FT                   /product="thr operon leader peptide"
FT                   /note="corresponds to STY0001 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67735"
FT                   /db_xref="GOA:Q8XG12"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XG12"
FT                   /protein_id="AAO67735.1"
FT                   /translation="MNRISTTTITTITITTGNGAG"
FT   gene            337..2799
FT                   /gene="thrA"
FT                   /locus_tag="t0002"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="t0002"
FT                   /product="aspartokinase I"
FT                   /note="corresponds to STY0002 from Accession AL513382:
FT                   Salmonella typhi CT18; homoserine dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:t0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67736"
FT                   /db_xref="GOA:Q8Z9R7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9R7"
FT                   /protein_id="AAO67736.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNSRQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPDEFDASGDVTAFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2801..3730
FT                   /gene="thrB"
FT                   /locus_tag="t0003"
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="t0003"
FT                   /product="homoserine kinase"
FT                   /note="corresponds to STY0003 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67737"
FT                   /db_xref="GOA:P65227"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65227"
FT                   /protein_id="AAO67737.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3734..5020
FT                   /gene="thrC"
FT                   /locus_tag="t0004"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="t0004"
FT                   /product="threonine synthase"
FT                   /note="corresponds to STY0004 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67738"
FT                   /db_xref="GOA:Q8Z9R6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9R6"
FT                   /protein_id="AAO67738.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNINDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5114..5887)
FT                   /gene="yaaA"
FT                   /locus_tag="t0005"
FT   CDS_pept        complement(5114..5887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="t0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0005 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67739"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9R5"
FT                   /protein_id="AAO67739.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLDAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
FT   gene            complement(5966..7396)
FT                   /gene="yaaJ"
FT                   /locus_tag="t0006"
FT   CDS_pept        complement(5966..7396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="t0006"
FT                   /product="putative amino-acid transport protein"
FT                   /note="corresponds to STY0006 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67740"
FT                   /db_xref="GOA:Q8Z9R4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9R4"
FT                   /protein_id="AAO67740.1"
FT                   /translation="MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFSR
FT                   SLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIGMA
FT                   TSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNSVQA
FT                   NAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIALLWVAGSVFI
FT                   CLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMGSTPNA
FT                   AAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQLLQHAM
FT                   VSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLATLGMVIA
FT                   GTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGVRPQFDPRRF
FT                   PDIEPQLAPDTWDAASRD"
FT   gene            7665..8618
FT                   /gene="talB"
FT                   /locus_tag="t0007"
FT   CDS_pept        7665..8618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="t0007"
FT                   /product="transaldolase B"
FT                   /note="corresponds to STY0007 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67741"
FT                   /db_xref="GOA:P66956"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66956"
FT                   /protein_id="AAO67741.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8729..9319
FT                   /gene="mog"
FT                   /locus_tag="t0008"
FT   CDS_pept        8729..9319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="t0008"
FT                   /product="molybdopterin biosynthesis Mog protein"
FT                   /note="corresponds to STY0008 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67742"
FT                   /db_xref="GOA:Q8Z9R3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9R3"
FT                   /protein_id="AAO67742.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFELQTR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
FT   gene            complement(9376..9942)
FT                   /gene="yaaH"
FT                   /locus_tag="t0009"
FT   CDS_pept        complement(9376..9942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="t0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0009 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67743"
FT                   /db_xref="GOA:Q8XGB2"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGB2"
FT                   /protein_id="AAO67743.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   gene            complement(10092..10805)
FT                   /locus_tag="t0010"
FT   CDS_pept        complement(10092..10805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0010 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67744"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGV3"
FT                   /protein_id="AAO67744.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   gene            complement(10841..11245)
FT                   /gene="yaaI"
FT                   /locus_tag="t0011"
FT   CDS_pept        complement(10841..11245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="t0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0011 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67745"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9R2"
FT                   /protein_id="AAO67745.1"
FT                   /translation="MRSVLTISVGLLFGLALSSVAHANDHKILGVIAMPRNETNDLALK
FT                   IPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMARLKVIGDD"
FT   gene            11594..13510
FT                   /gene="dnaK"
FT                   /locus_tag="t0012"
FT   CDS_pept        11594..13510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="t0012"
FT                   /product="DnaK protein"
FT                   /note="heat shock protein 70; corresponds to STY0012 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67746"
FT                   /db_xref="GOA:Q8Z9R1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9R1"
FT                   /protein_id="AAO67746.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALSALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13596..14735
FT                   /gene="dnaJ"
FT                   /locus_tag="t0013"
FT   CDS_pept        13596..14735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="t0013"
FT                   /product="DnaJ protein"
FT                   /note="corresponds to STY0013 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67747"
FT                   /db_xref="GOA:P0A1G8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G8"
FT                   /protein_id="AAO67747.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            15020..15967
FT                   /locus_tag="t0014"
FT   CDS_pept        15020..15967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0014"
FT                   /product="putative regulatory protein"
FT                   /note="corresponds to STY0014 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67748"
FT                   /db_xref="GOA:Q8Z9R0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9R0"
FT                   /protein_id="AAO67748.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFSVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDE
FT                   LYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPPPELAF
FT                   KSVQVYASWKKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16094..16438
FT                   /locus_tag="t0015"
FT   CDS_pept        16094..16438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0015"
FT                   /product="putative phage protein"
FT                   /note="corresponds to STY0015 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67749"
FT                   /db_xref="GOA:Q8Z9Q9"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q9"
FT                   /protein_id="AAO67749.1"
FT                   /translation="MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEYN
FT                   SSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRI
FT                   KKIIGGNNSD"
FT   gene            complement(16499..17032)
FT                   /locus_tag="t0016"
FT   CDS_pept        complement(16499..17032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0016 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67750"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q8"
FT                   /protein_id="AAO67750.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGDYHPSAWLQRWLNVFN
FT                   HEGKRYPDVHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGMYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   gene            complement(17049..17492)
FT                   /locus_tag="t0017"
FT   CDS_pept        complement(17049..17492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0017"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0017 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67751"
FT                   /db_xref="GOA:Q8Z9Q7"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q7"
FT                   /protein_id="AAO67751.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   gene            17873..19972
FT                   /locus_tag="t0018"
FT   CDS_pept        17873..19972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0018"
FT                   /product="putative chitinase"
FT                   /note="corresponds to STY0018 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67752"
FT                   /db_xref="GOA:Q8Z9Q6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q6"
FT                   /protein_id="AAO67752.1"
FT                   /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNK
FT                   YKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGCDLTNVSPTAYDKLIFGFVGITGFR
FT                   KIDKEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFETSGWDVDPKTVTQANAK
FT                   GMLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKTFAKGVVKLFKQF
FT                   PMFSEVDIDWEYPNDEGAGNPFGAEDGANYALLIAELRKQLDSAGLSNVKISIAASAVT
FT                   TIFDHAKVKDLLAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLL
FT                   AEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGDTTGSFESGTSEWYDVIYS
FT                   YLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVF
FT                   TWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDDEQSDSDDAQKVNHAP
FT                   KAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEK
FT                   TAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEETTPAED
FT                   DTSADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWT
FT                   DLGAY"
FT   gene            20004..21155
FT                   /locus_tag="t0019"
FT   CDS_pept        20004..21155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0019"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0019 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67753"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q5"
FT                   /protein_id="AAO67753.1"
FT                   /translation="MIQAPVYRGFSPPGTEEEQTMTISIHASAFDVNSWYQKITLTFIN
FT                   ESGNPVDMNHAAISFTASGHIDPWGNSGGTLKGNPPLTLNDSSYGTLETNNIIINNSDA
FT                   LLLQPGERGTLSFSLAATQVPVKMSAVTLTLASSSSEDAESATPSDQETPAIPAADEQP
FT                   AESDVPEKDNDLQERGLTLNVSELNAASWYQHVTFTLTNLYAQAVDLNQLQLNFTASAH
FT                   PDPYSPFQGTMLGNQAVTLASDGGWPIEKNTITINHDGALMLAAGDIAELQCYLAATQT
FT                   PVAISDLNATLAHDPAHQGKICVHFPAMTQTVALKPVIELLFPAGETRRFVGEWGEVLT
FT                   ISDLSAGTYRLIVPVLANDEMQIAPVESSFTVTLQSGDAAAQV"
FT   gene            21198..23060
FT                   /locus_tag="t0020"
FT   CDS_pept        21198..23060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0020"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0020 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67754"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q4"
FT                   /protein_id="AAO67754.1"
FT                   /translation="MIDAPALGNAKLTVEIADATQADERTVTLIANQPQLITRLLAGHH
FT                   YTVNLQPAMINNRFISAPIQLTGFIPAAAQVAEVAVAYQQSALDTASFVTVDATILGLP
FT                   DGVAPQRYLFSSGKYQYSLMLESGSDRQTLSLRFAPGLYDVQTDDIFIDSVPWRCEQAG
FT                   PLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGVTVNAPETVSLYRDIPFSALFKYDG
FT                   FDGGGDPVPAAEVDVNGDVFLDYATLPIHKTVALVRQIEKEAGRSVMPVMVIYTANASG
FT                   GSALVDLQDAQKLRNHFGNFITQCLAAQSYKDETHPVPATFVLNPDFLGALQQGPYGYT
FT                   VVRQKNSVPVNAQLAAAIQALPAMAGFIAPSLPTFSDDLYGYIQAVNYLVRQFAPDVAF
FT                   GWQTNVWATGTADWVLRDTADPVAEGQAIAGFIHELGVYSGEYAPDFIAFDEFERDCFS
FT                   PDALAHYGWNATCWLNYLAMVKQVTKALLTPAMLWQIPGGHMPTVEEGVSKISAAHFAS
FT                   GGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVPTVGDFLRKDKGYDWGQMQALNLPD
FT                   FNVFSILWGGGSTISITTIHSNGEDGGWLADKMVEYYAAPRYFR"
FT   gene            23341..24045
FT                   /locus_tag="t0021"
FT   CDS_pept        23341..24045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0021 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67755"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q3"
FT                   /protein_id="AAO67755.1"
FT                   /translation="MKKMMNDAFAKDNNENLLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGIVSFCRDDNRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCSGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLIEIWAYPQAYRENIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            24473..25015
FT                   /gene="bcfA"
FT                   /locus_tag="t0022"
FT   CDS_pept        24473..25015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfA"
FT                   /locus_tag="t0022"
FT                   /product="fimbrial subunit"
FT                   /note="corresponds to STY0024 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67756"
FT                   /db_xref="GOA:Q8Z9Q2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q2"
FT                   /protein_id="AAO67756.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMAANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
FT   gene            25116..25802
FT                   /gene="bcfB"
FT                   /locus_tag="t0023"
FT   CDS_pept        25116..25802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfB"
FT                   /locus_tag="t0023"
FT                   /product="fimbrial chaperone"
FT                   /note="corresponds to STY0025 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67757"
FT                   /db_xref="GOA:Q8Z9Q1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9Q1"
FT                   /protein_id="AAO67757.1"
FT                   /translation="MKKNVPIFLRLLLLLSAAGLSFAVQAGGIALGATRVIYPQGSKQT
FT                   SLPIINSSASNVFLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTD
FT                   RESVFYLNSKVIPSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPATLRCRNER
FT                   GQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPA
FT                   RVCPAS"
FT   gene            25807..28428
FT                   /pseudo
FT                   /gene="bcfC"
FT                   /locus_tag="t0024"
FT                   /note="corresponds to STY0026 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            28429..29436
FT                   /gene="bcfD"
FT                   /locus_tag="t0025"
FT   CDS_pept        28429..29436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfD"
FT                   /locus_tag="t0025"
FT                   /product="fimbrial subunit"
FT                   /note="corresponds to STY0029 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67758"
FT                   /db_xref="GOA:A0A0H2VKK2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VKK2"
FT                   /protein_id="AAO67758.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAHADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLGPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHFPQAIASDNADVGVVVETDEG
FT                   NALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            29437..29982
FT                   /gene="bcfE"
FT                   /locus_tag="t0026"
FT   CDS_pept        29437..29982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfE"
FT                   /locus_tag="t0026"
FT                   /product="fimbrial subunit"
FT                   /note="corresponds to STY0030 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67759"
FT                   /db_xref="GOA:Q8Z9P9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P9"
FT                   /protein_id="AAO67759.1"
FT                   /translation="MNRSHCALFVMGLILCPQINASADDLAYNLEFTGTIVAQTCDIDI
FT                   SSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGITGAKIWFTGEPDPDNPALL
FT                   AITDTGMGSGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRP
FT                   TVTSGNATAVMYFDMQYE"
FT   gene            29998..30516
FT                   /gene="bcfF"
FT                   /locus_tag="t0027"
FT   CDS_pept        29998..30516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfF"
FT                   /locus_tag="t0027"
FT                   /product="fimbrial subunit"
FT                   /note="corresponds to STY0031 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67760"
FT                   /db_xref="GOA:Q8Z9P8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P8"
FT                   /protein_id="AAO67760.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAGDSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGTVTPGDANA
FT                   SATFILAYE"
FT   gene            30509..31213
FT                   /gene="bcfG"
FT                   /locus_tag="t0028"
FT   CDS_pept        30509..31213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfG"
FT                   /locus_tag="t0028"
FT                   /product="fimbrial chaperone"
FT                   /note="corresponds to STY0032 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67761"
FT                   /db_xref="GOA:Q8Z9P7"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P7"
FT                   /protein_id="AAO67761.1"
FT                   /translation="MNKFFLHCAIYWCLLPISWAQAGVVIGGTRFIYHAGAPALSVPVS
FT                   NHSEASWLIDTHILPGGRWPGTKNEGNITPFVVTPPLFMLSARQENSMRVVYTGGPLPA
FT                   DRESLFTLSIAAIPSGKPEANRVQMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDG
FT                   ATVRNPTPYYVTLFLLRANERAQDNAGVVAPFATRQTDWCRHAVRCTVRWQSINDYGRV
FT                   MTAQTVDLTRIH"
FT   gene            31278..32123
FT                   /locus_tag="t0029"
FT   CDS_pept        31278..32123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0029"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY0033 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67762"
FT                   /db_xref="GOA:Q8Z9P6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P6"
FT                   /protein_id="AAO67762.1"
FT                   /translation="MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIV
FT                   SHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSV
FT                   GPSEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAAR
FT                   VGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSG
FT                   AVHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG
FT                   "
FT   gene            32162..32449
FT                   /locus_tag="t0030"
FT   CDS_pept        32162..32449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0030"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0034 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P5"
FT                   /protein_id="AAO67763.1"
FT                   /translation="MKSMRCVIPVILLSFIVHEGTAKPTAQIHFMGSVVEAGCWNDVGT
FT                   LEIQCYNKEGVERYIIVENIITPISSPHATVKRDYLDEDKQLTVLRIVYD"
FT   gene            complement(32549..32998)
FT                   /locus_tag="t0031"
FT   CDS_pept        complement(32549..32998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0031"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0035 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67764"
FT                   /db_xref="GOA:Q8Z9P4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P4"
FT                   /protein_id="AAO67764.1"
FT                   /translation="MRQYTINNEFIYNESLREIISLHDKKVLKVTLMRARCLSYLFENA
FT                   YKKLITREMISHAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKIDE
FT                   RFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
FT   gene            33368..34363
FT                   /locus_tag="t0032"
FT   CDS_pept        33368..34363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0032"
FT                   /product="putative transcriptional regulator (lysR family)"
FT                   /note="corresponds to STY0036 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67765"
FT                   /db_xref="GOA:Q8Z9P3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P3"
FT                   /protein_id="AAO67765.1"
FT                   /translation="MRPIKNAKKIDYNLIKVFDTVITEGNATRAARKLDVTPAAISQAL
FT                   LRLQNLYGEELFIRTRKGLVPSSKGKSLHQVFRQAIESIESTLCDKTDAQESNELIVLG
FT                   SDITENYYFPALLDTVLMNRYIIKHYAIKKTGEYSPASMLTHGYADIIMGILEIKNEMI
FT                   ESFLIDNLSDFVCVCGEKSPLVGLEKMSLYNFYAARHAVYHSDMFSSFNADSIDLFKSS
FT                   TPYAGRREIGYYSDSLFGVIGVVEKSDMVAILPGKIATYFRDVRRYNIKILRMPDEIIF
FT                   RTLPVYAYLATNSTHYKNAKKLISTFQSTFLFSQEKQPDALVEGSTSLCD"
FT   gene            complement(34511..34816)
FT                   /locus_tag="t0033"
FT   CDS_pept        complement(34511..34816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0033"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY0038 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67766"
FT                   /db_xref="GOA:Q8Z9P2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P2"
FT                   /protein_id="AAO67766.1"
FT                   /translation="MTIYLINSTHTYNDKTNELKNIKTGKIIKIAAMRIKCLEYMLNHA
FT                   QQEIIYKKQLTNELWGERSQFISDANLTQILYLLRRDLKGFGLSQFFPRCLERVLK"
FT   gene            35339..37057
FT                   /locus_tag="t0034"
FT   CDS_pept        35339..37057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0034"
FT                   /product="possible sulfatase"
FT                   /note="corresponds to STY0039 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67767"
FT                   /db_xref="GOA:Q8Z9P1"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P1"
FT                   /protein_id="AAO67767.1"
FT                   /translation="MNKKNSSMVNLPAPRESINQKIDTNNALVLNHNAIYEQRLAEITQ
FT                   SNTCDKAIVTVNPYGTAPLSLYLGIWIDEAAALEINVVDSEATTEAVRYQYDVHPGANL
FT                   IPVCGMVSAVNNQITLRLASQIVGQYTVMTDALPPTDSANVSLGFPIISVSCPAQQASL
FT                   MEEGLYFSTYFDRYNLAFDHNGIVRWYVSQEIPSYNFVRMDNGHFLATSQGINHCLNMY
FT                   EFDIMGRVYTVYLLDNEFHHSILPIENNLAIAPSEYSNGRPDGYSTGKDGVSIINLSTG
FT                   LEVAYYDMLYVMDYSRSPRPSGSAPGQDVSMDDWLHINQSYINEPNNLLICSGRHQSAI
FT                   FGVNVDSGELRFIMANHEDWSDEFKQYLLTPVDDDGVPLYDLTSPGGIDAADKNFWTWG
FT                   QHNIVEIPNDEPGILEFMVFDNGNYRSREDAKSLLPLDNFSRVVQFKINLNTMTVTRPY
FT                   EYGKTEVGNRGYSSFVSAKHLLTNGHLVIHFGATTVDEFEHTITAQPGSSDLVDPDEGQ
FT                   QALGRLVLQEINKETKEVLFEAMVTSGYFKNEETNGTNYRYDISAFRVYKMPLFA"
FT   gene            complement(37103..38674)
FT                   /locus_tag="t0035"
FT   CDS_pept        complement(37103..38674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0035"
FT                   /product="putative secreted 5'-nucleotidase"
FT                   /note="corresponds to STY0040 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67768"
FT                   /db_xref="GOA:Q8XG92"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG92"
FT                   /protein_id="AAO67768.1"
FT                   /translation="MVYMNKKFSISLLSLCIGLSSAISFSADARDITIYYTNDLHAHVT
FT                   PEIIPYVSKTRPVGGFAPISKIVKDAKAKEKDVFFFDAGDYFTGPFISTLTKGEAIIDI
FT                   LNTMPYDAVSVGNHEFDHGHENLVKQLSKLQFPVLLDNVFYSGTDTPLIKEPYTIVEKD
FT                   GFKIGVIGMHGVSAFYEAIAAGVREGVDCRDPIPYVKKQLEELKGKVDLTVLLAHEGVP
FT                   GMQSSAGEADVARALKTDVDMAKSLEGYGLNVLITGHAHKGTPEPIKVGDTLVVSTDAY
FT                   TIELGKLVLDWNPETKKVDSYNGKLITMYADTYKPDPVTQAKIDEWDNKVKKITDEVVA
FT                   HSPEVLTRSYGESAPTGNLITDALMATVPGADASFYNAGGIRTELPKGNITYGDVLSMY
FT                   PFTNDVMSMEISGKDLKSIMSHAADLKNGMLHVSKTVQFKYDSTKPLGQRIVEFDIKGK
FT                   PVEDNKLYTVALDSFIGKGGGGFTFTKGKNIKYIGIQTAPALVNYMKQVNNIQPDHTMR
FT                   VDDISK"
FT   gene            complement(38773..39534)
FT                   /locus_tag="t0036"
FT   CDS_pept        complement(38773..39534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0036"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY0041 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67769"
FT                   /db_xref="GOA:Q8Z9P0"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9P0"
FT                   /protein_id="AAO67769.1"
FT                   /translation="MKNKKYINSLLAACVLFSCFNGQAAELKRVYGKLSFGYGDWNKGF
FT                   VNVDRGEVWKAVADFGAVFDRGEFASFYEMNVLNHPVEGRNHVTQFLGHYRVVEGSNFT
FT                   AMMKLYMSMENKFGDELNMMYGVGYLGLTSPSGFIKPYFAVHNLSNDYTSKKYGQATGF
FT                   NGYVLGWVAAYNFDMFNEKFVISNWNEVEMDRNDAYAEQQGGTTGLNGAVTFTWKFMPR
FT                   WTASVSYRYFNNKLGYNGYGDRMNYLIGFKF"
FT   gene            40128..41621
FT                   /locus_tag="t0037"
FT   CDS_pept        40128..41621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0037"
FT                   /product="putative secreted sulfatase"
FT                   /note="corresponds to STY0042 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67770"
FT                   /db_xref="GOA:Q8Z9N9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N9"
FT                   /protein_id="AAO67770.1"
FT                   /translation="MKRTVVASMIGLALCAGCVLSTAQAATAKRPNLVIILADDLGYGD
FT                   LATYGHRIVKTPNIDKLAQEGVKFTDYYAPAPLCSPSRAGLLTGRMPFRTGIRSWIPEG
FT                   KDVALGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQAKDMGFDYTLVNPAGFV
FT                   TDATLDNAKERPRYGVVHPTGWIRNGQHIGRADKMSGEFVSSEVVNWLDNKKDDNPFFL
FT                   YVAFTEVHSPLASPKKYLDMYSQYMTDYQKQHPDLFYGDWADKPWRGTGEYYANISYMD
FT                   EQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELKLAGETDGLRGRKDNLWEG
FT                   GIRVPAIIKYGKHIPQGMVTDTPVYGLDWLPTLANMMDFKLPTDRTYDGQSLVPLLKDK
FT                   TLKRQKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRQNKPKYLYNLKTDRFETLNQIG
FT                   KQPQIEKQLYGKFLKYKKDIDNDSLMKARGDKPTPVTWG"
FT   gene            41720..42910
FT                   /locus_tag="t0038"
FT   CDS_pept        41720..42910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0038"
FT                   /product="possible sulfatase regulatory protein"
FT                   /note="corresponds to STY0043 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67771"
FT                   /db_xref="GOA:Q8Z9N8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N8"
FT                   /protein_id="AAO67771.1"
FT                   /translation="MMFGKSCQVMVKPTGSVCNLDCKYCFYLEKEKLYPDRKNHYKMSE
FT                   ETLELFIRQQIAAQDIDEVIFAWQGGEPTLMGIPFYRKAVEFQQRYCGGKTIVNTFQTN
FT                   GILINDDWATFFREHDFLVGVSIDGDAALHDEWRVTRSGKPTHEKVENAVRCLAQHDVE
FT                   FNTLTVVNRTNMHHPVQVYRYLKSVGSRYMQFIPLVERCGENGLAQPQDKHIAMTPWSV
FT                   DSLQFGQFLNAVFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPTCGSAFAMEMN
FT                   GDVYNCDHFVYPQFKLGNIHQKTLRQMNQGEQNRQFGSDKQRSMAQECHRCQWKFACYG
FT                   GCPKHRFLPSASGATNHNYLCAGYQAFFSHTATAMSAMRTLYEKGISLAEIKSIFV"
FT   gene            43198..44181
FT                   /locus_tag="t0039"
FT   CDS_pept        43198..44181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0039"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0045 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N7"
FT                   /protein_id="AAO67772.1"
FT                   /translation="MYCRQCNKTFISYTAIRSDARQENLATLIGEGASLVEIRAALAID
FT                   STGFSRELQKLSRRANQAERDFVFPAFDIAMSTRAFRVKFNGGDSSLYVLVTAEEESGK
FT                   VVAISTNYSAQPVEADYQYHSDYEERLPSGTLAHLVQRKEALTMRRNVLFDVDYGPAIL
FT                   YKNDPGMLVKPVLPAYRHFELVQALTDERSLNVQHYLDHECFILGGCMMANFSYLRQGR
FT                   CHISFVRERGVTPPKRDLPPRLFLSGGIRNNVWRTFSTRDYAMAVCNLTGNKKVSLLRH
FT                   ATLNSATAFIRYVHNHPFLPHLNRMSPGNVVAVLDYLKFEYDASCN"
FT   gene            44308..46023
FT                   /locus_tag="t0040"
FT   CDS_pept        44308..46023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0040"
FT                   /product="possible sulfatase"
FT                   /note="corresponds to STY0046 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67773"
FT                   /db_xref="GOA:Q8Z9N6"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N6"
FT                   /protein_id="AAO67773.1"
FT                   /translation="MNTLTATSVVLPAPRPAINQGIDINNEIVLNHTAIYENCLAQVTQ
FT                   ENTVENALMLLDPYGTAPLSAYAGVWSLEPAEIMVTVQDAAKTAMPVEHLYTLTAGANL
FT                   LPVLGLVAETENRIVFSQADTPLAVYTLTTQPLPPVDSAEVVLGFPIINVTQPATDVDK
FT                   MAPGFYFVTHFDRYNYALDQNGLVRWYVTQDYPSYNFVRIDNGHFLTTSEAKNTYLDMY
FT                   EFDMMGRLHTFYNLDNQFHHSIWPWDSNTIVAPSEYTSGRPDDLKTNEDGVSVVDLATG
FT                   LETAYYDMAKVLDTTRVSRPSGTAPGEDPTVKDWLHINQSYVNETNQLLIASGRHQSAV
FT                   FGVDLQTQALRFILSTHEDWDDAYQPYLLTPVDSEGVALYDFSKQEDIDAADRDFWTWG
FT                   QHNVVEIANNTPGIVEFMVFDNGNYRSRDDSKSLLPPDNYSRIVHFVVNMNEMTVMRPF
FT                   EYGKELGARGYSSCVSAKAIQQNGNIVVHFADCTFDENGRAISCQPGESDIIDPQAGSE
FT                   AMGLLILQEIAPTEKTVLFEATMTSGYYKNAETNGEGYRYDITSFRVYKMDLYA"
FT   gene            46186..47352
FT                   /gene="nhaA"
FT                   /locus_tag="t0041"
FT   CDS_pept        46186..47352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="t0041"
FT                   /product="Na(+)/H(+) antiporter 1"
FT                   /note="corresponds to STY0047 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67774"
FT                   /db_xref="GOA:Q8Z9N5"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9N5"
FT                   /protein_id="AAO67774.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTM
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNIDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            47414..48313
FT                   /gene="nhaR"
FT                   /locus_tag="t0042"
FT   CDS_pept        47414..48313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="t0042"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="corresponds to STY0048 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67775"
FT                   /db_xref="GOA:Q8XGC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGC3"
FT                   /protein_id="AAO67775.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILG
FT                   EFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNADYSALFKLQ"
FT   gene            complement(48368..50407)
FT                   /locus_tag="t0043"
FT   CDS_pept        complement(48368..50407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0043"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="corresponds to STY0049 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67776"
FT                   /db_xref="GOA:Q8Z9N4"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N4"
FT                   /protein_id="AAO67776.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEIGRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYHDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKYGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCDVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHEGMRERDVWLPE
FT                   GETWTDLATGESYSGGQTLHYATPLNRIPVFIREGGQYRSLLNL"
FT   gene            complement(50447..51820)
FT                   /locus_tag="t0044"
FT   CDS_pept        complement(50447..51820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0044"
FT                   /product="putative transport protein"
FT                   /note="corresponds to STY0050 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67777"
FT                   /db_xref="GOA:Q8Z9N3"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N3"
FT                   /protein_id="AAO67777.1"
FT                   /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFGSTYILYF
FT                   YTDVAGISLAVAGIILLLARIVDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAVFS
FT                   ALSFWSPDISITGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSWRMT
FT                   GGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMDADKI
FT                   QHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRSTTIVYYLTYNLDRKDLVPLI
FT                   NSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAADNITFLIAAWILGN
FT                   IGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTALAAWIMNS
FT                   FGYVPNHAQSAAGLEGITWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRHDLETINS"
FT   gene            complement(52277..52540)
FT                   /gene="rpsT"
FT                   /locus_tag="t0045"
FT   CDS_pept        complement(52277..52540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="t0045"
FT                   /product="30S ribosomal protein S20"
FT                   /note="corresponds to STY0052 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67778"
FT                   /db_xref="GOA:P0A2B2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2B2"
FT                   /protein_id="AAO67778.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            52646..52861
FT                   /locus_tag="t0046"
FT   CDS_pept        52646..52861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0053 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67779"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFA7"
FT                   /protein_id="AAO67779.1"
FT                   /translation="MQHSLRSDGAGFYQLACCEYSLSMRKIALSGGFWGGVCRMAMKSI
FT                   FFMFHQGNRRLTLTAVQGILLRFSLF"
FT   gene            52869..53807
FT                   /gene="ribF"
FT                   /locus_tag="t0047"
FT   CDS_pept        52869..53807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="t0047"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="corresponds to STY0054 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67780"
FT                   /db_xref="GOA:Q8XG31"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG31"
FT                   /protein_id="AAO67780.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRRR
FT                   GLPVVVMIFEPQPLELFATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQ
FT                   TFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARKFFGLAGQV"
FT   gene            53852..56686
FT                   /gene="ileS"
FT                   /locus_tag="t0048"
FT   CDS_pept        53852..56686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="t0048"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="corresponds to STY0055 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67781"
FT                   /db_xref="GOA:Q8Z9N2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9N2"
FT                   /protein_id="AAO67781.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYVPGWDCHGLPIEL
FT                   KVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFRAVDQDAV
FT                   KAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQAVILAKDLVESV
FT                   IQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELLKEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVDGIQAWWDLDPKE
FT                   ILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEGSDQHRGWFMSSL
FT                   MISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTD
FT                   YTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEEMVVLDRWAVGCA
FT                   KTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTA
FT                   LYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGLEENEEFNDAFWD
FT                   DVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLLGEEVRFIFITSQ
FT                   FVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVGKVAEHADICGRC
FT                   VSNIAGNGEQRKFA"
FT   gene            56686..57186
FT                   /gene="lspA"
FT                   /locus_tag="t0049"
FT   CDS_pept        56686..57186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="t0049"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="corresponds to STY0056 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67782"
FT                   /db_xref="GOA:Q8Z9N1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9N1"
FT                   /protein_id="AAO67782.1"
FT                   /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPS
FT                   LNLHYARNYGAAFSFLADSGSWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAK
FT                   EQA"
FT   gene            57341..57790
FT                   /gene="fkpB"
FT                   /locus_tag="t0050"
FT   CDS_pept        57341..57790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="t0050"
FT                   /product="probable FkbB-type 16 kD peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /note="corresponds to STY0057 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67783"
FT                   /db_xref="GOA:Q8XG79"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG79"
FT                   /protein_id="AAO67783.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            57793..58743
FT                   /gene="lytB"
FT                   /locus_tag="t0051"
FT   CDS_pept        57793..58743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="t0051"
FT                   /product="LytB protein"
FT                   /note="corresponds to STY0058 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67784"
FT                   /db_xref="GOA:P58678"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58678"
FT                   /protein_id="AAO67784.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            58943..60145
FT                   /locus_tag="t0052"
FT   CDS_pept        58943..60145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0052"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0059 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9N0"
FT                   /protein_id="AAO67785.1"
FT                   /translation="MGKIKYRLPTLLAIGFWMDAASATVLELPAWERNYTGTIAGKPVN
FT                   VNITRFGNTLYGHYCYEPCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSSEI
FT                   KGEWTSADKKRHFPVALIYYKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKL
FT                   YRDGKLIQTLDTASVGTCSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLYDPAK
FT                   QRYVDAPASYQEITSPEIDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQ
FT                   PVISKGKMYNCYMTPSYADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVRTVIQAE
FT                   KPGAEPESLEIQWQENKASPGRFCPLVPFVEGDKLSPRLVTDDDVPDTCISRAEYEDIK
FT                   Q"
FT   gene            60161..61081
FT                   /gene="yaaF"
FT                   /locus_tag="t0053"
FT   CDS_pept        60161..61081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaF"
FT                   /locus_tag="t0053"
FT                   /product="putative nucleoside hydrolase (IUNH family)"
FT                   /note="corresponds to STY0060 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67786"
FT                   /db_xref="GOA:Q8Z9M9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9M9"
FT                   /protein_id="AAO67786.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGEYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFAYVP"
FT   gene            complement(61103..61789)
FT                   /gene="citB"
FT                   /locus_tag="t0054"
FT   CDS_pept        complement(61103..61789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="t0054"
FT                   /product="transcriptional regulatory protein CitB"
FT                   /note="corresponds to STY0061 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67787"
FT                   /db_xref="GOA:Q8Z9M8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9M8"
FT                   /protein_id="AAO67787.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKLFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   gene            complement(61791..63410)
FT                   /gene="citA"
FT                   /locus_tag="t0055"
FT   CDS_pept        complement(61791..63410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="t0055"
FT                   /product="sensor kinase CitA"
FT                   /note="corresponds to STY0062 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67788"
FT                   /db_xref="GOA:A0A0H2VJ80"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VJ80"
FT                   /protein_id="AAO67788.1"
FT                   /translation="MFIREITHWFARRSFQNRIFLLILFTSTIVMLAITWYLTDITKER
FT                   LHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSDATYITVGNEKGQR
FT                   LYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPIQDSTGKVIGIVSV
FT                   GYTLEQLESWLNLQISSLLFPMAILLLVLLYCARRFSLHIKKQMLNMEPQQLSQLLIQQ
FT                   SVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHIVLPEAFFYDAP
FT                   QKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLNLQLSQVRQYADNL
FT                   RAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISHNFRDHHLAGLLIG
FT                   KYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLNREGSRQIEC
FT                   LINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLWLVHSYVKQANGDI
FT                   IVDNNNSFGTIFTLYIPFTREE"
FT   gene            complement(63545..64846)
FT                   /gene="oadB"
FT                   /locus_tag="t0056"
FT   CDS_pept        complement(63545..64846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="t0056"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /note="corresponds to STY0063 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67789"
FT                   /db_xref="GOA:Q8Z9M6"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9M6"
FT                   /protein_id="AAO67789.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQNQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGLIAFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRALTSEKERKIRMVQLRTVSKREKILFPVVLLLLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQXL
FT                   GILLLGVIAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   AQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(64859..66634)
FT                   /gene="oadA"
FT                   /locus_tag="t0057"
FT   CDS_pept        complement(64859..66634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="t0057"
FT                   /product="oxaloacetate decarboxylase alpha chain"
FT                   /note="corresponds to STY0064 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67790"
FT                   /db_xref="GOA:Q8XGX8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XGX8"
FT                   /protein_id="AAO67790.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADRLDQVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLEGSAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPL
FT                   PQAEAAQPVAKAEKPAASGIYTVEVEGKAFVVRVSDGGDISQLTTAVPAASSAPVQAAA
FT                   PAGAGTPVTAPLAGNIWKVIATEGQSVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVK
FT                   SGDAVSVGDTLMTLA"
FT   gene            complement(66650..66889)
FT                   /gene="oadG"
FT                   /locus_tag="t0058"
FT   CDS_pept        complement(66650..66889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadG"
FT                   /locus_tag="t0058"
FT                   /product="oxaloacetate decarboxylase gamma chain"
FT                   /note="corresponds to STY0065 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67791"
FT                   /db_xref="GOA:Q8Z9M5"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9M5"
FT                   /protein_id="AAO67791.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFPE
FT                   PVAAPAPRAVPAVDDFTRLKPVIAAAIHHHRLNA"
FT   gene            complement(67048..68388)
FT                   /gene="citC"
FT                   /locus_tag="t0059"
FT   CDS_pept        complement(67048..68388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="t0059"
FT                   /product="citrate-sodium symporter"
FT                   /note="corresponds to STY0066 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67792"
FT                   /db_xref="GOA:P0A2F9"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="InterPro:IPR018025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2F9"
FT                   /protein_id="AAO67792.1"
FT                   /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYN
FT                   AIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEI
FT                   DAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIG
FT                   LCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIF
FT                   AIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLL
FT                   AYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVL
FT                   MVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCM
FT                   ANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   gene            68633..69676
FT                   /gene="citC"
FT                   /locus_tag="t0060"
FT   CDS_pept        68633..69676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="t0060"
FT                   /product="[citrate (PRO-3S)-lyase] ligase"
FT                   /note="corresponds to STY0067 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67793"
FT                   /db_xref="GOA:Q8Z9M4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9M4"
FT                   /protein_id="AAO67793.1"
FT                   /translation="MQNRVNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCA
FT                   YWQGEIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQN
FT                   RLLFSGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLG
FT                   HRYLVEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRA
FT                   TFPGYFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHDI
FT                   LHDPKRSGPVIEVVELARVEKNGTAISASRVRKLYSERNWPAISALVPAGTLAYLQRHA
FT                   ARHTETI"
FT   gene            69706..69999
FT                   /gene="citD"
FT                   /locus_tag="t0061"
FT   CDS_pept        69706..69999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="t0061"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /note="corresponds to STY0068 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67794"
FT                   /db_xref="GOA:Q8XFF4"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFF4"
FT                   /protein_id="AAO67794.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            69996..70865
FT                   /gene="citE"
FT                   /locus_tag="t0062"
FT   CDS_pept        69996..70865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="t0062"
FT                   /product="citrate lyase beta chain"
FT                   /note="corresponds to STY0069 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67795"
FT                   /db_xref="GOA:Q8Z9M3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9M3"
FT                   /protein_id="AAO67795.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAHEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            70876..72396
FT                   /gene="citF"
FT                   /locus_tag="t0063"
FT   CDS_pept        70876..72396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="t0063"
FT                   /product="citrate lyase alpha chain"
FT                   /note="corresponds to STY0070 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67796"
FT                   /db_xref="GOA:Q8Z9M2"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9M2"
FT                   /protein_id="AAO67796.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTVNSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPGSKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLCGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTLGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            72396..72947
FT                   /gene="citX"
FT                   /locus_tag="t0064"
FT   CDS_pept        72396..72947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="t0064"
FT                   /product="citx protein"
FT                   /note="corresponds to STY0071 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67797"
FT                   /db_xref="GOA:Q8Z9M1"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9M1"
FT                   /protein_id="AAO67797.1"
FT                   /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            72925..73833
FT                   /gene="citG"
FT                   /locus_tag="t0065"
FT   CDS_pept        72925..73833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="t0065"
FT                   /product="CitG protein"
FT                   /note="corresponds to STY0072 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67798"
FT                   /db_xref="GOA:Q8Z9M0"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9M0"
FT                   /protein_id="AAO67798.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSARKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQFLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
FT   gene            74013..74834
FT                   /gene="dapB"
FT                   /locus_tag="t0066"
FT   CDS_pept        74013..74834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="t0066"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="corresponds to STY0073 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67799"
FT                   /db_xref="GOA:Q8Z9L9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L9"
FT                   /protein_id="AAO67799.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            75687..76835
FT                   /gene="carA"
FT                   /locus_tag="t0067"
FT   CDS_pept        75687..76835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="t0067"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /note="corresponds to STY0076 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67800"
FT                   /db_xref="GOA:Q8Z9L8"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L8"
FT                   /protein_id="AAO67800.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAIEAIKKFLQTDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKHYRSSAK"
FT   gene            76851..80078
FT                   /gene="carB"
FT                   /locus_tag="t0068"
FT   CDS_pept        76851..80078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="t0068"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /note="corresponds to STY0077 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67801"
FT                   /db_xref="GOA:Q8Z9L7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L7"
FT                   /protein_id="AAO67801.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVTEVGITGLNADFLRQLKRKGFADARLAKLAGVREGEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   gene            80352..80747
FT                   /gene="caiF"
FT                   /locus_tag="t0069"
FT   CDS_pept        80352..80747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="t0069"
FT                   /product="transcriptional activator CaiF"
FT                   /note="corresponds to STY0078 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67802"
FT                   /db_xref="GOA:Q8XFZ2"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFZ2"
FT                   /protein_id="AAO67802.1"
FT                   /translation="MCEKYVERPLYLLIADWMMAENRWITAREISRQFDIEHCKAINTL
FT                   SYILSEVGEIVCEVKMIPNQIAGRGCQCQRLVKVVSIDSQLYRRLNHNLQERKVSVAKA
FT                   PRLSAVPPTELNREQKWQMMLSKSMRR"
FT   gene            complement(80825..81421)
FT                   /gene="caiE"
FT                   /locus_tag="t0070"
FT   CDS_pept        complement(80825..81421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="t0070"
FT                   /product="carnitine operon protein CaiE"
FT                   /note="corresponds to STY0079 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67803"
FT                   /db_xref="GOA:Q8Z9L6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L6"
FT                   /protein_id="AAO67803.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQDLA
FT                   IRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
FT   gene            complement(81533..82318)
FT                   /gene="caiD"
FT                   /locus_tag="t0071"
FT   CDS_pept        complement(81533..82318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="t0071"
FT                   /product="carnitine racemase"
FT                   /note="corresponds to STY0080 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67804"
FT                   /db_xref="GOA:Q8Z9L5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L5"
FT                   /protein_id="AAO67804.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGIVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRAPVWKGR"
FT   gene            complement(82372..83925)
FT                   /gene="caiC"
FT                   /locus_tag="t0072"
FT   CDS_pept        complement(82372..83925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="t0072"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /note="corresponds to STY0081 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67805"
FT                   /db_xref="GOA:Q8Z9L4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L4"
FT                   /protein_id="AAO67805.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGMYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYYLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQSAT
FT                   LCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPA
FT                   TPTDRQHHLREVMFYLNLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   gene            complement(83988..85205)
FT                   /gene="caiB"
FT                   /locus_tag="t0073"
FT   CDS_pept        complement(83988..85205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="t0073"
FT                   /product="L-carnitine dehydratase"
FT                   /note="corresponds to STY0082 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67806"
FT                   /db_xref="GOA:Q8Z9L3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L3"
FT                   /protein_id="AAO67806.1"
FT                   /translation="MNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEIC
FT                   PRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPEGTQLI
FT                   HRVECPYGPLVEEKLDAWLAAHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADIKELVGKG
FT                   LAKVED"
FT   gene            complement(85317..86459)
FT                   /gene="caiA"
FT                   /locus_tag="t0074"
FT   CDS_pept        complement(85317..86459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="t0074"
FT                   /product="probable carnitine operon oxidoreductase CaiA"
FT                   /note="corresponds to STY0083 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67807"
FT                   /db_xref="GOA:Q8Z9L2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L2"
FT                   /protein_id="AAO67807.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCTFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(86494..88011)
FT                   /gene="caiT"
FT                   /locus_tag="t0075"
FT   CDS_pept        complement(86494..88011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="t0075"
FT                   /product="probable carnitine transporter"
FT                   /note="corresponds to STY0084 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67808"
FT                   /db_xref="GOA:Q8Z9L1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L1"
FT                   /protein_id="AAO67808.1"
FT                   /translation="MKNEKRKSGIEPKVFFPLLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFSWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFSTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   gene            88492..89262
FT                   /gene="fixA"
FT                   /locus_tag="t0076"
FT   CDS_pept        88492..89262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="t0076"
FT                   /product="FixA protein"
FT                   /note="corresponds to STY0085 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67809"
FT                   /db_xref="GOA:Q8Z9L0"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9L0"
FT                   /protein_id="AAO67809.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTATAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPAYSTQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            89278..90219
FT                   /gene="fixB"
FT                   /locus_tag="t0077"
FT   CDS_pept        89278..90219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="t0077"
FT                   /product="FixB protein"
FT                   /note="corresponds to STY0086 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67810"
FT                   /db_xref="GOA:P64096"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64096"
FT                   /protein_id="AAO67810.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASDVSLQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDASRSG
FT                   EMHTVQWQAPATAVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            90269..91555
FT                   /gene="fixC"
FT                   /locus_tag="t0078"
FT   CDS_pept        90269..91555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="t0078"
FT                   /product="FixC protein"
FT                   /note="corresponds to STY0087 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67811"
FT                   /db_xref="GOA:Q8Z9K9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9K9"
FT                   /protein_id="AAO67811.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVSIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            91552..91839
FT                   /gene="fixX"
FT                   /locus_tag="t0079"
FT   CDS_pept        91552..91839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="t0079"
FT                   /product="ferredoxin like protein FixX"
FT                   /note="corresponds to STY0088 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67812"
FT                   /db_xref="GOA:Q8Z9K8"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9K8"
FT                   /protein_id="AAO67812.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            91987..93327
FT                   /gene="yaaU"
FT                   /locus_tag="t0080"
FT   CDS_pept        91987..93327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="t0080"
FT                   /product="putative metabolite transport protein"
FT                   /note="corresponds to STY0089 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67813"
FT                   /db_xref="GOA:Q83T87"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T87"
FT                   /protein_id="AAO67813.1"
FT                   /translation="MPQPRNFDDLKFSSIHRRIMLWGSGGPFLDGYVLVIIGVALEQLT
FT                   PLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKVGRRKMFLLDIIAIGVISVATMFVS
FT                   TPLELLVMRVLIGIVIGADYPIATSMITEFSNTRQRAFSIGFIAAMWYVGATCANLVGY
FT                   WLYDMEGGWRWMLGSAFIPCLIILIGRFDLPESPRWLLRKGRVKECEQMMIKLFGEPVC
FT                   FDDEPPQETRFLQLFNRRHFPFVLFVAAIWSCQVIPMFAIYTFGPQIVGLLGWEQGRNA
FT                   ALGNVVISLFFMLGCIPAMFWLNSIGRRPLLIGSFAMMTIALALLGLVSNLGIILVVVA
FT                   FAVYAFFSGGPGILQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFITRYGI
FT                   NNVMLIGALISLVGLGVSVMFAPETRGLTLTQTGNMTLRGTPSDNPR"
FT   gene            93416..93646
FT                   /locus_tag="t0081"
FT   CDS_pept        93416..93646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0081"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY0091 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67814"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGK8"
FT                   /protein_id="AAO67814.1"
FT                   /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            93931..94353
FT                   /locus_tag="t0082"
FT   CDS_pept        93931..94353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0082"
FT                   /product="probable secreted protein"
FT                   /note="corresponds to STY0093 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67815"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9K6"
FT                   /protein_id="AAO67815.1"
FT                   /translation="MKLKLIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMT
FT                   ILPPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGT
FT                   YNRQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(94577..94867)
FT                   /locus_tag="t0083"
FT   CDS_pept        complement(94577..94867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0083"
FT                   /product="probable secreted protein"
FT                   /note="corresponds to STY0095 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67816"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFA8"
FT                   /protein_id="AAO67816.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   gene            95077..95271
FT                   /locus_tag="t0084"
FT   CDS_pept        95077..95271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0084"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0096 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67817"
FT                   /db_xref="GOA:Q8Z9K5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9K5"
FT                   /protein_id="AAO67817.1"
FT                   /translation="MLLVTHSLAAFKQLELFWVITSVDYLKIALFGVTVLYLVIVTSLC
FT                   CCQCKIMRCQLKRNLTPCK"
FT   gene            95765..95989
FT                   /locus_tag="t0085"
FT   CDS_pept        95765..95989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0085"
FT                   /product="probable secreted protein"
FT                   /note="corresponds to STY0097 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67818"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9K4"
FT                   /protein_id="AAO67818.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPTWDKPFTGEIPEKLPEGYNILLVVTD"
FT   gene            96041..97345
FT                   /locus_tag="t0086"
FT   CDS_pept        96041..97345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0086"
FT                   /product="puatative sulfatase"
FT                   /note="corresponds to STY0098 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67819"
FT                   /db_xref="GOA:Q8Z9K3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9K3"
FT                   /protein_id="AAO67819.1"
FT                   /translation="MKTGVTFCNHQNTSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMP
FT                   YDLDPALGTTGHMMRELGYYTAYKGKWHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIM
FT                   EKYGFADYHGIGDIIGHSKGGYFYDSTTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNP
FT                   HDVMFIDTDKEGEKVQWRGELDQDDNTLAPTQPPENELYQASWPNYPLPANRHQSFNEQ
FT                   GRPPAHLEYQTARAALEGQFPDEDRRWRKLLDYYFNCIRDCDTHLDRILNELDALKLTD
FT                   KTIVVFTADHGELGGSHQMHGKGASVYKEQIHVPMIISHPAYPGNKKCQALTCHLDIAP
FT                   TLVGLTGLPEEKQHQALGNRKGVNFSGLLKNPESVAVNAVRNASLYCYGMILYTDAHYL
FT                   HRVIALQRDKQKRWRKSSRKYRICILISAIVQGRG"
FT   gene            97342..97653
FT                   /locus_tag="t0087"
FT   CDS_pept        97342..97653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0087"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0099 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67820"
FT                   /db_xref="GOA:Q8Z9K2"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9K2"
FT                   /protein_id="AAO67820.1"
FT                   /translation="MINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDEN
FT                   HNLAADKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAREPWDLTIEQFNRMAKD"
FT   gene            98060..98590
FT                   /gene="yabF"
FT                   /locus_tag="t0088"
FT   CDS_pept        98060..98590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="t0088"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /note="corresponds to STY0100 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67821"
FT                   /db_xref="GOA:Q8Z9K1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9K1"
FT                   /protein_id="AAO67821.1"
FT                   /translation="MILIIYAHPYPHHSHANKQMLEQAGTLENVEIRSLYHLYPDFNID
FT                   VAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGENHFAIGSHPGFAVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQARQY
FT                   KQRLLAWQEVNHG"
FT   gene            98583..100445
FT                   /gene="kefC"
FT                   /locus_tag="t0089"
FT   CDS_pept        98583..100445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="t0089"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="corresponds to STY0101 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67822"
FT                   /db_xref="GOA:Q8Z9K0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9K0"
FT                   /protein_id="AAO67822.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARTLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKTHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFCHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGKAADEPEVKPSI"
FT   gene            100644..101123
FT                   /gene="folA"
FT                   /locus_tag="t0090"
FT   CDS_pept        100644..101123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="t0090"
FT                   /product="dihydrofolate reductase type I"
FT                   /note="corresponds to STY0102 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67823"
FT                   /db_xref="GOA:Q8Z9J9"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9J9"
FT                   /protein_id="AAO67823.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIIISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(101219..102067)
FT                   /gene="apaH"
FT                   /locus_tag="t0091"
FT   CDS_pept        complement(101219..102067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="t0091"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /note="corresponds to STY0103 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67824"
FT                   /db_xref="GOA:P0A1B2"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1B2"
FT                   /protein_id="AAO67824.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(102078..102455)
FT                   /gene="apaG"
FT                   /locus_tag="t0092"
FT   CDS_pept        complement(102078..102455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="t0092"
FT                   /product="CorD protein"
FT                   /note="corresponds to STY0104 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67825"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9J8"
FT                   /protein_id="AAO67825.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGKGVVGVQPRIAPGEEYQYTGGAVIETPLGTMQGHYEMIDE
FT                   NGDAFTIDIPVFRLAVPTLIH"
FT   gene            complement(102458..103279)
FT                   /gene="ksgA"
FT                   /locus_tag="t0093"
FT   CDS_pept        complement(102458..103279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="t0093"
FT                   /product="dimethyladenosine transferase"
FT                   /note="corresponds to STY0105 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67826"
FT                   /db_xref="GOA:Q8Z9J7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9J7"
FT                   /protein_id="AAO67826.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   gene            complement(103276..104265)
FT                   /gene="pdxA"
FT                   /locus_tag="t0094"
FT   CDS_pept        complement(103276..104265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="t0094"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /note="corresponds to STY0106 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67827"
FT                   /db_xref="GOA:P58715"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58715"
FT                   /protein_id="AAO67827.1"
FT                   /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAIPGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(104265..105551)
FT                   /gene="surA"
FT                   /locus_tag="t0095"
FT   CDS_pept        complement(104265..105551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="t0095"
FT                   /product="survival protein SurA precursor"
FT                   /note="corresponds to STY0107 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67828"
FT                   /db_xref="GOA:Q8XEV3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEV3"
FT                   /protein_id="AAO67828.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(105605..107959)
FT                   /gene="imp"
FT                   /locus_tag="t0096"
FT   CDS_pept        complement(105605..107959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="t0096"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /note="corresponds to STY0108 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67829"
FT                   /db_xref="GOA:Q8Z9J6"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9J6"
FT                   /protein_id="AAO67829.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGAGLMELDYLPSDKVYEDEHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTISLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDWYNANNSKKLEDSVNRVMPQFKVDGKLVFERDMAMLAPGYTQTLEPRVQYLYV
FT                   PYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVERFN
FT                   VSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLDSV
FT                   ATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWPIA
FT                   DRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
FT   gene            108213..109025
FT                   /gene="djlA"
FT                   /locus_tag="t0097"
FT   CDS_pept        108213..109025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="t0097"
FT                   /product="DnaJ-like protein"
FT                   /note="corresponds to STY0109 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67830"
FT                   /db_xref="GOA:Q8XEM4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEM4"
FT                   /protein_id="AAO67830.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(109120..109779)
FT                   /gene="rluA"
FT                   /locus_tag="t0098"
FT   CDS_pept        complement(109120..109779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="t0098"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /note="corresponds to STY0110 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67831"
FT                   /db_xref="GOA:Q8Z9J5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9J5"
FT                   /protein_id="AAO67831.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDQFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPADF"
FT   gene            complement(109791..112697)
FT                   /gene="hepA"
FT                   /locus_tag="t0099"
FT   CDS_pept        complement(109791..112697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="t0099"
FT                   /product="probable ATP-dependent helicase HepA"
FT                   /note="corresponds to STY0111 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67832"
FT                   /db_xref="GOA:Q8Z9J4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9J4"
FT                   /protein_id="AAO67832.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEINSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEQSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
FT   gene            complement(112871..115222)
FT                   /gene="polB"
FT                   /locus_tag="t0100"
FT   CDS_pept        complement(112871..115222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="t0100"
FT                   /product="DNA polymerase II"
FT                   /note="corresponds to STY0112 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67833"
FT                   /db_xref="GOA:Q8Z9J3"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9J3"
FT                   /protein_id="AAO67833.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQATLAPQESVAFI
FT                   PTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVY
FT                   EADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHPDYRPPLKWVSLDIETTRHG
FT                   ELYCIGLEGCGQRTVYMLGPANGDERQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIG
FT                   WNVVQFDLRMLQKYAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDAL
FT                   KSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVT
FT                   RIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYIAPNLGEVPPLAS
FT                   PGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVSQIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEW
FT                   WAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEGDSQRMVFKGLE
FT                   TVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHE
FT                   YQRNVPSHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYL
FT                   TRQLQPVAEGILPFVEDNFATLLTGQLGLF"
FT   gene            complement(115269..117704)
FT                   /pseudo
FT                   /locus_tag="t0103"
FT                   /note="corresponds to STY0113 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(115562..116002)
FT                   /locus_tag="t0101"
FT   CDS_pept        complement(115562..116002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0101"
FT                   /product="putative IS element transposase"
FT                   /note="corresponds to STY0114 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67834"
FT                   /db_xref="GOA:A0A0H2VKP0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VKP0"
FT                   /protein_id="AAO67834.1"
FT                   /translation="MFATLLFLRSTSIQKHKINRSRHAAFLLHVHLVFITKYRRKILGE
FT                   SHYAAFHQYAAEVCRDFGGELKESNGDVDHVHMLIEYPPTVQLSVLVNSLKAVTSRRLR
FT                   NEFIDLRGAYGKAVLWSRSYFAGSCGGAPLEVVKQYIQHQRG"
FT   gene            116022..117230
FT                   /locus_tag="t0102"
FT   CDS_pept        116022..117230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0102"
FT                   /product="putative IS element transposase"
FT                   /note="corresponds to STY0115 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67835"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9J1"
FT                   /protein_id="AAO67835.1"
FT                   /translation="MMLILKAYKFRLEPTPEQSQRLRQLCGCARFVWNLGLAETKRILG
FT                   SGEKLPSAFELNRMLTVWKKMPGHIFLQDAYTDNLQQKLKDLHTAWKRCFDKKLAAKAP
FT                   VWKRKNEGRDSIRFVNFEKYCRLENRRVKLPSGLGWVKFRQSQRVNGKIKNATISQLAG
FT                   QWYISFQVEVETAEPNHTSTTIVGLDAGVTKLATLSDGTVYQPVNSFKASQRKLATLQR
FT                   QLSRKVRFSSNWQKQKRKVQHLHSHIANIRRDYLHKVTSEISKNHAMIVIEDLKVSNMS
FT                   KSAKGTAEQHGRNVKAKSGLNRSILDQGWYEMRRQLEYKQLWRGGQVLAVPPAYTSQRC
FT                   ACCGHTAKENRLSQSKFVCQACGYTANADVNGARNILAAGHAVLACGGMVQSGRPSETG
FT                   TRR"
FT   gene            118222..118641
FT                   /locus_tag="t0104"
FT   CDS_pept        118222..118641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0104"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY0117 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67836"
FT                   /db_xref="InterPro:IPR031855"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9J0"
FT                   /protein_id="AAO67836.1"
FT                   /translation="MNVSMQARLVGSDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKDGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
FT   gene            complement(118647..119342)
FT                   /gene="araD"
FT                   /locus_tag="t0105"
FT   CDS_pept        complement(118647..119342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="t0105"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="corresponds to STY0118 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67837"
FT                   /db_xref="GOA:Q8Z9I9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9I9"
FT                   /protein_id="AAO67837.1"
FT                   /translation="MLEDLKHQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPSG
FT                   VDYSVMTADDMVVVSLETGEVVEGHKKPSSDTPTHRLLYQAFPTIGSIVHTHSRHATIW
FT                   AQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVEAFEKQGINAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(119483..120985)
FT                   /gene="araA"
FT                   /locus_tag="t0106"
FT   CDS_pept        complement(119483..120985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="t0106"
FT                   /product="L-arabinose isomerase"
FT                   /note="corresponds to STY0119 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67838"
FT                   /db_xref="GOA:P58539"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58539"
FT                   /protein_id="AAO67838.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAW
FT                   MRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIG
FT                   DGDISALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTDHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR"
FT   gene            complement(120996..122705)
FT                   /gene="araB"
FT                   /locus_tag="t0107"
FT   CDS_pept        complement(120996..122705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="t0107"
FT                   /product="L-ribulokinase"
FT                   /note="corresponds to STY0120 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67839"
FT                   /db_xref="GOA:P58542"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58542"
FT                   /protein_id="AAO67839.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSVEWYLRWQEGRYCDG
FT                   PNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPASF
FT                   FDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGD
FT                   IYAWFSRVLSWPLEQLAAQHPELKTQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTEQGIAVNNVMAL
FT                   GGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPAAQQSMASA
FT                   VERTLRPRPEQAQRFERLYRRYQQWALSAEQHYLPTAAPAPTTPANQAILTH"
FT   gene            123046..123891
FT                   /gene="araC"
FT                   /locus_tag="t0108"
FT   CDS_pept        123046..123891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="t0108"
FT                   /product="arabinose operon regulatory protein"
FT                   /note="corresponds to STY0121 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67840"
FT                   /db_xref="GOA:Q8Z9I8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9I8"
FT                   /protein_id="AAO67840.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASGWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRARCE
FT                   "
FT   gene            124010..124777
FT                   /gene="yabI"
FT                   /locus_tag="t0109"
FT   CDS_pept        124010..124777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="t0109"
FT                   /product="DedA-family integral membrane protein"
FT                   /note="corresponds to STY0122 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67841"
FT                   /db_xref="GOA:Q8Z9I7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9I7"
FT                   /protein_id="AAO67841.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHTWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYLPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(124816..125523)
FT                   /gene="yabJ"
FT                   /locus_tag="t0110"
FT   CDS_pept        complement(124816..125523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="t0110"
FT                   /product="hypothetical ABC transporter"
FT                   /note="corresponds to STY0123 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67842"
FT                   /db_xref="GOA:Q8Z9I6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I6"
FT                   /protein_id="AAO67842.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGEDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIARQMGIESLMARLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(125507..127117)
FT                   /gene="yabK"
FT                   /locus_tag="t0111"
FT   CDS_pept        complement(125507..127117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="t0111"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="corresponds to STY0124 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67843"
FT                   /db_xref="GOA:Q8Z9I5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9I5"
FT                   /protein_id="AAO67843.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   LWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELHQRQQLFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   gene            complement(127093..128076)
FT                   /gene="tbpA"
FT                   /locus_tag="t0112"
FT   CDS_pept        complement(127093..128076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="t0112"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /note="corresponds to STY0125 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67844"
FT                   /db_xref="GOA:Q8XGL6"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGL6"
FT                   /protein_id="AAO67844.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   gene            complement(128254..129912)
FT                   /gene="yabN"
FT                   /locus_tag="t0113"
FT   CDS_pept        complement(128254..129912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="t0113"
FT                   /product="putative ABC transporter periplasmic solute
FT                   binding protein"
FT                   /note="corresponds to STY0127 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67845"
FT                   /db_xref="GOA:Q8Z9I4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I4"
FT                   /protein_id="AAO67845.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVIASLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQDDAAQWRAGEMNLANWCQQLLANKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            complement(130462..131067)
FT                   /gene="leuD"
FT                   /locus_tag="t0114"
FT   CDS_pept        complement(130462..131067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="t0114"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /note="corresponds to STY0129 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67846"
FT                   /db_xref="GOA:Q8Z9I3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I3"
FT                   /protein_id="AAO67846.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDEQVDELFTLVKANPGIKFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAEYENKQPAFMR"
FT   gene            complement(131078..132478)
FT                   /gene="leuC"
FT                   /locus_tag="t0115"
FT   CDS_pept        complement(131078..132478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="t0115"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /note="corresponds to STY0130 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67847"
FT                   /db_xref="GOA:Q8Z9I2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I2"
FT                   /protein_id="AAO67847.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVTLRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(132481..133572)
FT                   /gene="leuB"
FT                   /locus_tag="t0116"
FT   CDS_pept        complement(132481..133572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="t0116"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="corresponds to STY0131 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67848"
FT                   /db_xref="GOA:Q8Z9I1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I1"
FT                   /protein_id="AAO67848.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSRYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKAYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQEFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADEAATAIEQAINRALEEGVRTSDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(133572..135143)
FT                   /gene="leuA"
FT                   /locus_tag="t0117"
FT   CDS_pept        complement(133572..135143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="t0117"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="corresponds to STY0132 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67849"
FT                   /db_xref="GOA:Q8Z9I0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9I0"
FT                   /protein_id="AAO67849.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIINVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMGHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   gene            complement(135231..135317)
FT                   /gene="leuL"
FT                   /locus_tag="t0118"
FT   CDS_pept        complement(135231..135317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="t0118"
FT                   /product="leu operon leader peptide"
FT                   /note="corresponds to STY0133 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67850"
FT                   /db_xref="GOA:Q8Z9H9"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H9"
FT                   /protein_id="AAO67850.1"
FT                   /translation="MSYIVRFTGLLLLNAFIVRGRPVGGIQH"
FT   gene            135975..136919
FT                   /gene="leuO"
FT                   /locus_tag="t0119"
FT   CDS_pept        135975..136919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="t0119"
FT                   /product="probable activator protein in leuABCD operon"
FT                   /note="corresponds to STY0134 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67851"
FT                   /db_xref="GOA:Q83T85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T85"
FT                   /protein_id="AAO67851.1"
FT                   /translation="MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAHT
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQETE
FT                   FVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDRYASF
FT                   SRPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPRWLAEEFAESLELQILPLPLK
FT                   LNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR"
FT   gene            137241..138965
FT                   /gene="ilvI"
FT                   /locus_tag="t0120"
FT   CDS_pept        137241..138965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="t0120"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /note="corresponds to STY0135 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67852"
FT                   /db_xref="GOA:Q8Z9H7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9H7"
FT                   /protein_id="AAO67852.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKMPYVWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAISAAC
FT                   YAPLRHIIETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQMLELLAQDAP
FT                   SQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGLQ
FT                   INRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            138965..139459
FT                   /gene="ilvH"
FT                   /locus_tag="t0121"
FT   CDS_pept        138965..139459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="t0121"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /note="corresponds to STY0136 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67853"
FT                   /db_xref="GOA:Q8Z9H6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9H6"
FT                   /protein_id="AAO67853.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKVM
FT                   R"
FT   gene            139743..140747
FT                   /gene="fruR"
FT                   /locus_tag="t0122"
FT   CDS_pept        139743..140747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="t0122"
FT                   /product="fructose repressor"
FT                   /note="corresponds to STY0138 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67854"
FT                   /db_xref="GOA:P0A2P9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2P9"
FT                   /protein_id="AAO67854.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            141353..141811
FT                   /gene="yabB"
FT                   /locus_tag="t0123"
FT   CDS_pept        141353..141811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="t0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0139 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67855"
FT                   /db_xref="GOA:Q8Z9H5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H5"
FT                   /protein_id="AAO67855.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQIVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            141813..142754
FT                   /gene="yabC"
FT                   /locus_tag="t0124"
FT   CDS_pept        141813..142754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="t0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0140 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67856"
FT                   /db_xref="GOA:Q8Z9H4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H4"
FT                   /protein_id="AAO67856.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IAHAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLASGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            142751..143116
FT                   /gene="ftsL"
FT                   /locus_tag="t0125"
FT   CDS_pept        142751..143116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="t0125"
FT                   /product="cell division protein FtsL"
FT                   /note="corresponds to STY0141 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67857"
FT                   /db_xref="GOA:Q8XEN0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEN0"
FT                   /protein_id="AAO67857.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            143132..144898
FT                   /gene="ftsI"
FT                   /locus_tag="t0126"
FT   CDS_pept        143132..144898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="t0126"
FT                   /product="penicillin-binding protein 3 precursor"
FT                   /note="corresponds to STY0142 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67858"
FT                   /db_xref="GOA:Q8XGV8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGV8"
FT                   /protein_id="AAO67858.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            144885..146372
FT                   /gene="murE"
FT                   /locus_tag="t0127"
FT   CDS_pept        144885..146372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="t0127"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopim ligase"
FT                   /note="corresponds to STY0143 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67859"
FT                   /db_xref="GOA:Q8Z9H3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H3"
FT                   /protein_id="AAO67859.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGVTIRFASSWGEGEIESCLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
FT   gene            146369..147727
FT                   /gene="murF"
FT                   /locus_tag="t0128"
FT   CDS_pept        146369..147727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="t0128"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diami
FT                   nopimelate--D-alan alanyl ligase"
FT                   /note="corresponds to STY0144 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67860"
FT                   /db_xref="GOA:Q8Z9H2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9H2"
FT                   /protein_id="AAO67860.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTASNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLAAVKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLSTGKLSQVISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            147721..148803
FT                   /gene="mraY"
FT                   /locus_tag="t0129"
FT   CDS_pept        147721..148803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="t0129"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="corresponds to STY0145 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67861"
FT                   /db_xref="GOA:Q8Z9H1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H1"
FT                   /protein_id="AAO67861.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            148806..150122
FT                   /gene="murD"
FT                   /locus_tag="t0130"
FT   CDS_pept        148806..150122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="t0130"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine:D-glutamate
FT                   ligase"
FT                   /note="corresponds to STY0146 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67862"
FT                   /db_xref="GOA:Q8Z9H0"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9H0"
FT                   /protein_id="AAO67862.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLA
FT                   PHVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            150122..151366
FT                   /gene="ftsW"
FT                   /locus_tag="t0131"
FT   CDS_pept        150122..151366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="t0131"
FT                   /product="cell division protein FtsW"
FT                   /note="corresponds to STY0147 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67863"
FT                   /db_xref="GOA:Q8XGF1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGF1"
FT                   /protein_id="AAO67863.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   gene            151363..152430
FT                   /gene="murG"
FT                   /locus_tag="t0132"
FT   CDS_pept        151363..152430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="t0132"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)-pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /note="corresponds to STY0148 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67864"
FT                   /db_xref="GOA:Q8Z9G9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G9"
FT                   /protein_id="AAO67864.1"
FT                   /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTSDRM
FT                   EADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGA
FT                   QLTVEQAYAGAGQPQHKVTEFIDGMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPD
FT                   ATERVASEVSRVART"
FT   gene            152549..154024
FT                   /gene="murC"
FT                   /locus_tag="t0133"
FT   CDS_pept        152549..154024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="t0133"
FT                   /product="UDP-N-acetylmuramate:alanine ligase"
FT                   /note="corresponds to STY0149 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67865"
FT                   /db_xref="GOA:Q8Z9G8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G8"
FT                   /protein_id="AAO67865.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIDDDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            154017..154937
FT                   /gene="ddlB"
FT                   /locus_tag="t0134"
FT   CDS_pept        154017..154937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="t0134"
FT                   /product="D-alanine:D-alanine ligase B"
FT                   /note="corresponds to STY0150 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67866"
FT                   /db_xref="GOA:Q8Z9G7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G7"
FT                   /protein_id="AAO67866.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEV
FT                   DVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            154939..155769
FT                   /gene="ftsQ"
FT                   /locus_tag="t0135"
FT   CDS_pept        154939..155769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="t0135"
FT                   /product="cell division protein FtsQ"
FT                   /note="corresponds to STY0151 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67867"
FT                   /db_xref="GOA:Q8XEL1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEL1"
FT                   /protein_id="AAO67867.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            155766..157028
FT                   /gene="ftsA"
FT                   /locus_tag="t0136"
FT   CDS_pept        155766..157028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="t0136"
FT                   /product="cell division protein FtsA"
FT                   /note="corresponds to STY0152 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67868"
FT                   /db_xref="GOA:Q8XFM6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFM6"
FT                   /protein_id="AAO67868.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            157089..158240
FT                   /gene="ftsZ"
FT                   /locus_tag="t0137"
FT   CDS_pept        157089..158240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="t0137"
FT                   /product="cell division protein FtsZ"
FT                   /note="corresponds to STY0153 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67869"
FT                   /db_xref="GOA:Q8Z9G6"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9G6"
FT                   /protein_id="AAO67869.1"
FT                   /translation="MFEPMELTNDAVITVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNAPQAAKEPDYLDIPAFLRKQAD"
FT   gene            158341..159258
FT                   /gene="lpxC"
FT                   /locus_tag="t0138"
FT   CDS_pept        158341..159258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="t0138"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="corresponds to STY0154 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67870"
FT                   /db_xref="GOA:Q8Z9G5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G5"
FT                   /protein_id="AAO67870.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDALNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            159608..160036
FT                   /gene="yacA"
FT                   /locus_tag="t0139"
FT   CDS_pept        159608..160036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="t0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0155 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67871"
FT                   /db_xref="GOA:Q8Z9G4"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G4"
FT                   /protein_id="AAO67871.1"
FT                   /translation="MVAASFGLPALSNAAETNTPARTTASTASKVNFSHLALLEASNRR
FT                   PNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADAPSPLQAHHIALLNTLSAMLTQEGTP
FT                   PAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAGPQRLS"
FT   gene            160098..162803
FT                   /gene="secA"
FT                   /locus_tag="t0140"
FT   CDS_pept        160098..162803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="t0140"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="corresponds to STY0156 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67872"
FT                   /db_xref="GOA:Q8Z9G3"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9G3"
FT                   /protein_id="AAO67872.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIGKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYITEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            162959..163354
FT                   /gene="mutT"
FT                   /locus_tag="t0141"
FT   CDS_pept        162959..163354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="t0141"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="corresponds to STY0157 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67873"
FT                   /db_xref="GOA:Q8Z9G2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9G2"
FT                   /protein_id="AAO67873.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITRRAADAHMANKLEFPGGKIEAGET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRW
FT                   IAQNALNTDDFPPANEPIIRKLRQFAP"
FT   gene            complement(163388..164377)
FT                   /locus_tag="t0142"
FT   CDS_pept        complement(163388..164377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0142"
FT                   /product="putative aldo/keto reductase"
FT                   /note="corresponds to STY0158 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67874"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9G1"
FT                   /protein_id="AAO67874.1"
FT                   /translation="MQYRTLGANGPRVSAIGLGCMGMSAFYGAHDDSTSIKTLHYALDQ
FT                   GVTLLDTADMYGPYTNERLVGRAIADRRDRVFLATKFGIVLDPANPMARGVNGRPEYVR
FT                   RSCEQSLQRLGVDHIDLYYQHRVDPSVPIEETVGAMADLVREGKVRYLGLSEASTQTLE
FT                   RAHNVHPITALQSEYSLWSREAEISALSTCERLGIGFVAYSPLGRGFLTGTIKTPEDFA
FT                   ANDFRRTNPRFMGENFSRNLRLAEAIKQMAREKECTPAQLALAWLLARNRHLVPIPGTR
FT                   HCARVDENLGALSLTLSPQELAAIEAVFPHDAAAGPRYWPEIMSTLNR"
FT   gene            164463..165404
FT                   /locus_tag="t0143"
FT   CDS_pept        164463..165404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0143"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="corresponds to STY0159 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67875"
FT                   /db_xref="GOA:Q8Z9G0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9G0"
FT                   /protein_id="AAO67875.1"
FT                   /translation="MKAGLIMRHDVMSVLHAFCMIAENHSFTRAAAQLHISTSALSQNM
FT                   RQLEDELGVKLLNRTTRRVGLTEAGHAFLASIRPALNHIDEAMEHACQSRDIPGGTLRL
FT                   TVPRTAATLLLQPNLAGFMRDYPDIRLDIDVNDGFVDLINERFDAGIRFGDAVQLDMNV
FT                   VPLGDVLRPAIVASPAYLARFGTPLHPQELINHRCLCHRFTRESGLYRWEFVHGAQRLE
FT                   ITPEAALMVNDKALRLSAARDGAELTYVFEQDVHEDLQDGRLCSVLEEWLPAADRFYLY
FT                   YPGRAHMAPKLRVFIDYFCHKAILPSQQSYHR"
FT   gene            complement(165401..165592)
FT                   /gene="yacG"
FT                   /locus_tag="t0144"
FT   CDS_pept        complement(165401..165592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="t0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0160 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67876"
FT                   /db_xref="GOA:P67482"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67482"
FT                   /protein_id="AAO67876.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   gene            complement(165602..166345)
FT                   /gene="yacF"
FT                   /locus_tag="t0145"
FT   CDS_pept        complement(165602..166345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="t0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0161 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67877"
FT                   /db_xref="GOA:P67694"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67694"
FT                   /protein_id="AAO67877.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFFR
FT                   NISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLIS
FT                   APRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNP
FT                   LTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGLVPERLDFELACC"
FT   gene            complement(166345..166965)
FT                   /gene="yacE"
FT                   /locus_tag="t0146"
FT   CDS_pept        complement(166345..166965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /locus_tag="t0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0162 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67878"
FT                   /db_xref="GOA:P63829"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63829"
FT                   /protein_id="AAO67878.1"
FT                   /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQP
FT                   ALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQAT
FT                   SPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
FT   gene            167191..168234
FT                   /gene="guaC"
FT                   /locus_tag="t0147"
FT   CDS_pept        167191..168234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="t0147"
FT                   /product="GMP reductase"
FT                   /note="corresponds to STY0163 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67879"
FT                   /db_xref="GOA:Q8Z9F9"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9F9"
FT                   /protein_id="AAO67879.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYSVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPSKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(168265..169467)
FT                   /gene="hofC"
FT                   /locus_tag="t0148"
FT   CDS_pept        complement(168265..169467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="t0148"
FT                   /product="transport protein HofC"
FT                   /note="corresponds to STY0164 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67880"
FT                   /db_xref="GOA:Q8Z9F8"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F8"
FT                   /protein_id="AAO67880.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWVDNRLALIITLQHQRIMPLRI
FT                   KRISVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGPAWGWLILF
FT                   LTMLVAIAHRRLKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSESTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(169457..170842)
FT                   /gene="hofB"
FT                   /locus_tag="t0149"
FT   CDS_pept        complement(169457..170842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="t0149"
FT                   /product="transport protein HofB"
FT                   /note="corresponds to STY0165 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67881"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F7"
FT                   /protein_id="AAO67881.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSTNAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLTGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQIGVTRWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQANGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILRVLGMP
FT                   HER"
FT   gene            complement(170852..171289)
FT                   /gene="ppdD"
FT                   /locus_tag="t0150"
FT   CDS_pept        complement(170852..171289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="t0150"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /note="corresponds to STY0166 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67882"
FT                   /db_xref="GOA:Q9L4I6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q9L4I6"
FT                   /protein_id="AAO67882.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDAN"
FT   gene            complement(171511..172404)
FT                   /gene="nadC"
FT                   /locus_tag="t0151"
FT   CDS_pept        complement(171511..172404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="t0151"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /note="corresponds to STY0167 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67883"
FT                   /db_xref="GOA:Q8Z9F6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F6"
FT                   /protein_id="AAO67883.1"
FT                   /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGNDI
FT                   TAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQTV
FT                   FELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLRTAL
FT                   KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVENLDEL
FT                   DDALKAGADIIMLDNFNTDQMREAVKHVNGQARLEVSGNVTAETLREFAETGVDFISVG
FT                   ALTKHVRALDLSMRFC"
FT   gene            172492..173055
FT                   /gene="ampD"
FT                   /locus_tag="t0152"
FT   CDS_pept        172492..173055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="t0152"
FT                   /product="anhydro-N-acetylmuramyl-tripeptide amidase"
FT                   /note="corresponds to STY0168 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67884"
FT                   /db_xref="GOA:Q8Z9F5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F5"
FT                   /protein_id="AAO67884.1"
FT                   /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPDRKT
FT                   DPGPAFDWPRFRALVALSSHKEMT"
FT   gene            173052..173906
FT                   /gene="ampE"
FT                   /locus_tag="t0153"
FT   CDS_pept        173052..173906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="t0153"
FT                   /product="AmpE protein"
FT                   /note="corresponds to STY0169 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67885"
FT                   /db_xref="GOA:Q8Z9F4"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F4"
FT                   /protein_id="AAO67885.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKVRVHYHAWLKAASRNDPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLVREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(173998..174948)
FT                   /locus_tag="t0154"
FT   CDS_pept        complement(173998..174948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0154"
FT                   /product="putatuve glycosysl hydrolase"
FT                   /note="corresponds to STY0170 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67886"
FT                   /db_xref="GOA:Q8Z9F3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F3"
FT                   /protein_id="AAO67886.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRADSLE
FT                   GLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTPFDTFSLDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTLKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTSEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(174948..176354)
FT                   /locus_tag="t0155"
FT   CDS_pept        complement(174948..176354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0155"
FT                   /product="putative symporter"
FT                   /note="corresponds to STY0171 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67887"
FT                   /db_xref="GOA:Q83T84"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T84"
FT                   /protein_id="AAO67887.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGYNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVIYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGDGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVILGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LKAAESVRKA"
FT   gene            complement(176518..177888)
FT                   /gene="aroP"
FT                   /locus_tag="t0156"
FT   CDS_pept        complement(176518..177888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="t0156"
FT                   /product="aromatic amino acid transport protein"
FT                   /note="corresponds to STY0173 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67888"
FT                   /db_xref="GOA:P0A188"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A188"
FT                   /protein_id="AAO67888.1"
FT                   /translation="MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIAV
FT                   IAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSA
FT                   VVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPAL
FT                   FYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
FT   gene            178454..179218
FT                   /gene="pdhR"
FT                   /locus_tag="t0157"
FT   CDS_pept        178454..179218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="t0157"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /note="corresponds to STY0174 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67889"
FT                   /db_xref="GOA:P0A2S3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2S3"
FT                   /protein_id="AAO67889.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            179378..182041
FT                   /gene="aceE"
FT                   /locus_tag="t0158"
FT   CDS_pept        179378..182041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="t0158"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /note="corresponds to STY0175 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67890"
FT                   /db_xref="GOA:Q8Z9F0"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9F0"
FT                   /protein_id="AAO67890.1"
FT                   /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            182056..183945
FT                   /gene="aceF"
FT                   /locus_tag="t0159"
FT   CDS_pept        182056..183945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="t0159"
FT                   /product="dihydrolipoamide acetyltransferase component (E2)
FT                   of pyruvate dehydrogenase"
FT                   /note="corresponds to STY0176 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67891"
FT                   /db_xref="GOA:Q8Z9E9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E9"
FT                   /protein_id="AAO67891.1"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVT
FT                   EVMVKVGDKVTAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFG
FT                   VNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEV
FT                   EEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTP
FT                   VVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKS
FT                   VTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSK
FT                   SAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   gene            184144..185571
FT                   /gene="lpdA"
FT                   /locus_tag="t0160"
FT   CDS_pept        184144..185571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="t0160"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="corresponds to STY0177 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67892"
FT                   /db_xref="GOA:Q8Z9E8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E8"
FT                   /protein_id="AAO67892.1"
FT                   /translation="MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGV
FT                   CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAG
FT                   MAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRV
FT                   WDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKV
FT                   FTKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNL
FT                   DAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKK
FT                   HYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTK
FT                   LIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE
FT                   IFEGSITDLPNPKAKKK"
FT   gene            185860..186144
FT                   /locus_tag="t0161"
FT   CDS_pept        185860..186144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0161"
FT                   /product="probable secreted protein"
FT                   /note="corresponds to STY0178 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFC8"
FT                   /protein_id="AAO67893.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(186182..186973)
FT                   /locus_tag="t0162"
FT   CDS_pept        complement(186182..186973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0162"
FT                   /product="probable secreted protein"
FT                   /note="corresponds to STY0179 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67894"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG44"
FT                   /protein_id="AAO67894.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   gene            complement(186986..188608)
FT                   /gene="yacH"
FT                   /locus_tag="t0163"
FT   CDS_pept        complement(186986..188608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="t0163"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY0180 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67895"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E7"
FT                   /protein_id="AAO67895.1"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPTSEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPTTVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWR
FT                   NGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMAQFQQRSHTSPANVSGET
FT                   SRDRQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQQ
FT                   HPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGS
FT                   HLNTEQRAAAREHFSEHHEFHRR"
FT   gene            188997..191594
FT                   /gene="acnB"
FT                   /locus_tag="t0164"
FT   CDS_pept        188997..191594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="t0164"
FT                   /product="aconitate hydratase 2"
FT                   /note="citrate hydro-lyase 2; corresponds to STY0181 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67896"
FT                   /db_xref="GOA:Q8Z9E6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E6"
FT                   /protein_id="AAO67896.1"
FT                   /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEFL
FT                   LDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLA
FT                   EKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQKKGYPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETDELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIVEYLTSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLL
FT                   SDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTFVAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            191782..192144
FT                   /locus_tag="t0165"
FT   CDS_pept        191782..192144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0182 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67897"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9E5"
FT                   /protein_id="AAO67897.1"
FT                   /translation="MDYEFLRDVTGRVLVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
FT   gene            192379..193332
FT                   /gene="kdgT"
FT                   /locus_tag="t0166"
FT   CDS_pept        192379..193332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="t0166"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="corresponds to STY0183 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67898"
FT                   /db_xref="GOA:P65208"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65208"
FT                   /protein_id="AAO67898.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            193329..194600
FT                   /gene="ygbK"
FT                   /locus_tag="t0167"
FT   CDS_pept        193329..194600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbK"
FT                   /locus_tag="t0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0184 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67899"
FT                   /db_xref="GOA:Q8Z9E4"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E4"
FT                   /protein_id="AAO67899.1"
FT                   /translation="MKMMVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLV
FT                   INTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRK
FT                   LAVIAAAIPAAGRTTLEGKCLVNGAPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYE
FT                   VFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLA
FT                   NALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQE
FT                   IASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKSAMSRQQLGERLSHRLGVVTL
FT                   NIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYYIEEMYCGD"
FT   gene            194590..195573
FT                   /locus_tag="t0168"
FT   CDS_pept        194590..195573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0168"
FT                   /product="PdxA-like protein"
FT                   /note="corresponds to STY0185 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67900"
FT                   /db_xref="GOA:P58716"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58716"
FT                   /protein_id="AAO67900.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   CLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTTRVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            195583..196350
FT                   /locus_tag="t0169"
FT   CDS_pept        195583..196350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0169"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY0186 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67901"
FT                   /db_xref="GOA:Q8XG73"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG73"
FT                   /protein_id="AAO67901.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(196380..197174)
FT                   /gene="speD"
FT                   /locus_tag="t0170"
FT   CDS_pept        complement(196380..197174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="t0170"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="corresponds to STY0187 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67902"
FT                   /db_xref="GOA:Q8Z9E3"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9E3"
FT                   /protein_id="AAO67902.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPIDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV"
FT   gene            complement(197195..198055)
FT                   /gene="speE"
FT                   /locus_tag="t0171"
FT   CDS_pept        complement(197195..198055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="t0171"
FT                   /product="spermidine synthase"
FT                   /note="corresponds to STY0188 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67903"
FT                   /db_xref="GOA:Q8Z9E2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9E2"
FT                   /protein_id="AAO67903.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNSAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   gene            complement(198162..198509)
FT                   /gene="yacC"
FT                   /locus_tag="t0172"
FT   CDS_pept        complement(198162..198509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="t0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0189 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67904"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGD8"
FT                   /protein_id="AAO67904.1"
FT                   /translation="MKTFFRPVLFGSLMALCANSYALTESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
FT   gene            198711..200321
FT                   /gene="yacK"
FT                   /locus_tag="t0173"
FT   CDS_pept        198711..200321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacK"
FT                   /locus_tag="t0173"
FT                   /product="possible multicopper oxidase precursor"
FT                   /note="corresponds to STY0190 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67905"
FT                   /db_xref="GOA:Q8Z9E1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9E1"
FT                   /protein_id="AAO67905.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPQQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
FT   gene            complement(200399..202789)
FT                   /gene="gcd"
FT                   /locus_tag="t0174"
FT   CDS_pept        complement(200399..202789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="t0174"
FT                   /product="glucose dehydrogenase"
FT                   /note="corresponds to STY0191 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67906"
FT                   /db_xref="GOA:Q8Z9E0"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9E0"
FT                   /protein_id="AAO67906.1"
FT                   /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGVWLVAIGGSWYYPI
FT                   AGLVMLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRADATPAATSSSI
FT                   ADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYHEAKADTASPE
FT                   VIADCPSRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTPGLYEPTSPPI
FT                   ITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLLWAFDPGAKDPNTIPADEHAFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQLRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGNPMEPPKDAKGT
FT                   GTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVWKKRIGTPRDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            202995..203531
FT                   /gene="hpt"
FT                   /locus_tag="t0175"
FT   CDS_pept        202995..203531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="t0175"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="corresponds to STY0192 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67907"
FT                   /db_xref="GOA:Q8Z9D9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D9"
FT                   /protein_id="AAO67907.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSDSEMVLVGLLRGS
FT                   FMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYVGKVVLLDE"
FT   gene            complement(203589..204251)
FT                   /gene="yadF"
FT                   /locus_tag="t0176"
FT   CDS_pept        complement(203589..204251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="t0176"
FT                   /product="carbonic anhydrase"
FT                   /note="corresponds to STY0193 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67908"
FT                   /db_xref="GOA:Q8Z9D8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D8"
FT                   /protein_id="AAO67908.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDALEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIPHQ"
FT   gene            204360..205286
FT                   /gene="yadG"
FT                   /locus_tag="t0178"
FT   CDS_pept        204360..205286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="t0178"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /note="corresponds to STY0194 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67909"
FT                   /db_xref="GOA:Q83T83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T83"
FT                   /protein_id="AAO67909.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVSQEFNFNPFETVQQIVVNQAG
FT                   YYGVEHKEAVLRSEKYLKQLDLWEKRHERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKN
FT                   LLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   gene            205283..206053
FT                   /gene="yadH"
FT                   /locus_tag="t0177"
FT   CDS_pept        205283..206053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="t0177"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="corresponds to STY0195 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67910"
FT                   /db_xref="GOA:Q8Z9D6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D6"
FT                   /protein_id="AAO67910.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIATFYLLCWSLIQRGRGLRS"
FT   gene            206158..206598
FT                   /gene="yadI"
FT                   /locus_tag="t0179"
FT   CDS_pept        206158..206598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="t0179"
FT                   /product="putative IIA component of PTS system"
FT                   /note="corresponds to STY0196 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67911"
FT                   /db_xref="GOA:Q8Z9D5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D5"
FT                   /protein_id="AAO67911.1"
FT                   /translation="MLGWVITCHDDRAQDMLDRLERKNGPLAQCRAVNFWRGLSSNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHPQCEVISGISYSLIEEMIPLR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDLYEF"
FT   gene            206666..207889
FT                   /gene="yadE"
FT                   /locus_tag="t0180"
FT   CDS_pept        206666..207889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="t0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0197 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67912"
FT                   /db_xref="GOA:Q8Z9D4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D4"
FT                   /protein_id="AAO67912.1"
FT                   /translation="MRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTVGN
FT                   IRAGQILSVTPVAVDYYAFKFGFGVGFIDKGHLGPVQGKQKVEDGLGDLNKPLSNQNLV
FT                   TWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLKGRLHQTWNQIRIGDRLAYVNAMDAQ
FT                   EDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDYIY
FT                   NRANFPARAVAITFDDGLKSVSRYAYPVLKQYDMKATAFIISSRIKRHPQKWNPRSLQF
FT                   MSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALTQFTPHV
FT                   FYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETMSR
FT                   LIVNQPQG"
FT   gene            complement(207896..208276)
FT                   /gene="panD"
FT                   /locus_tag="t0181"
FT   CDS_pept        complement(207896..208276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="t0181"
FT                   /product="aspartate 1-decarboxylase"
FT                   /note="corresponds to STY0198 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67913"
FT                   /db_xref="GOA:P65663"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65663"
FT                   /protein_id="AAO67913.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            complement(208371..209225)
FT                   /gene="panC"
FT                   /locus_tag="t0182"
FT   CDS_pept        complement(208371..209225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="t0182"
FT                   /product="pantoate:beta-alanine ligase"
FT                   /note="corresponds to STY0199 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67914"
FT                   /db_xref="GOA:Q8Z9D3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9D3"
FT                   /protein_id="AAO67914.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQGLE
FT                   GQTYVDVPGLSTMLEGTSRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMGYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   gene            complement(209351..210145)
FT                   /gene="panB"
FT                   /locus_tag="t0183"
FT   CDS_pept        complement(209351..210145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="t0183"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="corresponds to STY0200 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67915"
FT                   /db_xref="GOA:Q8Z9D2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9D2"
FT                   /protein_id="AAO67915.1"
FT                   /translation="MSKPTTIAVLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVG
FT                   DSLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQAFENAAIV
FT                   MRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQIL
FT                   LDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAEAGDMRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(210255..211430)
FT                   /gene="staG"
FT                   /locus_tag="t0184"
FT   CDS_pept        complement(210255..211430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staG"
FT                   /locus_tag="t0184"
FT                   /product="putative fimbrial protein"
FT                   /note="corresponds to STY0201 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67916"
FT                   /db_xref="GOA:Q8Z9D1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D1"
FT                   /protein_id="AAO67916.1"
FT                   /translation="MLLKNTTWFAAFFLMMAIMSNCYAINTTLAVGDYASSEHDGPSGD
FT                   SVFTDNSHNFGQTIAIHKETALRQITVFNWSGIQYVMEMFCNGSGNHTYLQLTHNYISA
FT                   GKSYNGHPLYKTSIPGFYFTIEMTFLQPAENMTSSTFWFDKTSTPITSEFTEFPSACSR
FT                   TNVYSNLGKLMYGLKIYAYVDSDFAPTEAQLQSFTLSKNGDSDFYIDNPGSGLSNYKMK
FT                   FNLAATGLKAVWPTCSASTISGTNVSGSTVKLGSFYPKQIMEGLSPTKFQINLSSCQYI
FT                   NNIEVKLASNNVGTKNTSLLTNNSTSNTKASGIGVLIEGLKSSSSAQMVLKPNDSSSIY
FT                   KDTTNNTGDGSPVGSATKSLYFQATLKPDGDNPTINPGDFKATAQFSITYP"
FT   gene            complement(211467..212063)
FT                   /gene="staF"
FT                   /locus_tag="t0185"
FT   CDS_pept        complement(211467..212063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staF"
FT                   /locus_tag="t0185"
FT                   /product="putative fimbrial protein"
FT                   /note="corresponds to STY0202 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67917"
FT                   /db_xref="GOA:Q8Z9D0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9D0"
FT                   /protein_id="AAO67917.1"
FT                   /translation="MVIPMRRLREPTLATLFSGLATALFSATLYADTNVNFTASVQKDT
FT                   CQIKIDGNGTVNFATIAPAYFADGITAETDYEGGKEFTIKLISCPISDGKITNVTFNFA
FT                   PLNGQFSPENQQVFPNDIATDAGGVDNVGVVIFTTDSPRTNVLNTDGSSRATFAASTYS
FT                   DTVWTFYSRMQKIRSAEKVTTGELSSRVLVNVSYE"
FT   gene            complement(212063..212677)
FT                   /gene="staE"
FT                   /locus_tag="t0186"
FT   CDS_pept        complement(212063..212677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staE"
FT                   /locus_tag="t0186"
FT                   /product="putative fimbrial protein"
FT                   /note="corresponds to STY0203 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67918"
FT                   /db_xref="GOA:Q8Z9C9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C9"
FT                   /protein_id="AAO67918.1"
FT                   /translation="MIMKKQILRVVIFSSLIATGAGISTMTYADGTNSLDLTVNANITA
FT                   GTCSASVVEGDTITDTIAFGNVYISEVYAKSKIKLFKLRFSDCVGLKDKKAKFRLAPNN
FT                   VACPGSSGTDGQFANASTSTTKAAMVAMEVWTTETPGGTGAVKLHCWSKPEQTVDLSGA
FT                   SVTTPVDFPLSAMMVAQSGGTLQNMTAGDFYSPTTFTITYQ"
FT   gene            complement(212686..213252)
FT                   /gene="staD"
FT                   /locus_tag="t0187"
FT   CDS_pept        complement(212686..213252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staD"
FT                   /locus_tag="t0187"
FT                   /product="putative fimbrial protein"
FT                   /note="corresponds to STY0204 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67919"
FT                   /db_xref="GOA:Q8Z9C8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C8"
FT                   /protein_id="AAO67919.1"
FT                   /translation="MKRNKYLLAASVLAVIFPLTSQAENINVDFTATVLATTCSMSIAA
FT                   LDGSNLSGDATSGYTLNVGDVGLDKIIKKSAESQKNFKFVAKDCSAALTKITTTLASST
FT                   DASGNFIKNQSAASGAATNVGMGFKRKSTTDETYFTPGSGSFSWTSDERAANEVEMTVA
FT                   LRELTDGAGTTGAFSSTATFNFTYQ"
FT   gene            complement(213239..215830)
FT                   /gene="staC"
FT                   /locus_tag="t0188"
FT   CDS_pept        complement(213239..215830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staC"
FT                   /locus_tag="t0188"
FT                   /product="outer membrane usher protein HtrE precursor"
FT                   /note="corresponds to STY0205 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67920"
FT                   /db_xref="GOA:A0A0H2VKU6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VKU6"
FT                   /protein_id="AAO67920.1"
FT                   /translation="MLAVCCALFYSQSSISAESVEYDSSFLMGSSASTIDISKYSDGNP
FT                   TPVGTYSVKVFVNENPVSSLSIPFIDIGKVSAEACLTQKNLAQLHIKQPEINATNQILK
FT                   KGEEEDQDCLNLPVAIAHSEVNFDMGEQRLDITVPQAWLIEGYDGYVEPSLWEDGIPAA
FT                   LLSYSANGYHSTNGSADNDSMYAAFNTGINLGAWRFRANGNYNWTKDSGSSFDYQNRYL
FT                   QRDLPSMRSQLVVGETYTTGETFDSVSIRGARLYSDNRMLPSQLANYAPIIRGVANSNA
FT                   KVSITQGGYKIYESTVPPGPFEISDISPSGYGSDLIVTVEEADGSKRTFSQPFSSVMQM
FT                   QRPGVGRWDFSAGEVNDDELHDKPYMAQGSYYYGLNNFLTLYTGVQGTDNNYLAGLLGV
FT                   GLNTPLGAFALDVTQSRTEIPEDKTYKGQSYRLTWNKLIEPTATSFNVAAYRYSTQDYL
FT                   GLNDALQLIDDAKHKDADDRNTMLNYSRMKNQVTVSINQPLRFKEVDYGSFFLSGSWTD
FT                   YWATNESRTDYSLGYGRGFSWGSLSINLQRSWDEDGEKDDSLYINFNVPLENLLGGGRR
FT                   KSGFSSLTAQMRTDFDGGYQLSMNSNGSSEDHTLNYSVNTGYTMQKNEKNITDVSGYAS
FT                   YQSPWGDVTASASANNDSSRQYSLATTGDFVLHGGGVTFTNDNFGNSDAIVLVKAPGAK
FT                   GARINGGNSTIDRWGYGATNSLSAYRENQVNIDIDTLENDVELKSTSTTLIPRDGAVVL
FT                   ASFETDQGRSVILNMSRNDGKALPFGAEVYENDVQIDNMGQGGQAFVRGISDAGELSVR
FT                   WFEENQPATCLATFALPATQQTVGSSQTLLLDHITCRVNNLKSNGIDNEKE"
FT   gene            complement(215905..216639)
FT                   /gene="staB"
FT                   /locus_tag="t0189"
FT   CDS_pept        complement(215905..216639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staB"
FT                   /locus_tag="t0189"
FT                   /product="chaperone protein EcpD precursor"
FT                   /note="corresponds to STY0206 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67921"
FT                   /db_xref="GOA:Q8Z9C6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C6"
FT                   /protein_id="AAO67921.1"
FT                   /translation="MLYVKKSLTAIVLASAVFSTFSYADIIISGTRIVYDENKKDVSIR
FT                   LENKGTRPLLVQNWIDLGNDNDDPGSIKAPFVSTPPVSRVEPKRGQSVKIMYTQASALP
FT                   KDRESVFWFNVLEVPPKADTSKEENKSLLQLAFRTRIKLFYRPTGLKGQPAEAAKQLKW
FT                   QIASEQGYAVLRADNSTPYFVSFNDATYTAGGKRYDVEATMVAPFSKSSFTVKGLSGAS
FT                   AGKLEYHAINDFGGLIEGSVSL"
FT   gene            complement(216818..217402)
FT                   /gene="staA"
FT                   /locus_tag="t0190"
FT   CDS_pept        complement(216818..217402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="staA"
FT                   /locus_tag="t0190"
FT                   /product="putative fimbrial protein"
FT                   /note="corresponds to STY0207 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67922"
FT                   /db_xref="GOA:Q8Z9C5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C5"
FT                   /protein_id="AAO67922.1"
FT                   /translation="MKKAILAAAMVMAMGSTSAMAVEGGQIEFHGLVSATTCSKVVSSS
FT                   RGNQATDGDVYLTTAAPGDITEGVAANAYGALPAPFSIILDCSGAADVTDATKASLVMD
FT                   SSFSNTTGTLDNDTTLSVAGETGAENVNIAIHDADTKTQVKIDGAEIHEASFKNKVATY
FT                   NFMASYVRADASKEVTTGHVTTNAMYTFTYQ"
FT   gene            complement(217797..218276)
FT                   /gene="folK"
FT                   /locus_tag="t0191"
FT   CDS_pept        complement(217797..218276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="t0191"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="corresponds to STY0208 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67923"
FT                   /db_xref="GOA:Q8Z9C4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C4"
FT                   /protein_id="AAO67923.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPELVFPDDKGLLIELMSQMSPCPDRW"
FT   gene            complement(218273..219691)
FT                   /gene="pcnB"
FT                   /locus_tag="t0192"
FT   CDS_pept        complement(218273..219691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="t0192"
FT                   /product="poly(A) polymerase"
FT                   /note="corresponds to STY0209 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67924"
FT                   /db_xref="GOA:Q8Z9C3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9C3"
FT                   /protein_id="AAO67924.1"
FT                   /translation="MTLPRCAIFTRVANFCRKVLSREESEAEQAVARPHMTIIPREQHA
FT                   ISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHNEGSESDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLNMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGNGFETYQQLREYHLFQP
FT                   LFPTITRYFTENGDSAMERIIAQVLKNTDNRIRNEMRVNPAFLFAAMFWYPLLEMAQKI
FT                   AQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLM
FT                   EHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQASAPPEQKGMLNELDDDPAPRRRR
FT                   SRPRKRAPRREGTV"
FT   gene            complement(219832..220728)
FT                   /gene="yadB"
FT                   /locus_tag="t0193"
FT   CDS_pept        complement(219832..220728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="t0193"
FT                   /product="glutamyl-tRNA synthetase-related protein"
FT                   /note="corresponds to STY0210 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67925"
FT                   /db_xref="GOA:Q8Z9C2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9C2"
FT                   /protein_id="AAO67925.1"
FT                   /translation="MTDSHYIGRFAPSPSGELHFGSLIAALGSYLQARAQRGVWRVRIE
FT                   DIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYREALAWLHEQGLSYYCTCP
FT                   RSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMHFHDALRGDIQADPQLASEDFII
FT                   HRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQFGWRAPGYVHLPLAL
FT                   NEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVAWQEMSVEELLRFAVAHWRLT
FT                   AVPTSANVNPAFSNASR"
FT   gene            complement(220797..221252)
FT                   /gene="dksA"
FT                   /locus_tag="t0194"
FT   CDS_pept        complement(220797..221252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="t0194"
FT                   /product="dosage-dependent dnaK suppressor protein"
FT                   /note="corresponds to STY0211 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67926"
FT                   /db_xref="GOA:P0A1G6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G6"
FT                   /protein_id="AAO67926.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(221429..222133)
FT                   /gene="sfsA"
FT                   /locus_tag="t0195"
FT   CDS_pept        complement(221429..222133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="t0195"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="corresponds to STY0212 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67927"
FT                   /db_xref="GOA:Q8Z9C1"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9C1"
FT                   /protein_id="AAO67927.1"
FT                   /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALAGY
FT                   NILNSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRE
FT                   LMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAT
FT                   KMELNEPVPITL"
FT   gene            complement(222150..222680)
FT                   /gene="ligT"
FT                   /locus_tag="t0196"
FT   CDS_pept        complement(222150..222680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="t0196"
FT                   /product="2'-5' RNA ligase"
FT                   /note="corresponds to STY0213 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67928"
FT                   /db_xref="GOA:Q8Z9C0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9C0"
FT                   /protein_id="AAO67928.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSNDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            222741..225182
FT                   /gene="hrpB"
FT                   /locus_tag="t0197"
FT   CDS_pept        222741..225182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="t0197"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="corresponds to STY0214 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67929"
FT                   /db_xref="GOA:Q8Z9B9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B9"
FT                   /protein_id="AAO67929.1"
FT                   /translation="MEPFVTSLPVAAVLPELLTALKTAPQVLLSAPTGAGKSTWLPLQL
FT                   LQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSCVGPRTRLEVVT
FT                   EGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRDDLRLLIMSATL
FT                   DNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAELLRNENGSLLLF
FT                   LPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMRKVVLATNIAET
FT                   SLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAGRLAPGICLHLL
FT                   AKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEVNLQAARRLLLM
FT                   LGALEGERLSARGRKMAATGNDPRLAAMLVNADEGDSAATAAMLAAILEDPPRGGGTDL
FT                   SVLFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIARRRGQEGRYQLA
FT                   NGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQACPDLLRQSDT
FT                   VEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKGLSVLNWTPEAE
FT                   QFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLKSLNVTQALRGL
FT                   LDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEASTPTLAQGRVP
FT                   LVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPANTAPTRRTKKY
FT                   S"
FT   gene            225323..227845
FT                   /gene="mrcB"
FT                   /locus_tag="t0198"
FT   CDS_pept        225323..227845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="t0198"
FT                   /product="penicillin-binding protein 1b"
FT                   /function="peptidoglycan synthetase"
FT                   /note="corresponds to STY0215 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67930"
FT                   /db_xref="GOA:Q8Z9B8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B8"
FT                   /protein_id="AAO67930.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRRFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPENDDRRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLVGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCNGGMRTLPVWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            228138..230329
FT                   /pseudo
FT                   /gene="fhuA"
FT                   /locus_tag="t0199"
FT                   /note="corresponds to STY0218 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            230378..231175
FT                   /gene="fhuC"
FT                   /locus_tag="t0200"
FT   CDS_pept        230378..231175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="t0200"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /note="corresponds to STY0219 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67931"
FT                   /db_xref="GOA:Q8Z9B7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B7"
FT                   /protein_id="AAO67931.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQLPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            231175..232065
FT                   /gene="fhuD"
FT                   /locus_tag="t0201"
FT   CDS_pept        231175..232065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="t0201"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /note="corresponds to STY0220 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67932"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B6"
FT                   /protein_id="AAO67932.1"
FT                   /translation="MRELYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPRFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SIDRLAMYKEADVICFDHGNSTDMNALMATPLWQAMSFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILNNVLGGKA"
FT   gene            232062..234119
FT                   /gene="fhuB"
FT                   /locus_tag="t0202"
FT   CDS_pept        232062..234119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="t0202"
FT                   /product="ferrichrome transport protein FhuB precursor"
FT                   /note="corresponds to STY0221 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67933"
FT                   /db_xref="GOA:Q8Z9B5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B5"
FT                   /protein_id="AAO67933.1"
FT                   /translation="MSRKREIPDGGAKNALTDLRFGRFVGRIRRSRHPALLLLALLVAA
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSQLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLTFAVAGGALLLLATWVALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAF
FT                   GVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMMLQASGDPRMADVLTWISGSTYNATGGQVTRTAIVMVILLAVVPLCRRWLTILPLG
FT                   GDAARAVGIALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   gene            complement(234210..235490)
FT                   /gene="hemL"
FT                   /locus_tag="t0203"
FT   CDS_pept        complement(234210..235490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="t0203"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="corresponds to STY0223 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67934"
FT                   /db_xref="GOA:Q8Z9B4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9B4"
FT                   /protein_id="AAO67934.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLLEAAE
FT                   EANIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMDDINNTIDAARRVFAKL"
FT   gene            235660..237081
FT                   /gene="yadQ"
FT                   /locus_tag="t0204"
FT   CDS_pept        235660..237081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="t0204"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0225 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67935"
FT                   /db_xref="GOA:Q8Z9B3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9B3"
FT                   /protein_id="AAO67935.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKTVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPAAAGGGFNLIPIAAAGNFSVGLLLFIFITR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAAKNQNAPAGENT"
FT   gene            237118..237507
FT                   /gene="yadR"
FT                   /locus_tag="t0205"
FT   CDS_pept        237118..237507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="t0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0226 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67936"
FT                   /db_xref="GOA:Q8XFF3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFF3"
FT                   /protein_id="AAO67936.1"
FT                   /translation="MGENLSNYRCRLEQNMSDDVALPLQFTDAAANKVKSLIADEDNPN
FT                   LKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEG
FT                   LEGSRFIVTNPNAKSTCGCGSSFSI"
FT   gene            complement(237608..238231)
FT                   /gene="yadS"
FT                   /locus_tag="t0206"
FT   CDS_pept        complement(237608..238231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="t0206"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0227 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67937"
FT                   /db_xref="GOA:Q8XEP1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEP1"
FT                   /protein_id="AAO67937.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(238268..239068)
FT                   /gene="btuF"
FT                   /locus_tag="t0207"
FT   CDS_pept        complement(238268..239068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="t0207"
FT                   /product="cobalamin periplasmic binding protein"
FT                   /note="corresponds to STY0228 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67938"
FT                   /db_xref="GOA:Q8Z9B2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9B2"
FT                   /protein_id="AAO67938.1"
FT                   /translation="MAKQMFRALGALLLTLPVWLYAAPRVITLSPANTELAFAAEITPV
FT                   GVSSYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKV
FT                   MWVDAVTIEQIADALRQLAAWSPQPEKAQQAAQTLLKEYAALKVEYAGKAKKRVFLQFG
FT                   MNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
FT                   KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(239061..239759)
FT                   /gene="mtn"
FT                   /locus_tag="t0208"
FT   CDS_pept        complement(239061..239759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="t0208"
FT                   /product="MTA/SAH nucleosidase"
FT                   /note="corresponds to STY0229 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67939"
FT                   /db_xref="GOA:P60216"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60216"
FT                   /protein_id="AAO67939.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   gene            239844..241361
FT                   /gene="dgt"
FT                   /locus_tag="t0209"
FT   CDS_pept        239844..241361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="t0209"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="corresponds to STY0230 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67940"
FT                   /db_xref="GOA:Q8Z9B1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9B1"
FT                   /protein_id="AAO67940.1"
FT                   /translation="MASIDFRNKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKEQNRLEEYGLDALTG
FT                   PFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTHDRCVVSSLRLQ
FT                   EGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGPV
FT                   PDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNVAVEHVFSHPDVEQL
FT                   ELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLFQKLSTRHRLAYVEV
FT                   VSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAVEQ"
FT   gene            241491..242918
FT                   /gene="htrA"
FT                   /locus_tag="t0210"
FT   CDS_pept        241491..242918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="t0210"
FT                   /product="protease DO precursor; heat shock protein HtrA"
FT                   /note="corresponds to STY0231 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67941"
FT                   /db_xref="GOA:Q8Z9B0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9B0"
FT                   /protein_id="AAO67941.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELSSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
FT   gene            243071..244228
FT                   /gene="yaeG"
FT                   /locus_tag="t0211"
FT   CDS_pept        243071..244228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeG"
FT                   /locus_tag="t0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0232 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67942"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9A9"
FT                   /protein_id="AAO67942.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
FT   gene            complement(244317..244703)
FT                   /gene="yaeH"
FT                   /locus_tag="t0212"
FT   CDS_pept        complement(244317..244703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="t0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0233 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67943"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7ANK1"
FT                   /protein_id="AAO67943.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDL
FT                   RHLESVVANKISEIEADLDKLTRK"
FT   gene            244950..246252
FT                   /pseudo
FT                   /locus_tag="t0213"
FT                   /note="corresponds to STY0235 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(246289..247113)
FT                   /gene="dapD"
FT                   /locus_tag="t0214"
FT   CDS_pept        complement(246289..247113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="t0214"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /note="corresponds to STY0236 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67944"
FT                   /db_xref="GOA:Q8Z9A8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A8"
FT                   /protein_id="AAO67944.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAVKQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKAPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(247143..249815)
FT                   /gene="glnD"
FT                   /locus_tag="t0215"
FT   CDS_pept        complement(247143..249815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="t0215"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /note="corresponds to STY0237 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67945"
FT                   /db_xref="GOA:Q8Z9A7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A7"
FT                   /protein_id="AAO67945.1"
FT                   /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQH
FT                   WLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAECAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRH
FT                   LRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIA
FT                   KGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLSQ
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLAADRHDVIRTGLEQTITQHSWQPPQPRRQPAKLRHFTVETEVNFLPTHTD
FT                   RKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNV
FT                   LQLEVQQRLTAALNPNDKG"
FT   gene            complement(249928..250722)
FT                   /gene="map"
FT                   /locus_tag="t0216"
FT   CDS_pept        complement(249928..250722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="t0216"
FT                   /product="methionine aminopeptidase"
FT                   /note="corresponds to STY0238 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67946"
FT                   /db_xref="GOA:P0A1X7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1X7"
FT                   /protein_id="AAO67946.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   gene            251172..251897
FT                   /gene="rpsB"
FT                   /locus_tag="t0217"
FT   CDS_pept        251172..251897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="t0217"
FT                   /product="30S ribosomal protein S2"
FT                   /note="corresponds to STY0239 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67947"
FT                   /db_xref="GOA:P66542"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66542"
FT                   /protein_id="AAO67947.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            252155..253006
FT                   /gene="tsf"
FT                   /locus_tag="t0218"
FT   CDS_pept        252155..253006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="t0218"
FT                   /product="elongation factor Ts"
FT                   /note="corresponds to STY0240 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67948"
FT                   /db_xref="GOA:P64053"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64053"
FT                   /protein_id="AAO67948.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            253151..253876
FT                   /gene="pyrH"
FT                   /locus_tag="t0219"
FT   CDS_pept        253151..253876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="t0219"
FT                   /product="uridine 5'-monophosphate kinase"
FT                   /note="corresponds to STY0241 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67949"
FT                   /db_xref="GOA:P65934"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65934"
FT                   /protein_id="AAO67949.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            254023..254580
FT                   /gene="frr"
FT                   /locus_tag="t0220"
FT   CDS_pept        254023..254580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="t0220"
FT                   /product="ribosome recycling factor"
FT                   /note="corresponds to STY0242 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67950"
FT                   /db_xref="GOA:P66739"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66739"
FT                   /protein_id="AAO67950.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            254722..255918
FT                   /gene="dxr"
FT                   /locus_tag="t0221"
FT   CDS_pept        254722..255918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="t0221"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /note="corresponds to STY0243 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67951"
FT                   /db_xref="GOA:Q8Z9A6"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A6"
FT                   /protein_id="AAO67951.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVHHNPDSFRVIALVAGKNVARMAEQ
FT                   CLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQS
FT                   IQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPASVDDVLQVDAIAREVARKQVIRLSR"
FT   gene            256231..256989
FT                   /locus_tag="t0222"
FT   CDS_pept        256231..256989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0222"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /note="corresponds to STY0244 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67952"
FT                   /db_xref="GOA:Q8Z9A5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A5"
FT                   /protein_id="AAO67952.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAELVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            257002..257859
FT                   /gene="cdsA"
FT                   /locus_tag="t0223"
FT   CDS_pept        257002..257859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="t0223"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="corresponds to STY0245 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67953"
FT                   /db_xref="GOA:Q8XG59"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG59"
FT                   /protein_id="AAO67953.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            257871..259223
FT                   /gene="yaeL"
FT                   /locus_tag="t0224"
FT   CDS_pept        257871..259223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="t0224"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY0246 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67954"
FT                   /db_xref="GOA:Q8Z9A4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A4"
FT                   /protein_id="AAO67954.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVNMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            259255..261666
FT                   /gene="yaeT"
FT                   /locus_tag="t0225"
FT   CDS_pept        259255..261666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="t0225"
FT                   /product="outer membrane protein precursor"
FT                   /note="corresponds to STY0247 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67955"
FT                   /db_xref="GOA:Q8Z9A3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A3"
FT                   /protein_id="AAO67955.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIEKLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKL
FT                   DRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDG
FT                   LGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDDDDYEDCTQESGCKS
FT                   DDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDY
FT                   SDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            261789..262274
FT                   /gene="ompH"
FT                   /locus_tag="t0226"
FT   CDS_pept        261789..262274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompH"
FT                   /locus_tag="t0226"
FT                   /product="outer membrane protein OmpH precursor"
FT                   /note="corresponds to STY0248 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67956"
FT                   /db_xref="GOA:P0A1Z3"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Z3"
FT                   /protein_id="AAO67956.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            262278..263303
FT                   /gene="lpxD"
FT                   /locus_tag="t0227"
FT   CDS_pept        262278..263303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="t0227"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="corresponds to STY0249 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67957"
FT                   /db_xref="GOA:P0A1X5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1X5"
FT                   /protein_id="AAO67957.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            263409..263864
FT                   /gene="fabZ"
FT                   /locus_tag="t0228"
FT   CDS_pept        263409..263864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="t0228"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydrase"
FT                   /note="corresponds to STY0250 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67958"
FT                   /db_xref="GOA:P0A1I0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1I0"
FT                   /protein_id="AAO67958.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            263868..264656
FT                   /gene="lpxA"
FT                   /locus_tag="t0229"
FT   CDS_pept        263868..264656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="t0229"
FT                   /product="acyl-[acyl-carrier-protein]:UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /note="corresponds to STY0251 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67959"
FT                   /db_xref="GOA:Q8Z9A2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A2"
FT                   /protein_id="AAO67959.1"
FT                   /translation="MIDKSVFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            264656..265804
FT                   /gene="lpxB"
FT                   /locus_tag="t0230"
FT   CDS_pept        264656..265804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="t0230"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /note="corresponds to STY0252 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67960"
FT                   /db_xref="GOA:Q8Z9A1"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z9A1"
FT                   /protein_id="AAO67960.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   gene            265801..266397
FT                   /gene="rnhB"
FT                   /locus_tag="t0231"
FT   CDS_pept        265801..266397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="t0231"
FT                   /product="ribonuclease HII"
FT                   /note="corresponds to STY0253 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67961"
FT                   /db_xref="GOA:P0A2C2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2C2"
FT                   /protein_id="AAO67961.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPELPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            266421..269903
FT                   /gene="dnaE"
FT                   /locus_tag="t0232"
FT   CDS_pept        266421..269903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="t0232"
FT                   /product="DNA polymerase III, alpha chain"
FT                   /note="corresponds to STY0254 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67962"
FT                   /db_xref="GOA:Q8Z9A0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z9A0"
FT                   /protein_id="AAO67962.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEAHFP
FT                   DRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDYLVKKSKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            269916..270875
FT                   /gene="accA"
FT                   /locus_tag="t0233"
FT   CDS_pept        269916..270875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="t0233"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /note="corresponds to STY0255 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67963"
FT                   /db_xref="GOA:P0A1C4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1C4"
FT                   /protein_id="AAO67963.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            271067..271525
FT                   /gene="tnpA"
FT                   /locus_tag="t0234"
FT   CDS_pept        271067..271525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="t0234"
FT                   /product="transposase for insertion sequence element IS200"
FT                   /note="corresponds to STY0256 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67964"
FT                   /db_xref="GOA:Q7WRV2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WRV2"
FT                   /protein_id="AAO67964.1"
FT                   /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLC
FT                   EWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
FT   gene            271768..273531
FT                   /pseudo
FT                   /locus_tag="t0235"
FT                   /note="corresponds to STY0257 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            273604..275745
FT                   /gene="ldcC"
FT                   /locus_tag="t0236"
FT   CDS_pept        273604..275745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="t0236"
FT                   /product="lysine decarboxylase"
FT                   /note="corresponds to STY0259 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67965"
FT                   /db_xref="GOA:Q8Z998"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z998"
FT                   /protein_id="AAO67965.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTVYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPKREFT
FT                   RDSIARKVAETAQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFTDADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPELMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            275801..276190
FT                   /locus_tag="t0237"
FT   CDS_pept        275801..276190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0260 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67966"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z997"
FT                   /protein_id="AAO67966.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEAWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            276253..277545
FT                   /gene="mesJ"
FT                   /locus_tag="t0238"
FT   CDS_pept        276253..277545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="t0238"
FT                   /product="cell cycle protein MesJ"
FT                   /note="corresponds to STY0261 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67967"
FT                   /db_xref="GOA:Q8Z996"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z996"
FT                   /protein_id="AAO67967.1"
FT                   /translation="MTTLTLNTSLLSSRRILAAFSGGLDSTVLLHQLVLWRERHPDVTL
FT                   RAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAFAQ
FT                   TLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKT
FT                   LEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCAEQER
FT                   LLDELLASDLTDCITTEGTLRLSPLMSMSDVRRAAILRRWLAMRNAPMPSRDALERIWQ
FT                   EVALARDDASPCLRFGDHEIRRYQSQLWWIKTVAGQHETTVAWPVWQTPLALPAGLGTV
FT                   QLVPGGELRRPREEESVSIRFKAPGLLHIVGRHGGRKLKKIWQEQGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
FT   gene            complement(277629..277883)
FT                   /gene="rof"
FT                   /locus_tag="t0239"
FT   CDS_pept        complement(277629..277883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="t0239"
FT                   /product="ROF protein"
FT                   /note="corresponds to STY0262 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67968"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z995"
FT                   /protein_id="AAO67968.1"
FT                   /translation="MNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKANDLIL
FT                   RKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
FT   gene            complement(277876..278094)
FT                   /gene="yaeP"
FT                   /locus_tag="t0240"
FT   CDS_pept        complement(277876..278094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="t0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0263 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67969"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67552"
FT                   /protein_id="AAO67969.1"
FT                   /translation="MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
FT   gene            278274..278819
FT                   /gene="yaeQ"
FT                   /locus_tag="t0241"
FT   CDS_pept        278274..278819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="t0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0264 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67970"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1S7"
FT                   /protein_id="AAO67970.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            278816..279238
FT                   /gene="yaeJ"
FT                   /locus_tag="t0242"
FT   CDS_pept        278816..279238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="t0242"
FT                   /product="putative release factor"
FT                   /note="corresponds to STY0265 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67971"
FT                   /db_xref="GOA:Q8Z994"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z994"
FT                   /protein_id="AAO67971.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKIRRPLD"
FT   gene            279270..279971
FT                   /gene="cutF"
FT                   /locus_tag="t0243"
FT   CDS_pept        279270..279971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="t0243"
FT                   /product="copper homeostasis protein CutF precursor"
FT                   /note="lipoprotein nlpE; corresponds to STY0266 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67972"
FT                   /db_xref="GOA:Q9F2C2"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F2C2"
FT                   /protein_id="AAO67972.1"
FT                   /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSN
FT                   GEKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFT
FT                   DCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVFAANPDTGEPVKTLIADKN
FT                   VKFAPGKDCTH"
FT   gene            complement(280079..280537)
FT                   /gene="tnpA"
FT                   /locus_tag="t0244"
FT   CDS_pept        complement(280079..280537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="t0244"
FT                   /product="transposase for insertion sequence element IS200"
FT                   /note="corresponds to STY0267 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67973"
FT                   /db_xref="GOA:Q7WRV2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WRV2"
FT                   /protein_id="AAO67973.1"
FT                   /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLC
FT                   EWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
FT   gene            complement(280756..282474)
FT                   /gene="proS"
FT                   /locus_tag="t0245"
FT   CDS_pept        complement(280756..282474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="t0245"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="corresponds to STY0269 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67974"
FT                   /db_xref="GOA:Q8XEY9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEY9"
FT                   /protein_id="AAO67974.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYLVKAIKG"
FT   gene            complement(282585..283292)
FT                   /gene="yaeB"
FT                   /locus_tag="t0246"
FT   CDS_pept        complement(282585..283292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="t0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0270 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67975"
FT                   /db_xref="GOA:Q8Z993"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z993"
FT                   /protein_id="AAO67975.1"
FT                   /translation="MSSFQFDQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQA
FT                   DAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPV
FT                   SFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   VNTGFEVFALEPR"
FT   gene            complement(283289..283693)
FT                   /gene="rcsF"
FT                   /locus_tag="t0247"
FT   CDS_pept        complement(283289..283693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="t0247"
FT                   /product="rcsF protein"
FT                   /note="corresponds to STY0271 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67976"
FT                   /db_xref="GOA:Q8XEN9"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEN9"
FT                   /protein_id="AAO67976.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   gene            complement(283812..284627)
FT                   /gene="yaeC"
FT                   /locus_tag="t0248"
FT   CDS_pept        complement(283812..284627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeC"
FT                   /locus_tag="t0248"
FT                   /product="putative lipoprotein precursor"
FT                   /note="corresponds to STY0272 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67977"
FT                   /db_xref="GOA:Q8Z992"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z992"
FT                   /protein_id="AAO67977.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVSL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(284666..285304)
FT                   /gene="yaeE"
FT                   /locus_tag="t0249"
FT   CDS_pept        complement(284666..285304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="t0249"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="corresponds to STY0273 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67978"
FT                   /db_xref="GOA:Q8Z991"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z991"
FT                   /protein_id="AAO67978.1"
FT                   /translation="MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENA
FT                   RLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFIARIVE
FT                   NALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAMGGAVG
FT                   AGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(285312..286343)
FT                   /gene="abc"
FT                   /locus_tag="t0250"
FT   CDS_pept        complement(285312..286343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abc"
FT                   /locus_tag="t0250"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="corresponds to STY0274 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67979"
FT                   /db_xref="GOA:Q8Z990"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z990"
FT                   /protein_id="AAO67979.1"
FT                   /translation="MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVMVGGQELTTLSESGLTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   gene            286533..287099
FT                   /gene="yaeD"
FT                   /locus_tag="t0251"
FT   CDS_pept        286533..287099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeD"
FT                   /locus_tag="t0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY0275 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67980"
FT                   /db_xref="GOA:Q8Z989"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z989"
FT                   /protein_id="AAO67980.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            287477..289010
FT                   /locus_tag="t0252"
FT   rRNA            287477..289010
FT                   /locus_tag="t0252"
FT                   /product="16S ribosomal RNA"
FT   gene            289097..289172
FT                   /locus_tag="t0253"
FT   tRNA            289097..289172
FT                   /locus_tag="t0253"
FT                   /product="tRNA-Glu"
FT   gene            289366..292371
FT                   /locus_tag="t0254"
FT   rRNA            289366..292371
FT                   /locus_tag="t0254"
FT                   /product="23S ribosomal RNA"
FT   gene            292472..292591
FT                   /locus_tag="t4650"
FT   rRNA            292472..292591
FT                   /locus_tag="t4650"
FT                   /product="5S ribosomal RNA"
FT   gene            293014..293469
FT                   /locus_tag="t0255"
FT   CDS_pept        293014..293469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2848 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67981"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J2"
FT                   /protein_id="AAO67981.1"
FT                   /translation="MAIKPFNYQQDFSSIDFRQQPELYQVGRGEQGGLLVEPYKSEILP
FT                   FWRYKDEASAMKSAEQIYQLFEAYRQQDDFVGMDMARKFIQMGYTRARRYANYKGGKKY
FT                   AEDGSLNTRGNDPIKAAAATVFKGWWDKIRQDEDYLKRKRQHQARWG"
FT   gene            293573..294874
FT                   /gene="kgtP"
FT                   /locus_tag="t0256"
FT   CDS_pept        293573..294874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /locus_tag="t0256"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="corresponds to STY2847 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67982"
FT                   /db_xref="GOA:Q8Z4J3"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J3"
FT                   /protein_id="AAO67982.1"
FT                   /translation="MAEIIQRIDKNNAEAPEMRRHIWAIVGASSGNLVEWFDFYVYSFC
FT                   SLYFAHIFFPSSNTTTQLLQTAGVFAAGFLMRSIGGWLFGRIADRRGRKASMLISVCMM
FT                   CMGSLVIACLPGYDTIGTWAPALLLIARLFQGLSVGGEYGTSATYMSEVALEGRKGFFA
FT                   SFQYVTLIGGQLLALLVVVILQQVLEDAELRAWGWRIPFALGAVLAVVALWLRRQLDET
FT                   SKHETRALKEAGSLKGLWRNRKAFLMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANV
FT                   ASGIMTAALCVFMLVQPLFGALSDKIGRRTSMLCFGALATLFTVPILSALQNVTSPYAA
FT                   FALVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANALFGGSAEYVALSLKS
FT                   VGMESSFFWYVTAMAVLAFLVSLMLHRKGKGLRL"
FT   gene            complement(294871..295194)
FT                   /gene="yfiM"
FT                   /locus_tag="t0257"
FT   CDS_pept        complement(294871..295194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiM"
FT                   /locus_tag="t0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2846 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67983"
FT                   /db_xref="InterPro:IPR017028"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEY1"
FT                   /protein_id="AAO67983.1"
FT                   /translation="MRVLIPFTVLFLSGCSHLANDHWSGQDKAQHFMASAMLSAAGNEY
FT                   ARHQGVSPDRSAAIGLMFSLSLGASKELWDSRPEGSGWSWKDFVWDVAGATTGYAIWQM
FT                   ARY"
FT   gene            complement(295239..296594)
FT                   /gene="pssA"
FT                   /locus_tag="t0258"
FT   CDS_pept        complement(295239..296594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="t0258"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase"
FT                   /note="corresponds to STY2845 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67984"
FT                   /db_xref="GOA:Q8XFW5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFW5"
FT                   /protein_id="AAO67984.1"
FT                   /translation="MLSKFKRNKHQQHLAQLPKISQSVDDVDFFYTPATFRETLLEKIA
FT                   SATQRICIVALYLEQDDGGKGILDALYAAKRQRPELDVRVLVDWHRAQRGRIGAAASNT
FT                   NADWYCRLAQENPGIDVPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQH
FT                   DKYRYDRYQLIRNRQMADIMFDWVTQNLMNGRGVNRLDNTQRPKSPEIKNDIRLYRQEL
FT                   RDASYHFQGDANDEQLSVTPLVGLGKSSLLNKTIFHLMPCAEHKLTICTPYFNLPAVLV
FT                   RNIIQLLRDGKKVEIIVGDKTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYVN
FT                   TDQLVVRLWKDDDNTYHLKGMWVDDKWMLLTGNNLNPRAWRLDLENAILIHDPKQELAP
FT                   QREKELELIRTHTTIVKHYRDLQSIADYPIKVRKLIRRLRRIRIDRLISRIL"
FT   gene            complement(296709..299369)
FT                   /locus_tag="t0259"
FT   CDS_pept        complement(296709..299369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0259"
FT                   /product="putative acyl-CoA synthetase"
FT                   /note="corresponds to STY2844 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67985"
FT                   /db_xref="GOA:Q8Z4J4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J4"
FT                   /protein_id="AAO67985.1"
FT                   /translation="MSQQGLEALLRPKSIAVIGASMKPHRAGYLMMRNLLAGGFNGPVL
FT                   PVTPAWKAVLGVMAWPDIASLPFTPDLAILCTNASRNLALLDALGAKGCKTCIILSAPT
FT                   SQHEELLASARHYKMRLLGPNSLGLLAPWQGLNASFSPVPIKQGKLAFISQSAAVSNTI
FT                   LDWAQQREMGFSYFIALGDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAAR
FT                   SASRNKPILVIKSGRSPAAQRLLNTSAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLS
FT                   HMRPLHGDRLMIISNGAAPAALALDELWSRNGKLATLSEETCLQLRQTLPAHIDIANPL
FT                   DLCDDASSEHYVKTLDILLASQDFDALMVIHSPSAAAPGTESAHALIETIKRHPRGKFV
FT                   TLLTNWCGEFSSQEARRLFSEAGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSN
FT                   LTSNTAEAHNLLQRAIAEGATSLDTHEVQPILHAYGLHTLPTWIASDSAEAVHIAEQIG
FT                   YPVALKLRSPDIPHKSEVQGVMLYLRTASEVQQAANAIFDRVKMAWPQARIHGLLVQSM
FT                   ANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEEQAVVALPPLNMNLARYLVIQGIK
FT                   QRKIRARSALRPLDIVGLSQLLVQVSNLIVDCPEIQRLDIHPLLASASEFTALDVTLDI
FT                   APFDGDNESRLAVRPYPHQLEEWVEMKNGDRCLFRPILPEDEPQLRQFIAQVTKEDLYY
FT                   RYFSEINEFTHEDLANMTQIDYDREMAFVAVRRMDNAEEILGVTRAISDPDNVDAEFAV
FT                   LVRSDLKGLGLGRRLMEKLIAYTRDHGLKRLNGITMPNNRGMVALARKLGFQVDIQLDE
FT                   GIVGLTLNLAKCDES"
FT   gene            complement(299423..300103)
FT                   /locus_tag="t0260"
FT   CDS_pept        complement(299423..300103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2843 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67986"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J5"
FT                   /protein_id="AAO67986.1"
FT                   /translation="MTNNAVLQLRAERLARATRPFLARGNRVRRCQRCLLPLKSCLCDT
FT                   LTPSQAKSRFCLVMFDTEPMKPSNTGRLIADILPDTAAFQWSRTEPPQALLELVQHPDY
FT                   QPIVVFPASYAGEAREVISTPPAGKPPLFIMLDGTWPEARKMFRKSPYLDHLPVISVDL
FT                   SRLSAYRLREIHAEGQYCTAEVAIALLDLAGDPEAATSLGEHFIRFKTRYLAGKTQHPG
FT                   NVTA"
FT   gene            complement(300176..300595)
FT                   /gene="yfiG"
FT                   /locus_tag="t0261"
FT   CDS_pept        complement(300176..300595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiG"
FT                   /locus_tag="t0261"
FT                   /product="thioredoxin 2"
FT                   /note="corresponds to STY2842 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67987"
FT                   /db_xref="GOA:Q8Z4J6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J6"
FT                   /protein_id="AAO67987.1"
FT                   /translation="MNTVCTHCQAINRIPGDRLQDAAKCGRCGHELFDGEVINATGETL
FT                   DKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNTEAERELSARFGI
FT                   RSIPMIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL"
FT   gene            300799..301836
FT                   /gene="yfiF"
FT                   /locus_tag="t0262"
FT   CDS_pept        300799..301836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiF"
FT                   /locus_tag="t0262"
FT                   /product="putative RNA methyltransferase"
FT                   /note="corresponds to STY2841 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67988"
FT                   /db_xref="GOA:Q8XFT1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFT1"
FT                   /protein_id="AAO67988.1"
FT                   /translation="MNDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPAKSRTD
FT                   GGRRPARDERNNQSRDRKHETSPWRTVSRAPGDETPEKVDHGGISGKSFIDPEVLRRQR
FT                   AEETRVYGENACQALFQSRPDAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELA
FT                   KASGTEHHGGVCFLIKKRNGTTVKQWVKQAADQDCVLALEDVANPHNLGGMMRSCAHFG
FT                   VKGVVVQDAALLESGAAIRTAEGGAEHVQPITGESIVDVLDDFRQAGYTVVTTSSDRGQ
FT                   ALFSTTLPEKMVLVLGREYDYLPEAAREPDDLCVKINGTGNVESLNVSVATGVLLAEWW
FT                   RQNKA"
FT   gene            complement(301952..302641)
FT                   /gene="ung"
FT                   /locus_tag="t0263"
FT   CDS_pept        complement(301952..302641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="t0263"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="corresponds to STY2840 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67989"
FT                   /db_xref="GOA:P67074"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67074"
FT                   /protein_id="AAO67989.1"
FT                   /translation="MATELTWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVF
FT                   NAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFV
FT                   RPAHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLL
FT                   WGSHAQKKGAIIDPQRHHILKAPHPSPLSAHRGFFGCNHFALTNQWLEQHGEKTIDWTP
FT                   VLPAESE"
FT   gene            302960..303343
FT                   /gene="yfiD"
FT                   /locus_tag="t0264"
FT   CDS_pept        302960..303343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiD"
FT                   /locus_tag="t0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2839 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67990"
FT                   /db_xref="GOA:Q8XFE0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFE0"
FT                   /protein_id="AAO67990.1"
FT                   /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKSGFAEDEVVA
FT                   VSKLGEIEYREIPMEVKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVIARTFTESL"
FT   gene            complement(303405..303992)
FT                   /gene="yfiK"
FT                   /locus_tag="t0265"
FT   CDS_pept        complement(303405..303992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiK"
FT                   /locus_tag="t0265"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2838 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67991"
FT                   /db_xref="GOA:Q8Z4J7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4J7"
FT                   /protein_id="AAO67991.1"
FT                   /translation="MTPMLLSAFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAG
FT                   MSLGFLVVMLLCAGIAFSLAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADEKVRPKP
FT                   VGFWVSFGLQFVNVKIILYGITALSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALA
FT                   GHLFQRAFRHYGRQLNIILALLLVYCAVRIFY"
FT   gene            304095..304977
FT                   /pseudo
FT                   /gene="yfiE"
FT                   /locus_tag="t0266"
FT                   /note="corresponds to STY2837 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(305010..306344)
FT                   /gene="srmB"
FT                   /locus_tag="t0267"
FT   CDS_pept        complement(305010..306344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="t0267"
FT                   /product="ATP-dependent RNA helicase SrmB"
FT                   /note="corresponds to STY2836 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67992"
FT                   /db_xref="GOA:Q8Z4J8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4J8"
FT                   /protein_id="AAO67992.1"
FT                   /translation="MTVTTFSELELDESLLDALQDKGFTRPTAIQAAAIPPALDGRDVL
FT                   GSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVADHARELAKHTH
FT                   LDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRML
FT                   DMGFAQDIEHIAGETRWRKQTMLFSATLEGDAIKDFAERLLEDPVEVSANPSTRERKKI
FT                   HQWYYRADNFEHKVALLKHLLKQDDATRSIVFVRKRERVHELAETLRLAGINNCYLEGE
FT                   MAQIKRNEGIKRLTDGRVNVLVATDVAARGIDIPDVSHVINFDMPRSGDTYLHRIGRTG
FT                   RAGRKGTAISLVEAHDHLLLLKIGRYIEEPLKARVIDELRPTTRAPSEKLTGKPSKKVL
FT                   AKRAEKKKEKEKEKPRVKKRYRDTKNIGKRRKPSGTKMQEQSSEE"
FT   gene            306474..307211
FT                   /gene="yfiC"
FT                   /locus_tag="t0268"
FT   CDS_pept        306474..307211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiC"
FT                   /locus_tag="t0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2835 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67993"
FT                   /db_xref="GOA:Q8Z4J9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4J9"
FT                   /protein_id="AAO67993.1"
FT                   /translation="MSQSGSVLRRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPVADV
FT                   KRILDIGTGSGLLALMLAQRTDDSVPVDAVELDAGAAMQAQENVAHSPWPHRITVHTDD
FT                   IQRWAPRQTVRFDLIISNPPYYEPGVECSTPQREQARYTATLDHQTLLAIAADCITEDG
FT                   FFCVVLPEQIGNAFTQQALNMGWHLRLRTDVAENEARLPHRVLLAFSPQAGECFSDRLV
FT                   IRGSDQNYSESYTALTQAFYLFM"
FT   gene            complement(307196..308818)
FT                   /gene="nadB"
FT                   /locus_tag="t0269"
FT   CDS_pept        complement(307196..308818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="t0269"
FT                   /product="L-aspartate oxidase"
FT                   /note="quinolinate synthetase B; corresponds to STY2834
FT                   from Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67994"
FT                   /db_xref="GOA:Q8Z4K0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4K0"
FT                   /protein_id="AAO67994.1"
FT                   /translation="MMTTPELSCDVLIIGSGAAGLSLALRLAEKHKVIVLSKGPVSEGS
FT                   TFYAQGGIAAVFDETDSIASHVEDTLIAGAGICDRHAVEFVASNARTCVQWLIDQGVLF
FT                   DTHVQPNGKESYHLTREGGHSHRRILHAADATGKEVETTLVSRAQNHPNIQVLERSNAV
FT                   DLIISDKIGLPGPRRVVGAWIWNRNKEWVETCHAKSVVLATGGASKVYQYTTNPDISSG
FT                   DGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGSRFMPDV
FT                   DERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPDDFVRQHFPMIYAKLLDLGMDLT
FT                   KEPIPIVPAAHYTCGGVVVDDYGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYG
FT                   WSAAMDIDRRMPSVHSVDVLPAWDESRVENADERVVIQHNWHELRLLMWDYVGIVRTTK
FT                   RLERALRRITMLQQEIDEYYANFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTL
FT                   DYPQQLAESGPSILSPLTPHINR"
FT   gene            309243..309818
FT                   /gene="rpoE"
FT                   /locus_tag="t0270"
FT   CDS_pept        309243..309818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="t0270"
FT                   /product="RNA polymerase sigma-E factor"
FT                   /note="sigma-24; corresponds to STY2833 from Accession
FT                   AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67995"
FT                   /db_xref="GOA:P0A2F1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2F1"
FT                   /protein_id="AAO67995.1"
FT                   /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGD
FT                   VPDVVQESFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAE
FT                   NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIM
FT                   DCPVGTVRSRIFRAREAIDNKVQPLIRR"
FT   gene            309850..310500
FT                   /gene="rseA"
FT                   /locus_tag="t0271"
FT   CDS_pept        309850..310500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseA"
FT                   /locus_tag="t0271"
FT                   /product="sigma-E factor negative regulatory protein"
FT                   /note="corresponds to STY2832 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67996"
FT                   /db_xref="GOA:Q8Z4K1"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K1"
FT                   /protein_id="AAO67996.1"
FT                   /translation="MQKEKLSALMDGETLDSELLKALTHDSEMQKTWESYHLIRDSMRG
FT                   DTPDVLHFDISARVMAAIENEPVRQVTPLIPEAQPAPQQWQKMPFWKKVRPWAAQLTQM
FT                   GVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEAAPVGSQQ
FT                   QQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ"
FT   gene            310500..311456
FT                   /gene="rseB"
FT                   /locus_tag="t0272"
FT   CDS_pept        310500..311456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseB"
FT                   /locus_tag="t0272"
FT                   /product="sigma-E factor regulatory protein RseB precursor"
FT                   /note="corresponds to STY2831 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67997"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K2"
FT                   /protein_id="AAO67997.1"
FT                   /translation="MKQLWFAMSLVAASLFFSVNASADPASGALLQQMNIASQSLNYEL
FT                   SFVSITKQGVESLRYRHARLDSRPLAQLLQLDGPRREVVQRGNEISYFEPGLEPFTLNG
FT                   DYIVDSLPSLIYTDFKRLAPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDMD
FT                   TKLPMRVDLLDRDGETLEQFRVIAFTVSQDIGSTMQALAKANLPPLLSVPGGEKTKFNW
FT                   NPSWVPQGFSEVSSSRRPLPTMDNLPIESRLYSDGLFSFSVNVNRATQNSSDQMLRTGR
FT                   RTVYSSVRDNAEITIVGELPPQTAKRIADSIKFRAVQ"
FT   gene            311453..311932
FT                   /gene="rseC"
FT                   /locus_tag="t0273"
FT   CDS_pept        311453..311932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseC"
FT                   /locus_tag="t0273"
FT                   /product="sigma-E factor regulatory protein RseC"
FT                   /note="corresponds to STY2830 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67998"
FT                   /db_xref="GOA:Q8Z4K3"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K3"
FT                   /protein_id="AAO67998.1"
FT                   /translation="MIKEWATVISWQNGQAVVSCDVKASCSSCASRAGCGSRVLNKLGP
FT                   QTTHTIVVPSAEPLAPGQKVELGIAEKSLLGSALLVYMSPLAGLFLCAALFQMLFGSDL
FT                   AALSGAVLGGVGGFLVARGYSRKLAERDAWQPVILNVALPPDLVRVETTSIETRQ"
FT   gene            312191..313990
FT                   /gene="lepA"
FT                   /locus_tag="t0274"
FT   CDS_pept        312191..313990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="t0274"
FT                   /product="GTP-binding protein LepA"
FT                   /note="corresponds to STY2829 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAO67999"
FT                   /db_xref="GOA:P0A1W5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1W5"
FT                   /protein_id="AAO67999.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLDFKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSA
FT                   KTGVGVTDVLERLVRDIPPPQGDPDGPLQALIIDSWFDNYLGVVSLVRIKNGTMRKGDK
FT                   IKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDILGAPVGDTLTSARNPA
FT                   EKALPGFKKVKPQVYAGLFPVSSDDYESFRDALGKLSLNDASLFYEPESSSALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTAKETIYVDSPSKLPPLNNIYEL
FT                   REPIAECHMLLPQAYLGNVITLCIEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRL
FT                   KSTSRGYASLDYNFKRFQASDMVRVDVLINNERVDALALITHRDNSQSRGRELVEKMKD
FT                   LIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRKKKLLQKQKEGKKRMK
FT                   QIGNVELPQEAFLAILHVGKDNK"
FT   gene            314007..314981
FT                   /gene="lepB"
FT                   /locus_tag="t0275"
FT   CDS_pept        314007..314981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="t0275"
FT                   /product="signal peptidase I"
FT                   /note="corresponds to STY2828 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68000"
FT                   /db_xref="GOA:P0A1W3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1W3"
FT                   /protein_id="AAO68000.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFVFAPKRRARQAAAQTASGDA
FT                   LDNATLNKVAPKPGWLETGASVFPVLAIVLIVRSFLYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKITYDPVAK
FT                   EVTIQPGCSSGQACENALPVTYSNVEPSDFVQTFARRNGGEATSGFFEVPLNETKENGI
FT                   RLTERKETLGDVTHRILMVPIAQDQLGMYYQQPGQPLATWVVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGKAVAIWMSFDKQEGEWPTGVRLSRIGGIH"
FT   gene            315255..315935
FT                   /gene="rnc"
FT                   /locus_tag="t0277"
FT   CDS_pept        315255..315935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="t0277"
FT                   /product="ribonuclease III"
FT                   /note="corresponds to STY2827 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68001"
FT                   /db_xref="GOA:Q8Z4K4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4K4"
FT                   /protein_id="AAO68001.1"
FT                   /translation="MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGD
FT                   SILSFVIANALYHRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSG
FT                   GFRRESILADTVEALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEY
FT                   LQGRHLPLPSYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK
FT                   LELE"
FT   gene            315932..316837
FT                   /gene="era"
FT                   /locus_tag="t0276"
FT   CDS_pept        315932..316837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="t0276"
FT                   /product="GTP-binding protein"
FT                   /note="corresponds to STY2826 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68002"
FT                   /db_xref="GOA:Q8Z4K5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4K5"
FT                   /protein_id="AAO68002.1"
FT                   /translation="MSTDKTYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGPYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGMNVD
FT                   TIASIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   TNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
FT   gene            316849..317577
FT                   /gene="recO"
FT                   /locus_tag="t0278"
FT   CDS_pept        316849..317577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="t0278"
FT                   /product="DNA repair protein RecO"
FT                   /note="corresponds to STY2825 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68003"
FT                   /db_xref="GOA:P0A286"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A286"
FT                   /protein_id="AAO68003.1"
FT                   /translation="MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSN
FT                   LKGALQPFTPLLLRYSGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYET
FT                   RFSELFFDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMT
FT                   YRYREEKGFFASVVIDNNTFTGRHLKALEAREFPDVDTLRAAKRFTRMALKPYLGGKPL
FT                   KSRELFRQFMPKRTVKTKKD"
FT   gene            317589..318320
FT                   /gene="pdxJ"
FT                   /locus_tag="t0279"
FT   CDS_pept        317589..318320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="t0279"
FT                   /product="putative pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /note="corresponds to STY2824 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68004"
FT                   /db_xref="GOA:Q8Z4K6"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4K6"
FT                   /protein_id="AAO68004.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHITDRDVRILRQTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQRDKMRDACARLAAAGIQVSLFIDADERQINAAAEVGAPFIEIHTGCYANAE
FT                   TDAEQAKELARIASAATLAARLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRA
FT                   VMTGLKEAVAEMKRLMLEARG"
FT   gene            318320..318700
FT                   /gene="acpS"
FT                   /locus_tag="t0280"
FT   CDS_pept        318320..318700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="t0280"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /note="corresponds to STY2823 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68005"
FT                   /db_xref="GOA:P63467"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63467"
FT                   /protein_id="AAO68005.1"
FT                   /translation="MAILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIWETHQQ
FT                   PVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALTLAEKLGV
FT                   AHMHVTLADERHYACATVILES"
FT   gene            complement(318812..319072)
FT                   /locus_tag="t0281"
FT   CDS_pept        complement(318812..319072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0281"
FT                   /product="putative ferredoxin"
FT                   /note="corresponds to STY2822 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68006"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K7"
FT                   /protein_id="AAO68006.1"
FT                   /translation="MALLITKKCINCDMCEPECPNEAISMGDSIYEINSDKCTECVGHY
FT                   ETPTCQKVCPIPNTILQDPAHVETEEQLWDKFVLMHHADKL"
FT   gene            complement(319125..320036)
FT                   /locus_tag="t0282"
FT   CDS_pept        complement(319125..320036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0282"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2821 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68007"
FT                   /db_xref="GOA:Q8Z4K8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K8"
FT                   /protein_id="AAO68007.1"
FT                   /translation="MNIKQLHSFLILCDELHYGRAASRLFITQPSLSQQIKQLESSLKT
FT                   ILFKRKGRGIKLTKAGIILQRHANKIMLDLKNAENELLPYQDQQRDTISIGVSGSYLVL
FT                   PAFRNFMAHHPEISLNVKEFSTEQTIKKLTDSAVDIGIVYRTALPAQLSSTMLFEDEII
FT                   AAIPLSHPLATRERLHLKDLNDQPIIVLNDSLLLRGIITTEFNNRKVVPNVICELDNHY
FT                   SCLEYAEAQIGIAFITRSLTHLSTPKNVRLVSLGIPAFFIPVMLVHSNDLSLDNATICL
FT                   LKQIKNFYTVDNKSAPEKSWPE"
FT   gene            320152..321348
FT                   /locus_tag="t0283"
FT   CDS_pept        320152..321348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0283"
FT                   /product="putative transmembrane transport protein"
FT                   /note="corresponds to STY2820 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68008"
FT                   /db_xref="GOA:Q8Z4K9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4K9"
FT                   /protein_id="AAO68008.1"
FT                   /translation="MSASINRWGMLAAHVCINFVLGGVYAFSYFKTPLMAQYHWDPATP
FT                   ALAFSINMGIIPLPMIWGGRMIDNGKGKQAIVIGGILFSLGFILSGFVDNLPMLFLTYG
FT                   VIAGLGSGLAFTGNLNNILKFFPDRRGLASGIVLAGVGVGTLLCTRLAEYFMAQTHDVS
FT                   RALLYLGIVYLVVIFIVQFFIRSAPAKDSGGIKASPLDKDYRHMLKDLRFWLLFMILAL
FT                   GVFSGMVISSSSAQIGMTQYGLLSGALVVSLVSIFNSIGRLFWGGLTDKLGGYNTLVIV
FT                   YLFTCVCMLLLLFFNGNTSVFYFSALGVGFAYAGILVIFLGLTSQNFGMRNQGLNYGFM
FT                   YFGFAVGAVIAPYVTSAIAKYTGSYNTVFILTTVLLLIGVVLTLITKKYVATVLAKIH"
FT   gene            321370..322287
FT                   /locus_tag="t0284"
FT   CDS_pept        321370..322287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0284"
FT                   /product="putative oxidoreductase"
FT                   /note="corresponds to STY2819 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68009"
FT                   /db_xref="GOA:Q8Z4L0"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4L0"
FT                   /protein_id="AAO68009.1"
FT                   /translation="MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLF
FT                   VETETTQKYYPIPAMLADESQGEFELVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNG
FT                   LGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMATGTGTIELQPIASQDSAQEAKVIA
FT                   TLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRPGALDLAQAVVDE
FT                   FVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIARI
FT                   GAQNNIAVPVNTLLTQLIHAKEAQ"
FT   gene            complement(322326..323174)
FT                   /gene="yfhH"
FT                   /locus_tag="t0285"
FT   CDS_pept        complement(322326..323174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhH"
FT                   /locus_tag="t0285"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2818 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68010"
FT                   /db_xref="GOA:Q8Z4L1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4L1"
FT                   /protein_id="AAO68010.1"
FT                   /translation="MNCLIRIRQRYPDLAQSDRKLADYLLAQPDTARHLSSQQLAAEAG
FT                   VSQSSVVKFAQKLGFKGFPALKLAISEALASNPNPHSVPVHNQIRGDDPMRLVGEKLIK
FT                   ENVAAMHATLDVNSEEKLLESVTMLRHARRIVITGIGASGLVAQNFAWKLLKIGINAVV
FT                   ERDMHALLATVQALAPEDLLLAISYSGERRELNLAADETLRAGAKILAITGFSPNALQQ
FT                   RATRCLYTIAEEQATRSAAISSTHAQMMLTDLLFMALVQQDLERAPERIRHSEALVKKL
FT                   V"
FT   gene            323290..324183
FT                   /locus_tag="t0286"
FT   CDS_pept        323290..324183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0286"
FT                   /product="putative phophosugar binding protein"
FT                   /note="corresponds to STY2817 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68011"
FT                   /db_xref="GOA:Q8Z4L2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4L2"
FT                   /protein_id="AAO68011.1"
FT                   /translation="MNLGTLVSETRNPQTMDLDALSTPELVKRFNEQDTLVAEAVKATL
FT                   PDVARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPG
FT                   ALLKAVEGAEDSQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYARQSGCTTVA
FT                   VSCNPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQN
FT                   LMVDMKATNVKLVDRACRMVVEATGIGREEAETLLKQTDFEVKPAILMALTGLDAAAAR
FT                   EKLAAHQGFLRAALEH"
FT   gene            324194..325555
FT                   /locus_tag="t0287"
FT   CDS_pept        324194..325555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0287"
FT                   /product="putative IIBC component of PTS system"
FT                   /note="corresponds to STY2816 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68012"
FT                   /db_xref="GOA:Q83T81"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T81"
FT                   /protein_id="AAO68012.1"
FT                   /translation="MDKTAALASDILRGIGGEQNILRLENCMTRVRVEVQDDSQLDIPR
FT                   LKALPGVSGYVKQGEQHQLIVGPGKAAQVVDAMRVQIAAGGVKPDDAMARTKSEAKAKY
FT                   KAPMSDALRKLANVFIPLIPAFIASGLITGIINILKRPDIVGDVAVHYPNLLGLMGIFG
FT                   SAVFAIMNILVGVNTAKVFGGSQALGGVMAGILSSPQLAQITLFGEALQPGRGGVIAVL
FT                   LVVALMCWIERQFRKLLPGSLELILNPLLTTVITGAVAIVALQPLGGWISDAIAHGASW
FT                   AIDRGGFLVGAVLAGTFLPLVLIGLHQGLVPIHVELVQAHGYNALFPILAMAGVGQIGA
FT                   AIAVLMKTRNARLKKVIKGALPVGLLGIGEPLIFGVTLPLGKPFIGACLGGAVGGALIS
FT                   YWKVATVITFGISGLPLALTIVAGKVLFYLLGYLIAVIAGFIFTWLLGFNDPEE"
FT   gene            325559..326194
FT                   /gene="yfhB"
FT                   /locus_tag="t0288"
FT   CDS_pept        325559..326194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhB"
FT                   /locus_tag="t0288"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2815 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68013"
FT                   /db_xref="GOA:Q8Z4L4"
FT                   /db_xref="InterPro:IPR006435"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4L4"
FT                   /protein_id="AAO68013.1"
FT                   /translation="MVSHERRVVFFDLDGTLYQQDMFGSFLRYLLRRQPLNALLVLPLL
FT                   PIIGIGLLVKGRAARWPMSLLLWGCTFGHSETRLQAHQADFVRWFRANVTAFPVVQERL
FT                   TTYLLSSDADIWLITGSPQSLVEQVYFDTPWLPRVNLIASQMARRYGGWVLTVRCLGHE
FT                   KVAQLERKIGTPLRLYSGYSDSKQDNPLLYFCQHRWRVTPHGELQQLE"
FT   gene            326219..326770
FT                   /gene="yfhC"
FT                   /locus_tag="t0289"
FT   CDS_pept        326219..326770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhC"
FT                   /locus_tag="t0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2814 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68014"
FT                   /db_xref="GOA:Q8XGY4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XGY4"
FT                   /protein_id="AAO68014.1"
FT                   /translation="MPPAFITGVTSLSDVELDHEYWMRHALTLAKRAWDEREVPVGAVL
FT                   VHNHRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGA
FT                   MVHSRIGRVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLLSDFFRMR
FT                   RQEIKALKKADRAEGAGPAV"
FT   gene            complement(326938..328365)
FT                   /gene="yfhD"
FT                   /locus_tag="t0290"
FT   CDS_pept        complement(326938..328365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhD"
FT                   /locus_tag="t0290"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2813 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68015"
FT                   /db_xref="GOA:Q8Z4L5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4L5"
FT                   /protein_id="AAO68015.1"
FT                   /translation="MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVL
FT                   RVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADL
FT                   LAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVND
FT                   LQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALD
FT                   VTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFL
FT                   RAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQS
FT                   LGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTV
FT                   KTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEK
FT                   EKQEAEAMKLAQDYPAV"
FT   gene            328621..332508
FT                   /gene="purL"
FT                   /locus_tag="t0291"
FT   CDS_pept        328621..332508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="t0291"
FT                   /product="phosphoribosylformylglycineamide synthetase"
FT                   /note="corresponds to STY2812 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68016"
FT                   /db_xref="GOA:Q8Z4L6"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4L6"
FT                   /protein_id="AAO68016.1"
FT                   /translation="MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNA
FT                   PLNDSEQAQLTRLLQYGPALSSHTLAGKLLLVTPRPGTISPWSSKATDIAHNCGLQQID
FT                   RLERGVAYYIEASTLTAEQWRQVAAELHDRMMETVFSSLTDAEKLFIHHQPAPVSSVDL
FT                   LGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGCNPNDIELYMFAQANSEHCRHKIF
FT                   NADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
FT                   FHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   RIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEEKVNSH
FT                   NGEELRGYHKPIMLAGGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGLGGGAASSMAS
FT                   GQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVS
FT                   DGGRGGKFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAV
FT                   IGDATEEQHLSLHDNHFDNQPIDLPLDVLLGKTPKMTRDVQTLKAKGDALNRADITIAD
FT                   AVNRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEA
FT                   MSIGERAPVALLDFAASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGL
FT                   YDAVKAVGEELCPQLGLTIPVGKDSMSMKTRWQEGNEQREMTSPLSLVISAFARVEDVR
FT                   HTLTPQLSTEDNALLLIDLGKGHNALGATALAQVYRQLGDKPADVRDVAQLKGFYDAMQ
FT                   VLVAARKLLAWHDRSDGGLLVTLAEMAFAGHCGVQVDIAALGDDHLAALFNEELGGVIQ
FT                   VRAEDRDAVETLLAQYGLADCVHYLGQALAGDRFVITANDRTVFSESRTTLRVWWAETT
FT                   WQMQRLRDNPQCADQEHEAKANDADPGLNVKLSFDINEDIAAPYIATGARPKVAVLREQ
FT                   GVNSHVEMAAAFHRAGFDAIDVHMSDLLGGRIGLGNFHALVACGGFSYGDVLGAGEGWA
FT                   KSILFNHRVRDEFETFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVRNHSDRFE
FT                   ARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDDAHLAALESKGLVALRYVDN
FT                   FGKVTETYPANPNGSPNGITAVTTENGRVTIMMPHPERVFRTVANSWHPENWGEDSPWM
FT                   RIFRNARKQLG"
FT   gene            333203..334588
FT                   /locus_tag="t0292"
FT   CDS_pept        333203..334588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0292"
FT                   /product="putative sensor kinase protein"
FT                   /note="corresponds to STY2811 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68017"
FT                   /db_xref="GOA:Q8Z4L7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4L7"
FT                   /protein_id="AAO68017.1"
FT                   /translation="MLAFLLILLPLLVLAWQAWQSLNALSDQAAVTNRSTLIDARRSEA
FT                   MTNVALEMERSYRQYCVLDDPTLAKVYQSQRKRYSDMLDAHAGVLPDDKLYQALRQDLN
FT                   ALAQLQCKDSGPEAAAAARLEAFANANTEMVQATRTVVYSRGQQLQQEIAERGQFFGWQ
FT                   ALVLFLVSLAMVLLFTRMIIGPVKGIERMINRLGEGRSLGNTVTFTGPRELRSVGQRII
FT                   WLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVDILDD
FT                   SSRNLQKLIEQLLDYNRKLVDSATELEAVDIAPLVDMVVSAHSLPARAKMMHTDVDLEA
FT                   ERCIAEPMLLMSVLDNLYSNAVHYGAESGNICIRSRSQGSTVYIDVVNSGEPIPQTERE
FT                   MIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGEIQLVDDKAQEVCFRISLPLPAS
FT                   DKH"
FT   gene            334590..335354
FT                   /gene="yfhG"
FT                   /locus_tag="t0294"
FT   CDS_pept        334590..335354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="t0294"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2810 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68018"
FT                   /db_xref="InterPro:IPR025262"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T80"
FT                   /protein_id="AAO68018.1"
FT                   /translation="MNLSLVRMSHVFVQTIKRCLLRWGIPVGISCLALTACVPHASQQL
FT                   PGSAAQDTLPHYQLADYLPTACADIWSLRGQAVETNPLYWLRTIDCADRLMPVQSRAEA
FT                   RALTDDNWQNAFRRGILLADAKITPPERRAIVTRLEALSAQIPAQVRPVYQIWHDGQAL
FT                   QLALSAERQRYSKLQQTSDSELDALRQQQQALQTQLDLTTRKLESLTDIERQLSTRKPA
FT                   GNYNADTPHTNDKPATSEDGAAPSPSQDEVTP"
FT   gene            335351..336688
FT                   /gene="yfhA"
FT                   /locus_tag="t0293"
FT   CDS_pept        335351..336688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhA"
FT                   /locus_tag="t0293"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2809 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68019"
FT                   /db_xref="GOA:Q8Z4L9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4L9"
FT                   /protein_id="AAO68019.1"
FT                   /translation="MISRKPAHLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEGLRV
FT                   LHREKVDLVISDLRMDEMDGMQLFTEIQKVQPGMPVIILTAHGSIPDAVAATQKGVFSF
FT                   LTKPIDRDALYKAIDEALEQSAPATDDSWRNAIVTRSPLMLRLLEQARMVAQSDVSVLI
FT                   NGQSGTGKEIFAQAIHNASPRNNKPFVAINCGALPEQLLESELFGHARGAFTGAVSNRE
FT                   GLFQAAEGGTLFLDEIGDMPAPLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDL
FT                   PKAMARGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLRQSAQRHKPFVRAFSTD
FT                   AMKRLMTASWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTFAEARNQF
FT                   ELNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
FT   gene            336765..337103
FT                   /gene="glnB"
FT                   /locus_tag="t0295"
FT   CDS_pept        336765..337103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="t0295"
FT                   /product="nitrogen regulatory protein p-II"
FT                   /note="corresponds to STY2808 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68020"
FT                   /db_xref="GOA:P0A9Z5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9Z5"
FT                   /protein_id="AAO68020.1"
FT                   /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRT
FT                   GEEDDAAI"
FT   gene            complement(337152..338612)
FT                   /locus_tag="t0296"
FT   CDS_pept        complement(337152..338612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0296"
FT                   /product="putative transmembrane transport protein"
FT                   /note="corresponds to STY2807 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68021"
FT                   /db_xref="GOA:Q8Z4M0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M0"
FT                   /protein_id="AAO68021.1"
FT                   /translation="MKTPSQPRAIFYIVAIQIWEYFSFYGMRALLILYLTHQLGFNDSH
FT                   AINLFSAYASLVYVTPILGGWLADRLLGNRVAVITGALLMTLGHVVLGLESDSTLSLYA
FT                   ALAIIICGYGLFKSNISCLLGELYAPDDNRRDGGFSLLYAAGNIGSIAAPIACGLAAQW
FT                   YGWHVGFALAGVGMFIGLLIFLSGHRHFQQTRGVNRPALRAVKFALPTWGWLVLMLCIA
FT                   PVFFTLLLENNWSGYVLAIVCVFAAQLIARIMVKFPEHRRALWQIVLLMITGTLFWVLA
FT                   QQGGSSISLFIDRFVNRHWLNMTVPTALFQSVNAIAVMAAGVVLAWLSSPKESARSVLR
FT                   VWLKFAVGLILMGGGFMLLALNAHQARLDGQASMGMMIAGLALMGFAELFIDPVAMAQI
FT                   TRLNLPGVTGVLTGIYMLATGAIANWLAGVVAQQTTESQISDTAVAAYGHFFSQMSEWT
FT                   LSCVALIVAIVGLRWICTRTTSALPQGD"
FT   gene            complement(338668..340812)
FT                   /gene="cadA"
FT                   /locus_tag="t0297"
FT   CDS_pept        complement(338668..340812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="t0297"
FT                   /product="lysine decarboxylase"
FT                   /note="corresponds to STY2806 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68022"
FT                   /db_xref="GOA:P0A1Z1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Z1"
FT                   /protein_id="AAO68022.1"
FT                   /translation="MNVIAIMNHMGVYFKEEPIRELHRALEGLNFRIVYPNDREDLLKL
FT                   IENNSRLCGVIFDWDKYNLELCEEISKLNEYMPLYAFANSYSTLDVSLNDLRMQVRFFE
FT                   YALGAAADIAAKIRQNTDEYIDNILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSIFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTST
FT                   ANKIVGMYSAPAGSTVLIDRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDYIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYQGKCGMSGDRVEGKIIYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLKSESDGWFFDVWQPEH
FT                   IDGAECWPLRSDSAWHGFKNIDNEHMYLDPIKVTILTPGMKKDGTMDEFGIPASLVAKY
FT                   LDERGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTEFKRAFDLNLRVKNILPALYRE
FT                   APEFYENMRIQELAQNIHKLVEHHNLPDLMYRAFEVLPKMVMTPYTAFQKELHGETEEV
FT                   YLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKENTK"
FT   gene            complement(340895..342226)
FT                   /gene="cadB"
FT                   /locus_tag="t0298"
FT   CDS_pept        complement(340895..342226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadB"
FT                   /locus_tag="t0298"
FT                   /product="probable cadaverine/lysine antiporter"
FT                   /note="corresponds to STY2805 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68023"
FT                   /db_xref="GOA:Q8Z4M1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M1"
FT                   /protein_id="AAO68023.1"
FT                   /translation="MSSVKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWVI
FT                   SIIGAMSLAYVYARLATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPALNNPIPAGIACIAIVWLFTFINMLGGAWVSRLTTIGLFLVLIPVVLTAV
FT                   AGWHWFAIATYHANWNTSTTTDSHAIVKSILLCLWAFVGVESAAVSTGMVKNPKRTVPL
FT                   ATMLGTALAGIIYIAATQVIAGMFPASVMASSGAPFAISTSTILGGWAAPLVSAFTAFA
FT                   CLTSLGSWMMLVGQAGVRAANDGNFPKIYGEMDKNGIPKKGLLLAAVKMTALMILITIM
FT                   NSSGGKASDLFGELTGIAVLLTMLPYFYSCVDLIRFEGFNIRNSVSLICSVLGCAFCFI
FT                   ALMGASSFELSGTFIVSLIILMFYGRKMHQRQNNDSDNNTAEAL"
FT   gene            complement(342575..344119)
FT                   /gene="cadC"
FT                   /locus_tag="t0299"
FT   CDS_pept        complement(342575..344119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadC"
FT                   /locus_tag="t0299"
FT                   /product="transcriptional activator CadC"
FT                   /note="corresponds to STY2804 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68024"
FT                   /db_xref="GOA:Q8Z4M2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040970"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M2"
FT                   /protein_id="AAO68024.1"
FT                   /translation="MQQPVVRIGEWLVTPSVNQISRQGRQITLEPRLIDLLMYFAHHPD
FT                   EVLSRDNIIDHVWMRTIVTNHVVTQSISELRKSLRDGGDSNAEYIVTVPKRGYKLTAPV
FT                   IWCEENSDEIDNLSTSPPPPIAATNAEPTEGVPAAAPVPPASLQTPTKKAKKPRIAAFW
FT                   TWVMFLLSLATLVVFIVMSVVDHNAAVTKTRLLLNPRDIDVRFEGGNSCNNWVSQESYA
FT                   IGLGGLITDLLNTYSTFMVHDKTNYRVNEPSNSGKTLTIQFVNQRHYRAQQCFMSVVLI
FT                   DNADGSTMLDKRYFVTNTNQLSIQDDLFNSLSFVLTQPWPNRMREQLALFRTPQNTALM
FT                   RFYEARQLILSGDAQALSKAGDILNGIIKETPDFNYAYEYKVLVDVLRQSQQPFDKEQV
FT                   AALNEEFKKIDQIPGVEKTSVYYKIKTVDLLGKGDIDAAYEEINKSIELEMSWFNYVLL
FT                   GKVYEMKGENRLAADAYLTAFNLRPGENTLYWIENGVFQTSVQKIVPYLNSFLAED"
FT   gene            complement(344300..345490)
FT                   /gene="hmpA"
FT                   /locus_tag="t0300"
FT   CDS_pept        complement(344300..345490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmpA"
FT                   /locus_tag="t0300"
FT                   /product="flavohemoprotein"
FT                   /note="haemoglobin-like protein; corresponds to STY2803
FT                   from Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68025"
FT                   /db_xref="GOA:Q8Z4M3"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4M3"
FT                   /protein_id="AAO68025.1"
FT                   /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM
FT                   SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLA
FT                   TLDEMFNPGQEVLDAWGKAYGVLANVFIHREAEIYHENASKDGGWEGTRPFRIVAKTPR
FT                   SALITSFEFEPVDGGTVAEYRPGQYLGVWLKPEGFAHQEIRQYSLTRKPDGKGYRIAVK
FT                   REDGGQVSNWLHHHANVGDVVHLAAPAGDFFMNVAADTPVSLISAGVGQTPMLAMLDTL
FT                   AKEQHTAQVNWFHAAENGDVHAFADEVSELGRTLPRFTAHTWYREPTEADRAQRVFDSE
FT                   GLMDLSKLEAAISDPAMQFYLCGPVGFMQFAAKQLVSLGVNNENIHYECFGPHKVL"
FT   gene            345815..347068
FT                   /gene="glyA"
FT                   /locus_tag="t0301"
FT   CDS_pept        345815..347068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="t0301"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="corresponds to STY2802 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68026"
FT                   /db_xref="GOA:P0A2E2"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2E2"
FT                   /protein_id="AAO68026.1"
FT                   /translation="MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQ
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFA
FT                   VYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAK
FT                   EHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHV
FT                   VTTTTHKTLAGPRGGLILAKGGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAME
FT                   PEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRA
FT                   NITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATI
FT                   ERVKAKVLDICARFPVYA"
FT   gene            347253..348392
FT                   /gene="hcaT"
FT                   /locus_tag="t0302"
FT   CDS_pept        347253..348392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaT"
FT                   /locus_tag="t0302"
FT                   /product="putative 3-phenylpropionate permease"
FT                   /note="corresponds to STY2801 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68027"
FT                   /db_xref="GOA:Q9EZ24"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EZ24"
FT                   /protein_id="AAO68027.1"
FT                   /translation="MALHSTRWLALSYFTYFFSYGIFLPFWSVWLKGLGLTPETIGLLL
FT                   GVGLVARFLGSLLIAPRVSDPSRLISALRVLALLTLVFALAFWAGTHVAWLMVVMVGFN
FT                   LFFSPLVPLTDALANTWQKQITLDYGRVRLWGSIAFVIGSALTGKLVSLYDYQAILALL
FT                   TLGVASMLLGMLLRPSVPPQGESRQQESAGWPAWRTLVAQSWRFLACVCLLQGAHAAYY
FT                   GFSAIYWQGAGYSASAVGYLWSLGVVAEVIIFALSKKLFRRFSARDLLLLSAVCGVVRW
FT                   GLMGWSTALPWLIVIQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIA
FT                   IMTVFAGFLYQHLGGGVFWIMALVALPAIFLRPKVVAAS"
FT   gene            complement(348387..349664)
FT                   /gene="csiE"
FT                   /locus_tag="t0303"
FT   CDS_pept        complement(348387..349664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csiE"
FT                   /locus_tag="t0303"
FT                   /product="stationary phase inducible protein CsiE"
FT                   /note="corresponds to STY2800 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68028"
FT                   /db_xref="GOA:Q8Z4M4"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M4"
FT                   /protein_id="AAO68028.1"
FT                   /translation="MMPTIAPPSVLSAPQRRCQVLLTLFQPEPIATVEIFSALNGVDDD
FT                   TAREDITDTSLEIQRYHRLAITTCQNGCYRIEGTALDQRLCLLHWLRRGLRLCPTFVTQ
FT                   QFTPALKNALKQRGIARPLYDDINLHALINLCARRLQKPFEHRDVQFLRLFLQYCLLQH
FT                   HAGITPEFNPVQQIWAQSCAEYPLAQEIGRHWQRHVMQAAPLNEALFMALLFSMIRLPD
FT                   PIRDTHQRAQQLRLEVARLVLRFREKGNVRFSDEQGLNDQLYVHLAQALNRSLFTIGID
FT                   NTLPEEFNRLYPRLVRTTREALAGFEAEYGIHFSEEETGLVAVIFGAWLMQDNDLHERQ
FT                   IVLLADKNDALETHIEQQLRELTLLPLNIRRISLQAFQKEGCPRGVALIVTPYATPLPL
FT                   FSPPLIHADRALTEHQQQQIRKILES"
FT   gene            349790..350428
FT                   /locus_tag="t0304"
FT   CDS_pept        349790..350428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0304"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2799 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68029"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M5"
FT                   /protein_id="AAO68029.1"
FT                   /translation="MKPVKRSALILFLAVLSFVAAAHPHSFIRLQTQVVSENEQFVALK
FT                   MRWTMDALTSADLLYDAGNAAPGSEIWKKLAAEVMANVLGQHYFTEVWRNGAKVKFKNR
FT                   PTEYGMTRDAHQAVLTFTLPLAEPQPLSGQTYTFSTFDPSYYVDMHYDQDSDITMPEPL
FT                   REKCRIQVYTPAPGEETLRFAQSLDKEDAPPEDMDLGKQFAQTVTLQCQ"
FT   gene            350476..351404
FT                   /pseudo
FT                   /locus_tag="t0305"
FT                   /note="corresponds to STY2797 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(351405..352418)
FT                   /gene="asrC"
FT                   /locus_tag="t0306"
FT   CDS_pept        complement(351405..352418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asrC"
FT                   /locus_tag="t0306"
FT                   /product="anaerobic sulfite reductase subunit C"
FT                   /note="corresponds to STY2796 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68030"
FT                   /db_xref="GOA:P0A1Y3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR014261"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Y3"
FT                   /protein_id="AAO68030.1"
FT                   /translation="MSIDIDIIKARAKNEYRLSKVRGEAMISVRIPGGILPAHLLTVAR
FT                   DIAETWGNGQIHLTTRQKLAMPGIRYEDIDNVNAALEPFLREIEIELCDVQVEDTKAGY
FT                   LAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPNDCAKASMA
FT                   DLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCGECVLAC
FT                   PTLAWQRKPDQLWQVRLGGRTSKKTPRVGKLFLNWVTEDVIKQVIVNLYEFEKEMLGGK
FT                   PIYLHMGHLIDKGGYLRFKERVLRGVQLNPEAMVAERIYWAEDESVARMHLKPAGH"
FT   gene            complement(352429..353247)
FT                   /gene="asrB"
FT                   /locus_tag="t0307"
FT   CDS_pept        complement(352429..353247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asrB"
FT                   /locus_tag="t0307"
FT                   /product="anaerobic sulfite reductase subunit B"
FT                   /note="corresponds to STY2795 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68031"
FT                   /db_xref="GOA:Q8Z4M6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR014260"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M6"
FT                   /protein_id="AAO68031.1"
FT                   /translation="MSHCSCHDKPQHSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWG
FT                   QFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGKVTSALFTLKEGDNVWLRGCYGNGYP
FT                   VDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATW
FT                   HGKHNLVLTLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQ
FT                   KGLKPEQIWVDYERRMACSVGKCGHCRMGEVYVCTDGPIFNYAVAQRFAD"
FT   gene            complement(353251..354294)
FT                   /gene="asrA"
FT                   /locus_tag="t0308"
FT   CDS_pept        complement(353251..354294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asrA"
FT                   /locus_tag="t0308"
FT                   /product="anaerobic sulfite reductase subunit A"
FT                   /note="corresponds to STY2794 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68032"
FT                   /db_xref="GOA:Q8Z4M7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014259"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M7"
FT                   /protein_id="AAO68032.1"
FT                   /translation="MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQR
FT                   ISGWRDLIWHEKSHMSPNTIIAPITETLFYFDKNTIQIAETDTSPIIIFARACDINAMS
FT                   RLDYMYLSNGNNSDYSYQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSD
FT                   EGALVSIRDPFIEAAIQGLGQEADYTPSFVSENRETVVTPDSVCRDPQKIRDILTRHPL
FT                   WDAYDSRCISCGRCTTGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGH
FT                   GFREKPGERLRYRALHKVNDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVR
FT                   QALAEEA"
FT   gene            complement(354476..355354)
FT                   /locus_tag="t0309"
FT   CDS_pept        complement(354476..355354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0309"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2793 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68033"
FT                   /db_xref="GOA:Q8Z4M8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4M8"
FT                   /protein_id="AAO68033.1"
FT                   /translation="MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPT
FT                   PAEAESITFTAKDGTHLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSWLPER
FT                   NVNLFMFDYRGFGESEGTPSQEGLLNDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVL
FT                   AAVGHCVGCANMRYADQAGIRAIVLDSTFSSYSSIANQMIPGSGYLLDDRYSADRNIAS
FT                   VSPIPVLILHGTADHVIPWQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAM
FT                   INFIQTALSAK"
FT   gene            complement(355499..356302)
FT                   /gene="suhB"
FT                   /locus_tag="t0310"
FT   CDS_pept        complement(355499..356302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="t0310"
FT                   /product="extragenic suppressor protein SuhB"
FT                   /note="corresponds to STY2792 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68034"
FT                   /db_xref="GOA:Q8Z4M9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4M9"
FT                   /protein_id="AAO68034.1"
FT                   /translation="MHPMLTIAVRAARKAGNVIAKNYETPDAAEASQKGSNDFVTNVDK
FT                   AAEAVIIDTIRKSYPQHTIITEESGEHVGTDQDVQWVIDPLDGTTNFIKRLPHFSVSIA
FT                   VHIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQ
FT                   YATTYINIIGKLFTECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVRE
FT                   AGGIVSDFTGGHNYMMTGNIVAGNPRVVKAMLANMRDELSDALKR"
FT   gene            356421..357152
FT                   /locus_tag="t0311"
FT   CDS_pept        356421..357152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0311"
FT                   /product="putative RNA methyltransferase"
FT                   /note="corresponds to STY2791 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68035"
FT                   /db_xref="GOA:P66975"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66975"
FT                   /protein_id="AAO68035.1"
FT                   /translation="MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQ
FT                   AIALAAGASDVIGNAQIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEA
FT                   ANTPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLAT
FT                   QENGDAADHEETPYPLVDDLERFYGHLEQTLLSTGFIRENHPGQVMNKLRRLFTRARPE
FT                   SQELNILRGILASIEQQNKGK"
FT   gene            357394..357888
FT                   /gene="yfhP"
FT                   /locus_tag="t0312"
FT   CDS_pept        357394..357888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhP"
FT                   /locus_tag="t0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2790 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68036"
FT                   /db_xref="GOA:Q8XF25"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XF25"
FT                   /protein_id="AAO68036.1"
FT                   /translation="MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQL
FT                   FSRLRKNGLVSSVRGPGGGYLLGKDAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKC
FT                   LTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHTHDAPRASGRAQDAIDVKLR
FT                   A"
FT   gene            358069..359283
FT                   /locus_tag="t0313"
FT   CDS_pept        358069..359283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0313"
FT                   /product="putative L-cysteine desulfurase"
FT                   /note="corresponds to STY2789 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68037"
FT                   /db_xref="GOA:Q8Z4N0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4N0"
FT                   /protein_id="AAO68037.1"
FT                   /translation="MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGW
FT                   QAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEH
FT                   KAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDI
FT                   ATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKP
FT                   RIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGI
FT                   KDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSATLEPSYVLR
FT                   ALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSI
FT                   EWAHH"
FT   gene            359311..359697
FT                   /gene="nifU"
FT                   /locus_tag="t0314"
FT   CDS_pept        359311..359697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="t0314"
FT                   /product="NifU-like protein"
FT                   /note="corresponds to STY2788 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68038"
FT                   /db_xref="GOA:Q8XFG9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFG9"
FT                   /protein_id="AAO68038.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDNNDDNVGSGMVGAPACGDVMKLQI
FT                   KVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKREAK"
FT   gene            359726..360049
FT                   /gene="yfhF"
FT                   /locus_tag="t0315"
FT   CDS_pept        359726..360049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhF"
FT                   /locus_tag="t0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2787 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68039"
FT                   /db_xref="GOA:Q8XFZ8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFZ8"
FT                   /protein_id="AAO68039.1"
FT                   /translation="MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFV
FT                   DEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FHV"
FT   gene            360246..360761
FT                   /gene="yfhE"
FT                   /locus_tag="t0316"
FT   CDS_pept        360246..360761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhE"
FT                   /locus_tag="t0316"
FT                   /product="chaperone protein HscB"
FT                   /note="corresponds to STY2786 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68040"
FT                   /db_xref="GOA:Q8Z4N1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4N1"
FT                   /protein_id="AAO68040.1"
FT                   /translation="MDYFTLFGLPARYQIDTQALSFRFQDLQRQYHPDKFANGTQAQQL
FT                   AAVQQSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLTLREELDD
FT                   IEQSKDDARLESFIKRVQKMFDARLQQMVEQLDNAAWDAAADTVRKLRFLDKLRSSAEQ
FT                   LEEKLLDF"
FT   gene            360774..362624
FT                   /gene="hscA"
FT                   /locus_tag="t0317"
FT   CDS_pept        360774..362624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="t0317"
FT                   /product="chaperone protein HscA"
FT                   /note="corresponds to STY2785 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68041"
FT                   /db_xref="GOA:Q8Z4N2"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4N2"
FT                   /protein_id="AAO68041.1"
FT                   /translation="MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLP
FT                   DHEGRHLLPSVVHYQQQGHTVGYAARDNAAQDTANTISSVKRMMGRSLADIQARYPHLP
FT                   YRFKASVNGLPMIDTAAGLLNPVRVSADILKALAARASESLSGELDGVVITVPAYFDDA
FT                   QRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGVIAVYDLGGGTFDISILRLSR
FT                   GVFEVLATGGDSALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAITAKIALSDA
FT                   DTVRVNVAGWQGEITREQFNDLISALVKRTLLACRRALKDAGVEPQDVLEVVMVGGSTR
FT                   VPLVRERVGEFFGRTPLTAIDPDKVIAIGAAIQADILVGNKPDSEMLLLDVIPLSLGLE
FT                   TMGGLVEKVIPRNTTIPVARAQDFTTFKDSQTAMSIHVMQGERELVQDCRSLARFALRG
FT                   IPPLPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDGEIASMIKDSM
FT                   SFAEQDVKARMLAEQKVEAARVLESLTGALTADAALLSAAERQCIDDAAAHLSAVAQGD
FT                   DVDAIEQAIKNVDKQTQEFAARRMDQSVRRALKGHSVDEV"
FT   gene            362626..362961
FT                   /gene="fdx"
FT                   /locus_tag="t0318"
FT   CDS_pept        362626..362961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="t0318"
FT                   /product="ferredoxin"
FT                   /note="corresponds to STY2784 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68042"
FT                   /db_xref="GOA:Q8XEQ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEQ8"
FT                   /protein_id="AAO68042.1"
FT                   /translation="MPKIVILPHQDLCPDGAVLEAETGETILDVALRNGIEIEHACEKS
FT                   CACTTCHCIVREGFDSLPESSEEEDDMLDKAWGLEPESRLSCQARVTDDDLVIEIPRYT
FT                   INHAREH"
FT   gene            362973..363173
FT                   /gene="yfhJ"
FT                   /locus_tag="t0319"
FT   CDS_pept        362973..363173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhJ"
FT                   /locus_tag="t0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2783 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68043"
FT                   /db_xref="GOA:Q8XGM3"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGM3"
FT                   /protein_id="AAO68043.1"
FT                   /translation="MGLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDD
FT                   PNASNEKILEAILLVWLDEAE"
FT   gene            363227..364510
FT                   /gene="yfhI"
FT                   /locus_tag="t0320"
FT   CDS_pept        363227..364510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhI"
FT                   /locus_tag="t0320"
FT                   /product="peptidase B"
FT                   /note="leucyl aminopeptidase; corresponds to STY2782 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68044"
FT                   /db_xref="GOA:Q8Z4N3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4N3"
FT                   /protein_id="AAO68044.1"
FT                   /translation="MTEAMKITLSTQPADARWGDKATYSINNDGITLHLNGKDDLGLIQ
FT                   RAARKIDGLGIKQVALTGEGWDTERCWAFWAGYKGPKGVRTVMWPDLDDAQRQELDNRL
FT                   TIIDWVRDTINAPAEELGPEQLAQRAVDLLCSVACDSVTYRITKGEDLREQNYMGLHTV
FT                   GRGSERPPVLLALDYNPTGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSDMGGA
FT                   ATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIIRYRNGKNVEVMNTDAEGR
FT                   LVLADGLIDASAQHPRLIIDMATLTGAAKTALGNDYHALFSFDDTLAGRLLTSAAQENE
FT                   PFWRLPLAEFHRNQLPSNFAELNNTGSATYPAGASTAAGFLSHFVENYREGWLHIDCSA
FT                   TYRKAPVEQWAAGATGLGVRTIANLLTA"
FT   gene            364611..365396
FT                   /gene="sseB"
FT                   /locus_tag="t0321"
FT   CDS_pept        364611..365396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseB"
FT                   /locus_tag="t0321"
FT                   /product="SseB protein"
FT                   /note="corresponds to STY2781 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68045"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N4"
FT                   /protein_id="AAO68045.1"
FT                   /translation="MIPMSETKNELEILLEKAATEPAHRSAFFRTLLESTVWVPGSAAE
FT                   GEAIVEDSALDLQHWEKEDGTTVIPFFTSLEALQQAVEDEQAFVVMPARTLFEMTLGET
FT                   LFLNAKLPTGKEFMPREISLLLAEEGSPLSTQEVLEGGESLILSEVAEPPSQMIDSLTT
FT                   LFKTIKPVKRAFLCAIKEHADAQPNLLIGIEADGEIEEIIHAAGNVATDTLPGDEPIDI
FT                   CQVRKGAQGISHFITEHIAPFYERRWGGFLRDFKQNRII"
FT   gene            complement(365965..366633)
FT                   /locus_tag="t0322"
FT   CDS_pept        complement(365965..366633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0322"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2780 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68046"
FT                   /db_xref="InterPro:IPR031990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N5"
FT                   /protein_id="AAO68046.1"
FT                   /translation="MDISLTNLMELVKKVNRNKVPNPMPAEEISCLRVRKYRDPQNTET
FT                   TELPESLKALLAYDRDLLSNYNMPVIETLQRFIDNEGVIHSYSPDEEAYYGAGMDSSGI
FT                   DIEDLMPVWSNDPRLPALIRIDHVGDQAIFIYITERDANGEYPIARMERNEFWLAESSL
FT                   VEYLYNIISGAKDIGFTEEDLHLPQWKAQQKMNEQRDAALLDLEDYHEAFWAKLDALVD
FT                   "
FT   gene            complement(366880..367722)
FT                   /gene="sseA"
FT                   /locus_tag="t0323"
FT   CDS_pept        complement(366880..367722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="t0323"
FT                   /product="putative thiosulfate sulfurtransferase"
FT                   /note="corresponds to STY2779 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68047"
FT                   /db_xref="GOA:Q8Z4N6"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N6"
FT                   /protein_id="AAO68047.1"
FT                   /translation="MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAG
FT                   HIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMRELGVRQDKHLVIYDEGNLFSAPRA
FT                   WWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFTPQAVVRLTDVLLA
FT                   SHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEV
FT                   FFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA"
FT   gene            367931..372865
FT                   /locus_tag="t0324"
FT   CDS_pept        367931..372865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0324"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY2778 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68048"
FT                   /db_xref="GOA:Q8Z4N7"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N7"
FT                   /protein_id="AAO68048.1"
FT                   /translation="MKHLRVVACMIMLALAGCDNNDKTAPTTKSEAPAVAQPSPAQDPS
FT                   QLQKLAQQSQGKALTLLDASEAQLDGAATLVLTFSIPLDPEQDFSRVVHVVDKKSGSVD
FT                   GAWELAPNLKELRLRHLEPERVLVVTVDPAVKALNNATFGKSYEKTITTRDVQPSVGFA
FT                   SRGSLLPGKIAEGLPVMALNVNHVDVNFFRVKPGSLASFVSQWEYRSSLSNWESDNLLK
FT                   MADLVYTGRFDLNPARNTREKLLLPLSDIKPLQQAGVYVAVMNQAGHYNYSNAATLFTL
FT                   SDIGVSAHRYHSRLDIFTQSLENGAAQSGIEIVLLNDKGQTLAQATSDAQGHVQLEADK
FT                   AAALLLARKEGQTTLLDLTLPALDLSEFNVAGAPGYSKQFFMFGPRDLYRPGETVILNG
FT                   LLRDSDGKTLPDQPVKLEVVKPDGQVMRTVVSQPENGLYRLNYPLDINAPTGLWHVRAN
FT                   TGDNLLRSWDFHVEDFMPERMALNLTAQKTPLAPADEVKFSVVGYYLYGAPANGNTLQG
FT                   QLFLRPLRDAVAALPGFQFGNIAEENLSRSLDEVQLTLDKGGRGEVSAASQWQEAHSPL
FT                   QVILQASLLESGGRPVTRRVEQAIWPADTLPGIRPQFAAKAVYDYRTDTTVNQPIVDED
FT                   SNAAFDIVYANAQGEKKAVSGLQVRLIRERRDYYWNWSESEGWQSQFDQKDLVEGEQTL
FT                   DLNADETGKVSFPVEWGAYRLEVKAPNETVSSVRFWAGYSWQDNSDGSGAARPDRVTLK
FT                   LDKANYRPGDTMKLHIAAPVAGKGYAMVESSDGPLWWQAIDVPAQGLELTIPVDKTWNR
FT                   HDLYLSTLVVRPGDKSRSATPKRAVGLLHLPLGDDNRRLDLALESPAKMRPNQPLTVRV
FT                   KASVKHGEMPKQINVLVSAVDSGVLNITDYATPDPWQAFFGQKRYGADIYDIYGQVIEG
FT                   QGRLAALRFGGDGDDLTRGGKPPVNHANIIAQQAQPITLNEQGEGVVTLPIGDFNGELR
FT                   VMAQAWTADDFGRGESKVVVAAPVIAELNMPRFLAGGDVSRLVLDVTNLTDRPQTLNIA
FT                   LAASGLLELLSQQPQPVNLAPGVRTTLFVPVRALEGFGEGEIQATISGLNLPGETLGAQ
FT                   HKQWQIGVRPAWPAQTVNSGIALAPGESWHVPEQHLANVSPATLQGQLLLSGKPPLNLA
FT                   RYIRELKAYPYGCLEQTTSGLFPALYTNAAQLQSLGITGDSDEKRRAAVDIGISRILQM
FT                   QRDNGGFALWDENGAEEPWLTAYAMDFLIRAGEQGYSVPPEAINRGNERLLRYLQDPGT
FT                   MLIRYSDNTQASTFAAQAYAALVLARQQKAPLGALREIWERRSQAASGLPLMQLGIALN
FT                   TMGDARRGEEAITLALNTPRQDERQWIADYGSSLRDNALMLSLLEENNLRPDAQNALLS
FT                   SLSEQAFGQRWLSTQENNALFLAAHSRQASAGAWQAQTSLEAQPLSGDKALTRNLDADQ
FT                   LAALEVTNTGSQPLWLRLDSSGYPSSAPEPASNVLQIERQILGTDGQRKSLSSLRSGEL
FT                   VLVWLTVVADRNVPDALVVDLLPAGLELENQNLADSSASLPESGSEVQNLLNQMQQADI
FT                   QYMEFRDDRFVAAVVVNEGQPVTLVYLARAVTPGTYQLAQPQVESMYAPQWRATGASEG
FT                   LLIVTP"
FT   gene            372866..375181
FT                   /gene="pbpC"
FT                   /locus_tag="t0325"
FT   CDS_pept        372866..375181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="t0325"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="corresponds to STY2777 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68049"
FT                   /db_xref="GOA:Q8Z4N8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N8"
FT                   /protein_id="AAO68049.1"
FT                   /translation="MNGWRGKRGRWLWLAGAPLFIFLALWAADKLWPLPLNEVHPARVV
FT                   VAHDGTPLWRFADAGGIWRYPVTIEEVSPRYLEALINYEDRWFWQHPGVNPFSVARAAW
FT                   QDLTAGRVISGGSTLTMQVARLLDPHSRTFGGKIRQLWRALQLEWHLSKRDILTLYLNR
FT                   APFGGTLQGIGAASWAYFGKPPARLSYADAALLAVLPQAPSRLRPDRWPTRAEAARNKV
FT                   LDRMAEQGVWPAETVRESREEPVWLAPRQMPQLAPLFARMMLSKSRSDKIVTTLDAGLQ
FT                   RQLEDLARAWKGRLPARSSLAMIVVDHTDMSVRGWVGSVDLNDDSRFGHVDMVTAIRSP
FT                   GSVLKPFVYGLALDDGLIHPASLLQDVPRRTGDYRPGNFDSGFHGPVSMSDALVRSLNL
FT                   PAVQVLEAYGPKRFAAKLRNVGLPLYLPAGAAPNLSLILGGAGARLDEMAAAYSAFARH
FT                   GKAAKLRLQPDDPLSERPLMSPGAAWIIRRIMADEAQPLPDNALPRIVPLAWKTGTSYG
FT                   YRDAWAIGVNARYIIGIWTGRPDGTPVVGQFGFASAVPLLNQVNNLLLAHTGRLPEDPR
FT                   PQTVSRGVICWPGGQTLPAGNSNCRRRLATWLLDDSQPPTLLLPEQEDINGIRFPVWLD
FT                   DTGRRVAADCPQARAHTFIVWPRPLEPWLPPAERRSARLPAASDHCPPLQGNDAAPLML
FT                   SGVRDGAVIRQLPGQENVTLPVSTTGGKGRRWWFLNGEPVNGENNRLSLLLNIAGRYQL
FT                   VVMDESGQVAAVNFELIR"
FT   gene            375337..377714
FT                   /pseudo
FT                   /locus_tag="t0326"
FT                   /note="corresponds to STY2775 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            377711..378340
FT                   /locus_tag="t0327"
FT   CDS_pept        377711..378340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0327"
FT                   /product="putative anaerobic reductase component"
FT                   /note="corresponds to STY2774 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68050"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4N9"
FT                   /protein_id="AAO68050.1"
FT                   /translation="MSQFTHYPPVSDKQLGFFIDSSRCSGCKACQVACKDKNNLEVGRR
FT                   FRRVYEVKGGSFIPTGQGGVSNNVFAYTLSISCNHCADPVCTKNCPTTAMHKRPGDGIV
FT                   RVDTDKCVGCGYCAWSCPYGAPQLNEQTGQMSKCDMCVDLLAKGESPGCVATCPLEAIK
FT                   FGPIDELRAKYGSVCDVNGLPDSSITKPNLVVKAHQGAEKEGKRHA"
FT   gene            378333..379142
FT                   /locus_tag="t0328"
FT   CDS_pept        378333..379142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0328"
FT                   /product="putative anaerobic reductase component"
FT                   /note="corresponds to STY2773 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68051"
FT                   /db_xref="GOA:Q8Z4P0"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P0"
FT                   /protein_id="AAO68051.1"
FT                   /translation="MHELPLLIFTLCLQGSVGVTLWLALGRQYAVEGRVPARGALPAMA
FT                   GAFVLACVGLLASALHMGYPLNALNALRHVASSWLSREIVFASLYLAALGLGVVLLFFR
FT                   KPGWQPLLALAAAFGLVDVFCMAQVYIHASVATWQHSNTLALFFGTSGIIGSVVIALAY
FT                   LRNAGAAMRCAVVVVALMVLIRLIMQPLWLADINAVDTTVVTFPHHPLQALAQLRDIYL
FT                   LGWCVSAAGMLCFAAGGLRNARGTLVAGSVLLLIGEIMLRYVFFSIG"
FT   gene            379142..380005
FT                   /locus_tag="t0329"
FT   CDS_pept        379142..380005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0329"
FT                   /product="putative polyferredoxin"
FT                   /note="corresponds to STY2772 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68052"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P1"
FT                   /protein_id="AAO68052.1"
FT                   /translation="MVNLTIDPAVDVTQACVRRRFRFSSCRACTDVCPAQVFSLAQGQV
FT                   SIDTTRCIACGDCLFVCPVDAITDIKPVKRFVQGDTLVGPFSLQAPTVDELLLWHSQYG
FT                   IRFIDIAVERSAQWLMALAGLNLALRRYGEPGWSFKHVVGAEINASRRTLFHVPRDAIT
FT                   PCAVEPGKRRLRQAFSAFSECVPEISPQECRMCGACWRSCPENVIQFDDDTLTIAAARC
FT                   TGCGGCAAVCPHQALRLRFDVEPASTRHSAVHTLTCESCKRTFHALTPEHTHCVLCQSP
FT                   EFAVRL"
FT   gene            380126..380557
FT                   /gene="ndk"
FT                   /locus_tag="t0330"
FT   CDS_pept        380126..380557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="t0330"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="corresponds to STY2771 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68053"
FT                   /db_xref="GOA:P65535"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65535"
FT                   /protein_id="AAO68053.1"
FT                   /translation="MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVE
FT                   QARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLR
FT                   ADYADSLTENGTHGSDSLESAQREIAFFFGEGEVCPRTR"
FT   gene            380764..381930
FT                   /gene="yfgB"
FT                   /locus_tag="t0331"
FT   CDS_pept        380764..381930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgB"
FT                   /locus_tag="t0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2770 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68054"
FT                   /db_xref="GOA:Q8Z4P2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4P2"
FT                   /protein_id="AAO68054.1"
FT                   /translation="MSEQIVTPESSTPVVLNNETKINLLDLNRQQMREFFKNLGEKPFR
FT                   ADQVMKWMYHYCCDNFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVG
FT                   DQRVETVYIPEDDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIV
FT                   GAAKVTGQRPITNVVMMGMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPA
FT                   LDKLGDMIDVALAISLHAPNDTIRDEIVPINKKYNIETFLGAVRRYLEKSNANQGRVTI
FT                   EYVMLDHVNDGTEHAHQLAELLKETPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMS
FT                   YGFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLRKRMQGEVIDIKAI"
FT   gene            382224..383198
FT                   /gene="yfgA"
FT                   /locus_tag="t0332"
FT   CDS_pept        382224..383198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgA"
FT                   /locus_tag="t0332"
FT                   /product="putative DNA-binding protein"
FT                   /note="corresponds to STY2769 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68055"
FT                   /db_xref="GOA:Q8Z4P3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4P3"
FT                   /protein_id="AAO68055.1"
FT                   /translation="MNTEATHDQNEAQTTGVRLRNAREQLGLSQQAVAERLCLKVSTVR
FT                   DIEEDKAPSDLASTFLRGYIRSYARLVHVPEEELLPGLEKQAPLRAAKVAPMQSFSLGK
FT                   RRKKRDGWLMSFTWLVLFVVVGLTGAWWWQNHKAQQEEITTMADQSTAELNADKDSGQS
FT                   VPLDTSAATSQDTTPAQTAPAPATPVDSTAATQNTVVAPSQANVDTAATSAAPAATETP
FT                   SALPTSQAGVAAPAADPNALVMNFTADCWLEVTDATGKKLFSGMQRKDGNLNLTGQAPY
FT                   KLKIGAPAAVQIQYQGKPVDLSRFIRTNQVARLTLNAEPTPAQ"
FT   gene            383225..384343
FT                   /gene="gcpE"
FT                   /locus_tag="t0333"
FT   CDS_pept        383225..384343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE"
FT                   /locus_tag="t0333"
FT                   /product="GcpE protein"
FT                   /note="protein E; corresponds to STY2768 from Accession
FT                   AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68056"
FT                   /db_xref="GOA:P58670"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58670"
FT                   /protein_id="AAO68056.1"
FT                   /translation="MHNQAPIQRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATV
FT                   NQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVSVPLVADIHFDYRIALKVAEYGVDC
FT                   LRINPGNIGNEERIRMVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMR
FT                   HVDHLDRLNFDQFKVSVKASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAI
FT                   GLGLLLSEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRARGINFIACPTCSRQEFDVI
FT                   GTVNALEQRLEDIITPMDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLD
FT                   NDDMIAQLESRIRAKVSQLDEARRIDVLQVEK"
FT   gene            384454..385728
FT                   /gene="hisS"
FT                   /locus_tag="t0334"
FT   CDS_pept        384454..385728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="t0334"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="corresponds to STY2767 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68057"
FT                   /db_xref="GOA:Q8Z4P4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4P4"
FT                   /protein_id="AAO68057.1"
FT                   /translation="MAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPI
FT                   VEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQR
FT                   LWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDIDAELIMLTARWWRALGISEHVSL
FT                   ELNSIGSLEARANYRDALVAFLEQHQETLDEDCKRRMYTNPLRVLDSKNPDVQALLNDA
FT                   PVLGDYLDDDSREHFAGLCKLLDAAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGT
FT                   VCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFIASPVVDIYLVAAGAQT
FT                   QSAAMTLAERLRDEMPGVKLMTNHGGGNFKKQFARADKWGARIALVLGESEVADGTVVV
FT                   KDLRSGEQTAVAQDSVAAHLRTLLG"
FT   gene            385742..386362
FT                   /locus_tag="t0335"
FT   CDS_pept        385742..386362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0335"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2766 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68058"
FT                   /db_xref="GOA:Q8XF04"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XF04"
FT                   /protein_id="AAO68058.1"
FT                   /translation="MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSH
FT                   QTESARAASLAYQNAVTAVSADKPDSIPAAEKFAAENKNTYGALASMELAQQFVDKNEL
FT                   KKAEAQLQQGLAATSDENLKAVINLRLARVQLQLKQADAALKTLDAVKGEGWTAIVADL
FT                   RGEALLSKGDKKGARSAWEAGVNSDASPALSEMMQMKINNLSI"
FT   gene            386373..387551
FT                   /locus_tag="t0336"
FT   CDS_pept        386373..387551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0336"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY2765 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68059"
FT                   /db_xref="GOA:Q8Z4P5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P5"
FT                   /protein_id="AAO68059.1"
FT                   /translation="MQLRKLLLPGLLSVTLLSGCSLFSGEEDVVKMSPLPQVENQFTPT
FT                   TVWSTSVGNGIGEFYSNLHPVMADNVVYAADRAGVVKALNADDGKEIWSVNLGEKDGWF
FT                   SRSSALLSGGVTVAGGHVYIGSEKAEVYALNTSDGTTAWQTKVAGEALSRPVVSDGIVL
FT                   IHTSNGQLQALNQADGAIKWTVNLDMPSLSLRGESAPATAFGAAIVGGDNGRVSAVLMQ
FT                   QGQMIWQQRISQATGPTEIDRLSDVDTTPVVVNGVVYALAYNGNLTALDLRSGQIMWKR
FT                   ELGSVNDFIVDGDRIYLVDQNDRVLALTTDGGVTLWTQSDLLHRLLTSPVLYNGDLVVG
FT                   DSEGYLHWINVDDGRFVAQQKVDSSGFLTEPTVADGKLLIQAKDGTVYAITR"
FT   gene            387670..389142
FT                   /locus_tag="t0337"
FT   CDS_pept        387670..389142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0337"
FT                   /product="putative GTP-binding protein"
FT                   /note="corresponds to STY2764 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68060"
FT                   /db_xref="GOA:Q8Z4P6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4P6"
FT                   /protein_id="AAO68060.1"
FT                   /translation="MVPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGRA
FT                   EVEGREFICIDTGGIDGTEDGVETRMAEQSLLAIEEADVVLFMVDARAGLMPADEAIAK
FT                   HLRSREKPTFLVANKTDGLDPDQAVVDFYSLGLGEIYPIAASHGRGVLSLLEHVLLPWM
FT                   DDVAPQEEVDEDAEYWAQFEAEQNGEEAPEDDFDPQSLPIKLAIVGRPNVGKSTLTNRI
FT                   LGEERVVVYDMPGTTRDSIYIPMERDEREYVLIDTAGVRKRGKITDAVEKFSVIKTLQA
FT                   IEDANVVLLVIDAREGISDQDLSLLGFILNSGRSLVIVVNKWDGLSQEVKEQVKETLDF
FT                   RLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVSTAMLTRIMTMAVEDHQPPL
FT                   VRGRRVKLKYAHTGGYNPPIVVIHGNQVKDLPDSYKRYLMNYFRKSLEVMGTPIRIQFK
FT                   EGENPYANKRNTLTPTQMRKRKRLMKHIKKSK"
FT   gene            389231..389452
FT                   /locus_tag="t0338"
FT   CDS_pept        389231..389452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2763A from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68061"
FT                   /db_xref="InterPro:IPR010807"
FT                   /db_xref="InterPro:IPR029037"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P7"
FT                   /protein_id="AAO68061.1"
FT                   /translation="MEIICPVCHHALERNGDTAHCETCAKDFSLQALCPDCRQPLQVLK
FT                   ACGAVDYFCQNGHGLISKKRVNFVISDQ"
FT   gene            389798..391987
FT                   /pseudo
FT                   /gene="sivH"
FT                   /locus_tag="t0339"
FT                   /note="corresponds to STY2762 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            392048..393013
FT                   /gene="sinI"
FT                   /locus_tag="t0340"
FT   CDS_pept        392048..393013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sinI"
FT                   /locus_tag="t0340"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2761 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P8"
FT                   /protein_id="AAO68062.1"
FT                   /translation="MQATVKRRLTKVALALVVAGYCAAPAVAANGNLKSGQWQIVSEQT
FT                   GTIQGTVPWITRAADKTADTDKDHVTVTIDRGDRKIVTEGDKQFHVGDKVTVNWAIGDT
FT                   EGDLDVDNAATKLTVQWMRYSDQNGSNPEEIGAKGSDTYEIQAGDADHYIGIKITPTTT
FT                   TGDPAVATELLLKDLSTDAGGGADGDDIPEGPVVDENVHVVIHEKDSNTNLLKNSGTTL
FT                   KTNTTYQVLLWSDKNGNGTYDAGENVTDQYDYRWKFVGTSKIAGTGTGGIVNENWNDKD
FT                   LVIPLTNAEAKEAFEGAEGGVTVGSDGVQGFGLSIDYKRK"
FT   gene            393133..399525
FT                   /gene="ratA"
FT                   /locus_tag="t0341"
FT   CDS_pept        393133..399525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ratA"
FT                   /locus_tag="t0341"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2760 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68063"
FT                   /db_xref="InterPro:IPR008541"
FT                   /db_xref="InterPro:IPR008542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4P9"
FT                   /protein_id="AAO68063.1"
FT                   /translation="MDRNRQVNKVVHFLLTLLIMFVASIAPAQALLKGGTWQELNSATA
FT                   AVNGTVPRADGAIIPVYQGSMLLDPTKTYDVAFTAMPRDFSADATSTSMRAVNSTDTEG
FT                   DLFSDPPTIAWENQQPPSVGLLWADAATPDTPLSPQPTPNQTFCAQNLAGRKLVVWPQP
FT                   DDETTVPALWLYTHTGVPNNAAIPLLSPKVTVNIAQAVGNPVSVSGDHVDASFKASKVK
FT                   VGESITLTVTTRGCDGKLVKNAPFVIRREDAKNRQGVVNNTNPVHVGDAELTTVQTEYR
FT                   GVTDAEGKATVVVTQDEGPGVKTHLIVASQSYPTLTDGVDVIFTTITSPDTAQANMYGH
FT                   MLESASATLNGATYTFTRPKLAVEAGNADESVNDTNETWAQFTWSGADNHCDVLPDAEQ
FT                   LVALRHAHSTLATYTGWPASGDAEYWSSTKDQMNNYHAAVHMNSASVVRAPNSDTLLVS
FT                   CVDKAQPAAHPQITLSPEGPYKAQVGESIDLVMTVVDKDTQKPLPYRYMELFIDPAKNR
FT                   KGEHQDAWDNQRVTVSSEDMRASSPEHYTGVTDVNGQAHLTLQHDSGMGGETPIRIVMP
FT                   DDEGGNVELPFSVIFTVITSPDVDGANMWGHMRGVVDAGNLYKRPLLAVEASHKDGQFS
FT                   ENNEEWATFNSVASATAQCGVGQVPDQSSLAHLYSEHPSGKMEIEHGWPTEDYFIAADS
FT                   DASGTVHVNLANGDSNKFTNQPNYLTCSANEMVAVLDVYFNDDPTTKNADMTAKVGEQI
FT                   KLNIHSRNALNDMAIAYTDFTITMANGKRRDGLTTGFTDPSNGEMQFDGVGYLAGQVYH
FT                   GITDANGDATIILTQNKGVGLLTPLSIAPVDSLIKTPISRSVKFTVATSPDTVKAKMWG
FT                   HMADTLTVGDWTFERPKLASEVNSPLRTQEESNETWTRVAHIDAAGNPDAGGCAANRLP
FT                   RIDQLEALYSANSGGAMKKTQGWPTLINYWSSTYQSATTWKLIALASGSEFPGSNTSVY
FT                   TSCLASDNPVPAAITIEPVDPSQWYDGSGVHALKVKKGDTLQLKVTVKDASGKPVPEAP
FT                   FVLTRGDGYDRKGEKYTAQDGSDLQNIVTPVVIDGESLAWTTTKMGSQTGPDGTRIISV
FT                   TRPDTHGTRTAITATLYENVAVSASIDTIFTVVTSPDVSVARMWGHMTPSLTAADSAVY
FT                   KRPLLYDELASKTGAAEYPEDNERWVVFYGPNTTKTVSPEACSKGYFPSVEQLDSLYSK
FT                   YPNGAIKTAQGWPIIRSYWSGTNAGTITPGAPPYDYYTVDLNDDAHRKVPNISDSDRQY
FT                   QICAATPQPLAGRITLTSTLATDSDIQAVKAKNSDSIPLVITTTDAAGNPVPYTPFSLI
FT                   RDAGTARNTSYTFTGSTNMMLAPPTGSAQQFYYNGYTIYGATGADGTAVLTLTQAAGPG
FT                   VKNVITAALTDTPTVTSTLPVVFTTVTSPDSPQANMYGHMPETFTASNGAEFKRPLLYS
FT                   ELASTLGVKSYADTNENWPIVNNFDTSNYGACSINQMATLDDLKALYGDHPSGKVTTDI
FT                   GLPVRKKWWAGDSLLQGQVIYWRYIDLSTGIDYSMSGTPGNYYYQLCLTKPRQMNIALS
FT                   TDAWNADKSAAVAKKGETIPMTVKVTNAAGQPVSNATVKITRGDALTRAGSVYTTNNAD
FT                   DITLSNIQPSGTATYLLGSVDKYMYAQTDAQGQITFSVSQNNTMGLKTPIRVTVANDIT
FT                   ATSSKDVIFTVLTSPDVASANYWGHMPETVEGPDGLRYQRPHLQAEAPSGVNYITVNGE
FT                   KWAAPTGVQTYTAGQSACDVEYMPLMNDLKALQQLYPDGALEDQFGWPVKTGKLWWSAD
FT                   LNSSKAHQAINLKTGQISAPTSTSLQACLVNARNVPASITLTSTAMDAEKGAAVAKKGE
FT                   AIPLTVTVKNRAGVPIANEPFTLKRGDANDRLDIKYTWNTTADDLTLQELTPSPTTKSM
FT                   TASGNVFSGVTGADGTATFTVNQDGSVGLKTELTASATGDVTQSTNTALGVIFNVITSP
FT                   DTDKAQYWGHMPDTLTVGGVTLHRPLLMKEAPAGATDSRKENNETWVSVYTKADGLTYD
FT                   MSKNCGGVAGFPAKGVLEKIRDEQMAVANGWPTVSLPYASSTPGTYNYCWVSLAKGGTT
FT                   HCPTTSSDYSIGYAACLVQP"
FT   gene            399637..405317
FT                   /pseudo
FT                   /gene="ratB"
FT                   /locus_tag="t0342"
FT                   /note="corresponds to STY2758 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            405324..406904
FT                   /gene="ratC"
FT                   /locus_tag="t0343"
FT   CDS_pept        405324..406904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ratC"
FT                   /locus_tag="t0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2756 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68064"
FT                   /db_xref="InterPro:IPR008541"
FT                   /db_xref="InterPro:IPR008542"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q0"
FT                   /protein_id="AAO68064.1"
FT                   /translation="MPIRLGRGNYSQNRAGGSDSTNNSDMLLTPIAPPADAKVFAYHYS
FT                   GEQLWYWYGTTDESGRVQFELTQDNTPGLKTALQAMLSDNPPTVSNMDVIFTVITSPDS
FT                   DKAKMWGHMPETAANSAGVKFHRPLLAAEMTSNSGTYYYNNETWPLVTIANTQKAGATT
FT                   CDAAYQPLFNDLQTLYSDHPDSALNTAFGWPVGAGKSWLAVDQEPGTGYYQYLRLDTGA
FT                   KGHTSSTSVSGAQVCLVEPHTSTPANITLTSTAMDSAKNAAVVEKGSAMPLTVTVKDSS
FT                   GNPVANVGFTLSRGDSKNRAGTVVTDGDVAADAGADDLMLKELTPASASRSMTTTGIVF
FT                   TGTTGSDGTATFTLNQDKSLGLKTPLTVKLTDNTALHASLDVIFMVLTSPDTDKALFWG
FT                   NMSDTTSVNGKTLHRPWLQAELPSGVTPVFTNGVHANNEYWAMTHTVDNTKWDIAKQCG
FT                   SLSKAPDNNDLLTLYHSISSLGWPTLGYPYLSKSTSGGGMYCGVDENTKQQNCAIQPAS
FT                   TAGYATCVE"
FT   gene            407470..412393
FT                   /pseudo
FT                   /gene="shdA"
FT                   /locus_tag="t0344"
FT                   /note="corresponds to STY2755 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(412555..413904)
FT                   /gene="xseA"
FT                   /locus_tag="t0345"
FT   CDS_pept        complement(412555..413904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="t0345"
FT                   /product="exodeoxyribonuclease large subunit"
FT                   /note="corresponds to STY2753 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68065"
FT                   /db_xref="GOA:Q8Z4Q1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Q1"
FT                   /protein_id="AAO68065.1"
FT                   /translation="MLSSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFTQPASG
FT                   HWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQP
FT                   AGEGLLQQKYEQLKAKLHAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRR
FT                   DPSLPVIIYPTAVQGDDAPGQIVRAIELANTRGECDVLIVGRGGGSLEDLWSFNDERVA
FT                   RAIFASRIPVVSAVGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRL
FT                   GMAMDYYLANRSRRFTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQR
FT                   QQRVSQRLSQQNPQPRIHRVQSRIQQLEYRLTENIRSRLSEQRERFGNAVTHLEAVSPL
FT                   ATLARGYTVSTTTDGKVLKKIKQVKAGDIMTTRLEDGWLESEVKSVTPGT"
FT   gene            414059..415531
FT                   /gene="guaB"
FT                   /locus_tag="t0346"
FT   CDS_pept        414059..415531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="t0346"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /note="corresponds to STY2752 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68066"
FT                   /db_xref="GOA:Q8Z4Q2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q2"
FT                   /protein_id="AAO68066.1"
FT                   /translation="MPMLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIP
FT                   MLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLP
FT                   TTTLHEVKALTERNGFAGYPVVTEDNELVGIITGRDVRFVTDLNQPVSVYMTPKERLVT
FT                   VREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKAERKPNSCKDEQGRLRV
FT                   GAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVA
FT                   TGAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIAD
FT                   GGIRFSGDIAKAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKG
FT                   SSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCATIDELRTK
FT                   AEFVRISGAGIQESHVHDVTITKESPNYRLGS"
FT   gene            415601..417178
FT                   /gene="guaA"
FT                   /locus_tag="t0347"
FT   CDS_pept        415601..417178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="t0347"
FT                   /product="GMP synthase"
FT                   /note="glutamine-hydrolyzing; corresponds to STY2751 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68067"
FT                   /db_xref="GOA:Q8Z4Q3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Q3"
FT                   /protein_id="AAO68067.1"
FT                   /translation="MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQ
FT                   IRDFNPSGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSN
FT                   EREFGYAQVEVLTDSALVRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESC
FT                   PFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVARIR
FT                   EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHF
FT                   GLNIVHVPAEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
FT   gene            417266..417424
FT                   /locus_tag="t0348"
FT   CDS_pept        417266..417424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0348"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2750 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68068"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q4"
FT                   /protein_id="AAO68068.1"
FT                   /translation="MHFLCSAQLLAAKHCIDTIVGFTGSTQSNLTVGFERGADIGSFNN
FT                   MTGIEVY"
FT   gene            complement(417501..418190)
FT                   /locus_tag="t0349"
FT   CDS_pept        complement(417501..418190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2749 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q5"
FT                   /protein_id="AAO68069.1"
FT                   /translation="MKDFSKYSKALGMAKFYVYAFYDTEDAAKKPFYIGKGKSERCLDH
FT                   IKYNDDSPKSERINHLLKTGNLGIDILRHGMDEATAKLVEATCIDLLGVGELTNKVRGS
FT                   SSLMGRITLDELNHLLLKQETEIAPEHAGLAFLLNSTYKSGMSALALYEATRGVWAKVP
FT                   KDENLQFAYATYGGLVMEVYEIQCWLKAGSQQYFTRELVIPPPKPTVQNLLDESHHQKS
FT                   EDYTLAS"
FT   gene            complement(418419..418958)
FT                   /locus_tag="t0350"
FT   CDS_pept        complement(418419..418958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0350"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2748 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68070"
FT                   /db_xref="InterPro:IPR020231"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q6"
FT                   /protein_id="AAO68070.1"
FT                   /translation="MKKVILGAVLFTLSGSVLSSSLQDQLAAVAQAEQQGKNEENRQRD
FT                   ALQAKRDQEAQQERQRQANAAAVAKQRAKAAEAERKARQAKLAAEAAQDKARDQSYEDE
FT                   LRRLEIQKQKLALAREEARVKRENEFIDQELKSKAAQTDVIQSHADANRNLSEGGRDLL
FT                   QSEGKAREEKASGWFN"
FT   gene            complement(418974..419490)
FT                   /pseudo
FT                   /locus_tag="t0351"
FT                   /note="corresponds to STY2747 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            419771..420031
FT                   /locus_tag="t0352"
FT   CDS_pept        419771..420031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0352"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2746 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q7"
FT                   /protein_id="AAO68071.1"
FT                   /translation="MRFFFILMVLPGADRRVDETSKEEEKTDKQYDTGHASVKSMSFSH
FT                   TVGLTYKGFLNVGPAVWAGSGWVLQRYYQGEERNKPAFTLH"
FT   gene            420102..420239
FT                   /locus_tag="t0353"
FT   CDS_pept        420102..420239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0353"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2745 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q8"
FT                   /protein_id="AAO68072.1"
FT                   /translation="MEDNFSIYINNKLMITKNKKTNKGCRRKVIIDLNQMLLLFNNYNR
FT                   "
FT   gene            420336..422549
FT                   /locus_tag="t0354"
FT   CDS_pept        420336..422549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0354"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2744 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68073"
FT                   /db_xref="GOA:Q8Z4Q9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Q9"
FT                   /protein_id="AAO68073.1"
FT                   /translation="MKLNKTYINIRDKWWGLPLILPSILLPVLSSANTYALTSTGNVVL
FT                   FYLPLAFMLSLMLFFGWAALPGIVLAIFWRRYPQTGLYETLSVTMHFIITIVLSWGGYR
FT                   VFSPRRNNVSHGDAHLLFQRMFWQVFCSATLFLVIYQFAAFVGMYESKASLMGVMPFNI
FT                   NTLINYQALLVGNLVGVPLCYFIIRTLRNPLHLRGYYQQLKLQIDSKATKKEIVIWLAV
FT                   LTTLMFILCMPLTDNSSIFSTNYTLSLLLPVMLWGAMRYGYKFISIIWAVVLITSIHYY
FT                   QRYMPWYSGYDTQLAITSSSYLVFSFIVNYMSVLATRQRVVSGRARRLAYLDPVVHLPN
FT                   LRALNRALKNAPWSTICFLHVPGLELLGKNYGVMLRIQYKQKLSHWITPMLASNECVYQ
FT                   MSGHDLVLRLNTEAHQQRIEALDKHIKQFRFIWDGLPLQPPVGVSYCCVRSPVSHLYLL
FT                   LGELSTSSDLSLTTNAPEDLQRRGAMHLQRDLKGRIAMMNRLQQALEHDHFFLMAQPIF
FT                   GVRGDVYHEILLRLRDDNGDVINPDNFLPVAHEFGLSSAIDLWVIENTLRFMAASREYM
FT                   PAHRFAINLSPTSVCRARFPAEVKQLLTQYQVEPWQLVFEVTESNSLTNAEQAQLTLGQ
FT                   LQQFGCQIAIDDFGTGYASYARLKNVDADILKIDGSFIRNIVSNSLDYQIVASICHLAR
FT                   MKNMQVVAEYIESEEIRSVVLSLGIDYLQGYLIGEPQLLSEIQ"
FT   gene            complement(422585..424126)
FT                   /gene="ppx"
FT                   /locus_tag="t0355"
FT   CDS_pept        complement(422585..424126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="t0355"
FT                   /product="exopolyphosphatase"
FT                   /note="corresponds to STY2743 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68074"
FT                   /db_xref="GOA:P0A270"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A270"
FT                   /protein_id="AAO68074.1"
FT                   /translation="MPIYDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRV
FT                   HLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQAQNAADFLKR
FT                   AEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPRLVE
FT                   SRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQGWNVAMGASGTIKA
FT                   AHEVLLALGEKDGFITPERLDKLKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGV
FT                   FDALAIRELRLSDGALREGVLYEMEGRFRHQDVRSRTAKSLANQYNIDREQARRVLETT
FT                   MQMYEQWQAQQPKLAHPQLEALLRWAAMLHEVGLNINHSGLHRHSAYILQHSDLPGFNQ
FT                   EQQMMMATLVRYHRKAIKLDDMPRFTLFKKKQYLPLIQLLRLGVLLNNQRQATTTPPTL
FT                   RLTTDDSHWTLCFPHDWFSQNALVLLDLEKEQQYWEAVTGWRLNIEEESSPEIAA"
FT   gene            complement(424131..426197)
FT                   /gene="ppk"
FT                   /locus_tag="t0356"
FT   CDS_pept        complement(424131..426197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="t0356"
FT                   /product="polyphosphate kinase"
FT                   /note="corresponds to STY2742 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68075"
FT                   /db_xref="GOA:Q8Z4R0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4R0"
FT                   /protein_id="AAO68075.1"
FT                   /translation="MGQEKLYIEKELSWLAFNERVLQEAADKSNPLIERMRFLGIYSNN
FT                   LDEFYKVRFAELKRRIIISEEQGSNSHSRHLLGKIQSRVLKADQGFDGLYNELLLEMAR
FT                   NQIFLINERQLSVNQQSWLRHYFKHYLRQHITPILINRETDLVQFLKDDYTYLAVEIIR
FT                   GDTINYALLEIPSDKVPRFVNLPPETPRRRKPMILLDNILRYCLDDIFKGFFDYDALNA
FT                   YSMKMTRDAEYDLVHEMESSLMELMSSSLKQRLTAEPVRFVYQRDMPAALVDVLREKLT
FT                   ISRYDSIVPGGRYHNFKDFINFPNVGKANLVNKPLPRLRHLWFDKEKFRNGFDAIRERD
FT                   VLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDSMIHAAHNGKKVTVV
FT                   VELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKEGDDVVRYAHIGTG
FT                   NFNEKTARLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLMVSPQNSRRLLYEM
FT                   IDREIANAQQGLPSGITLKLNNLVDKGLVDRLYAASGSGVQVNLLVRGMCSLIPQLEGI
FT                   SDNIRAISIVDRYLEHDRVYIFENGGDKQVWLSSADWMTRNIDYRIEVATPILDPRLKQ
FT                   RVLDIIDILFSDTVKARFIDKELSNRYVPRGNRRKVQAQLAIYDYIKSLEQPD"
FT   gene            complement(426386..427024)
FT                   /gene="purN"
FT                   /locus_tag="t0357"
FT   CDS_pept        complement(426386..427024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="t0357"
FT                   /product="phosphoribosylglycinamidine myltransferase"
FT                   /note="corresponds to STY2741 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68076"
FT                   /db_xref="GOA:Q8Z4R1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R1"
FT                   /protein_id="AAO68076.1"
FT                   /translation="MNIVVLISGNGSNLQAIIDACEAKKIKGTLRAVFSNKADAFGLER
FT                   AREAGIPAQALTADRFDSRDAFDRELIRKIDAYAPDVVVLAGFMRILSPMFVAHYYGRL
FT                   LNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFANDSED
FT                   DITARVQTQEHAIYPLVIGWFAQGRLKMRDNAAWLDGRRLPPQGYASDE"
FT   gene            complement(427024..428061)
FT                   /gene="purM"
FT                   /locus_tag="t0358"
FT   CDS_pept        complement(427024..428061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="t0358"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="corresponds to STY2740 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68077"
FT                   /db_xref="GOA:Q8Z4R2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4R2"
FT                   /protein_id="AAO68077.1"
FT                   /translation="MTDKTSLSYKDAGVDIDAGNALVDRIKGVVKKTRRSEVMGGLGGF
FT                   GALCALPQKYREPVLVSGTDGVGTKLRLAMDLKRHDAIGIDLVAMCVNDLVVQGAEPLF
FT                   FLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAGFCVGV
FT                   VEKSEIIDGSRVAEGDVLIALGSSGPHSNGYSLVRKIIDVSGCDPQTTLLEGKPLADHL
FT                   LEPTRIYVKSVLELIENIDVHAIAHLTGGGFWENIPRVLPENTQAVINESSWQWPAIFT
FT                   WLRTAGNVSRHEMYRAFNCGVGMVIALSAPEADKALALLNEKGENAWKIGIIKASDSEQ
FT                   RVVIE"
FT   gene            428474..429100
FT                   /gene="upp"
FT                   /locus_tag="t0359"
FT   CDS_pept        428474..429100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="t0359"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="corresponds to STY2739 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68078"
FT                   /db_xref="GOA:P0A2M6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2M6"
FT                   /protein_id="AAO68078.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATA
FT                   DLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMEGVLENVPSARISVVGMYRN
FT                   EETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAP
FT                   EGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK"
FT   gene            429188..430477
FT                   /gene="uraA"
FT                   /locus_tag="t0360"
FT   CDS_pept        429188..430477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="t0360"
FT                   /product="uracil permease"
FT                   /note="uracil transporter; corresponds to STY2738 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68079"
FT                   /db_xref="GOA:Q8Z4R3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R3"
FT                   /protein_id="AAO68079.1"
FT                   /translation="MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPVLFHINPAT
FT                   VLLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLV
FT                   SFIVKKAGTGWLDVMFPPAAMGAIVAVIGLELAGVAAGMAGLLPAQGQSPDTKTIIISM
FT                   VTLAVTVFGSVLFRGFLAIIPILIGVLAGYALSFALGVVDTTPIAQAHWFALPTFYTPR
FT                   FEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLVRDPGLHRSMFANGLSTIISGFFG
FT                   STPNTTYGENIGVMAITRVYSTWVIGGAAIFAILLSCVGKLAAAIQIIPLPVMGGVSLL
FT                   LYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKVHIGAAELKGMALATIVG
FT                   IGLSLIFKLISLLRPEEVVLEANDAESPHQ"
FT   gene            430548..431273
FT                   /locus_tag="t0361"
FT   CDS_pept        430548..431273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2737 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68080"
FT                   /db_xref="GOA:Q8XEQ0"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEQ0"
FT                   /protein_id="AAO68080.1"
FT                   /translation="MSSWVEVSLNTPAQLSLPLYLPDDETFASFWPGDNASLLAALQNV
FT                   LRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHL
FT                   SLVCIDNIECVAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLD
FT                   WGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDHA
FT                   SITAQRKLTIPFVKEILKL"
FT   gene            complement(431300..431659)
FT                   /locus_tag="t0362"
FT   CDS_pept        complement(431300..431659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0362"
FT                   /product="putative arsenate reductase"
FT                   /note="arsenical pump modifier; corresponds to STY2736 from
FT                   Accession AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68081"
FT                   /db_xref="GOA:Q8Z4R4"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R4"
FT                   /protein_id="AAO68081.1"
FT                   /translation="MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATV
FT                   RELLRMLGMSSARELMRQKEDLYKTLHLADSQLSEEALIQALVEHPKLMERPIVVANGQ
FT                   ARIGRPPEQVLDILG"
FT   gene            complement(431699..433162)
FT                   /locus_tag="t0363"
FT   CDS_pept        complement(431699..433162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0363"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2735 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68082"
FT                   /db_xref="GOA:P66951"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR030873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66951"
FT                   /protein_id="AAO68082.1"
FT                   /translation="MFRQLKKNLVATLIAALALGQVAPAFADPADTLPDMGTSAGSTLS
FT                   IGQEMQMGDFYVRQLRGSAPLINDPLLVQYINALGMRLVSHADSVKTPFHFFLINNDEI
FT                   NAFAFFGGNVVLHSALFRYADNESQLASVMAHEISHVTQRHLARAMEDQKRSAPLTWVG
FT                   ALGSILLAMASPQAGMAALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRAGFDPQAM
FT                   PSFLEKLLDQARYSTRPPEILLTHPLPESRLADARNRANQMRPVVVQSSADFYFAKARA
FT                   LGMYNSGRNQLTSDLLDQWSKGNVRQQHAAQYGRALQAMEASKYDEARKTLQPLLSAEP
FT                   NNAWYLDLATDIDLGQKRANDAINRLKNARDLRVNPVLQLNLANAYLQGGQPKAAETIL
FT                   NRYTFSHKDDGNGWDLLAQAEAALNNRDQELAARAESYALAGRLDQAISLLSSASAQAK
FT                   LGSQQQARYDARIDQLRQLQERFKPYTKM"
FT   gene            433370..434437
FT                   /locus_tag="t0364"
FT   CDS_pept        433370..434437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0364"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2734 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68083"
FT                   /db_xref="GOA:Q8XH19"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XH19"
FT                   /protein_id="AAO68083.1"
FT                   /translation="MLEMLMQWYRRRFSDPEAIALLVILVAGFSILFFFSGLLAPLLVA
FT                   IVLAYLLEWPTARLQAIGCSRRWAASIVLILFVGILLLMAFVVMPIAWQQGIYLIRDMP
FT                   GMLNKLSDFAATLPRRYPALMDAGIIDAMAENMRTRMLNMGDSVVKYSLASLVGLLTLA
FT                   VYLVLVPLMVFFLVKDKEQMLNAVRRVLPRNRGLAGQVWNEMNQQITNYIRGKVLEMVV
FT                   VGVATWLGFLLFGLNYSLLLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGLGTEFWSC
FT                   FAVYLIIQALDGNLLVPVLFSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKA
FT                   VVHAWPDGQVTDASS"
FT   gene            434714..435901
FT                   /pseudo
FT                   /locus_tag="t0365"
FT                   /note="corresponds to STY2732 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            435969..437237
FT                   /locus_tag="t0366"
FT   CDS_pept        435969..437237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0366"
FT                   /product="putative permease"
FT                   /note="corresponds to STY2731 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68084"
FT                   /db_xref="GOA:Q8Z4R5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R5"
FT                   /protein_id="AAO68084.1"
FT                   /translation="MTSISTLGAIAALVVAIVLILRKVSPAYGMMAGALVGGLIGGADL
FT                   LQTVSLMVSGAQGIVNAVLRILAAGVLAGVLIESGAANTIAETIVRKVGETRALLALAI
FT                   ATLCLTAVGVFIDVAVITVAPIALSIARNAGLSKSAILLAMVGGGKAGNVMSPNPNAIA
FT                   ASDAFHVPLTSIMLAGVVPGIVGLIIAYLLAKRLNNKGAGVADHEVTHHDDSVARPGFL
FT                   VAISAPLVAIFLLSLRPFVGISIDPLIALPVGGLVGLLLMGRARHCNQYMVAGLMRMAP
FT                   VAIMLLGTGTLAGIIANSELKDVLIHGLTASGLPSWLLAPVSGAMMSMATASTTAGTAV
FT                   ASGVFSPTLLELGVSALAGAAMIHAGATVLDHLPHGSFFHATGGSVNMQIHERLKLMPY
FT                   ETLVGLAITFISTLMFGFFGFAG"
FT   gene            437243..438382
FT                   /locus_tag="t0367"
FT   CDS_pept        437243..438382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2730 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68085"
FT                   /db_xref="GOA:Q8Z4R6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R6"
FT                   /protein_id="AAO68085.1"
FT                   /translation="MKIVIAPDSFKESLSAMAVAEAIEKGFREIYPDADYVKVPMADGG
FT                   EGTVQSMVEASGGRYVDQWVQGPLGQPVTARWGMLGDSDTAVIEMAAASGLHHVSPELR
FT                   NPLNTTSYGTGELIVAALERGVKRIILGIGGSATNDGGAGMMQALGVILRDKQGRSLSP
FT                   GGEALAALASIDLSGCHPLLRKVSITVACDVNNPLCGPQGASAIFGPQKGATAEMVNSL
FT                   DAALENWGRHIYQATGREVINAPGAGAAGGMGAALLGLLNAELRAGVEIVVETLQLEQA
FT                   VKDADLVITGEGRLDSQSICGKTPIGVARVAKRHHKPVIALAGGLQHDHHVVYQQGIDA
FT                   ALSILSHIVTLPEALHEAEYNLSLSARNVAAIWRLARQA"
FT   gene            complement(438429..438899)
FT                   /gene="bcp"
FT                   /locus_tag="t0368"
FT   CDS_pept        complement(438429..438899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="t0368"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="corresponds to STY2729 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68086"
FT                   /db_xref="GOA:Q8XF67"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XF67"
FT                   /protein_id="AAO68086.1"
FT                   /translation="MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPG
FT                   CTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDENHQVCEQFG
FT                   VWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA"
FT   gene            complement(438899..439537)
FT                   /gene="gcvR"
FT                   /locus_tag="t0369"
FT   CDS_pept        complement(438899..439537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvR"
FT                   /locus_tag="t0369"
FT                   /product="glycine cleavage system transcriptional
FT                   repressor"
FT                   /note="corresponds to STY2728 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68087"
FT                   /db_xref="GOA:Q8Z4R7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4R7"
FT                   /protein_id="AAO68087.1"
FT                   /translation="MLYAGFFYGFLKITSPLKGITGLTPSSQHYLVITALGADRPGIVN
FT                   TITRHVSSCGCNIEDSRLAMLGDEFTFIMLLSGTWNAITLIESTLPLKGAELDLLIVMK
FT                   RTSDRPRPAMPATVWVQVEVADSPHLIERFTALFNSHEMNIAELVSRTQPAEDDKAAQL
FT                   FIQITAHSPASQNSANIEQAFKALCTELNAQGSINVVNYSQHDEQDGVK"
FT   gene            439617..440495
FT                   /gene="dapA"
FT                   /locus_tag="t0370"
FT   CDS_pept        439617..440495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="t0370"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="corresponds to STY2727 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68088"
FT                   /db_xref="GOA:Q8Z4R8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4R8"
FT                   /protein_id="AAO68088.1"
FT                   /translation="MFTGSIVALVTPMDEKGNVSRSCLKKLIDYHVANGTSAIVSVGTT
FT                   GESATLSHDEHGDVVMMTLELADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVT
FT                   PYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRLAEIKNIIAIKEA
FT                   TGNLTRVHQIKELVSDDFILLSGDDASALDFMQLGGHGVISVTANVAARDMADMCKLAA
FT                   EGQFAEARAINQRLMPLHNKLFVEPNPIPVKWACKALGLVATDTLRLPMTPITDHGRDI
FT                   VKAALQHAGLL"
FT   gene            440512..441546
FT                   /gene="nlpB"
FT                   /locus_tag="t0371"
FT   CDS_pept        440512..441546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpB"
FT                   /locus_tag="t0371"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY2726 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68089"
FT                   /db_xref="GOA:Q83T79"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR014524"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T79"
FT                   /protein_id="AAO68089.1"
FT                   /translation="MAYSVQKSRLAKVAGVSLVLLLAACSSDSRYKRQVSGDESYLDAA
FT                   PLAELHAPAGMILPITTGDYVIPVTKGSGAVGKALDIRPPAQPLALVSGARTQFSGDTA
FT                   TLLVENGRSSTLWPQVVSVIQAKNYPIEKRDDASQTLTTDWVSWNRLDEDEQYRGRYQI
FT                   SVKPQGYQQAVTVKLVNLEQAGKPVADAASLQRYSTEMMNVISAGLDKTATDAANAAQN
FT                   RSAATMDVQSAADDTGLPMLVVRGPFNLVWQRLPAALEKVGMKVTDSTRSQGSMAVTYK
FT                   PLSDSDWRDLGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQA
FT                   AFNK"
FT   gene            441721..442434
FT                   /gene="purC"
FT                   /locus_tag="t0372"
FT   CDS_pept        441721..442434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="t0372"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="corresponds to STY2725 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68090"
FT                   /db_xref="GOA:P65890"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65890"
FT                   /protein_id="AAO68090.1"
FT                   /translation="MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDR
FT                   KGMVNNKFNHFIMTKLAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKR
FT                   LGVEEGMELNPPIFDLFLKNDALHDPMVNSSYCETFGWVSQENLARMKELTYKANDVLK
FT                   KLFDDAGLILVDFKLEFGLYKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLI
FT                   EAYEAVAHRLGVKLD"
FT   gene            442566..443429
FT                   /locus_tag="t0373"
FT   CDS_pept        442566..443429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0373"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2724 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68091"
FT                   /db_xref="GOA:Q8Z4S0"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S0"
FT                   /protein_id="AAO68091.1"
FT                   /translation="MRWQGRRESNNVEDRRNRPGGPSLGGPGFRLPRGKGGIILLVVVV
FT                   VAGYYGVDLTGLLTGQPVSQQQSTRSISPNDDEAAKFTSVILATTEDTWGQLFQKMGRG
FT                   YQQPKLVMYRGMTRTGCGAGQSVMGPFYCPADGTVYIDLSFYDVMKNKLGADGDFAQGY
FT                   VIAHEVGHHVQKLLGIEPKVRQLQQNASQTEVNRLSVRMELQADCFAGVWGHSMQQQGV
FT                   LEAGDLEEALNAAQAIGDDRLQQQGQGRVVPDSFTHGTSEQRYSWFKRGFDSGDPAQCN
FT                   TFGKNF"
FT   gene            443445..445460
FT                   /locus_tag="t0374"
FT   CDS_pept        443445..445460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2723 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68092"
FT                   /db_xref="GOA:Q8Z4S1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S1"
FT                   /protein_id="AAO68092.1"
FT                   /translation="MSDIDALRALTSQMTQEGIRRLLVISGDAAWCRERAEAIRAVLPG
FT                   DWWVAPDAPAQPRCTPQALQTLLGREFRHAIFDAWQGFDAAAFAALSGTLQAGSWLLLL
FT                   MPPYETWESRPDTDSLRWSDCAQPIPTPQFAQHLKRTLSRDPQTLLWRQRQPFCWPSYP
FT                   SRERWRPATGEPQPEQAAILSRLREMPPGVATVIAPRGRGKSALAGQFISQMAGTAIVT
FT                   APAKTATDILAAFAGERFCFMAPDALLASGARADWLVVDEAAAIPAPLLLQLVSRFPRI
FT                   LLTTTVQGYEGTGRGFLLKFCARFPQLHRFTLRQPVRWAPECPLENIVSEALIFDDEAF
FT                   AQAPHGGIAISAFYQQAWGKTPALPRAVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAT
FT                   ANNRVAGALWLVEEGGLSAELSQAVWCGFRRPRGNLVAQSLAAHGSDPLAATLVGRRVS
FT                   RIAVHPARQREGIGQQLIACACEQAAQCDYLSVSFGYTPELWRFWQRCGFVLVRMGSHR
FT                   EASSGCYTAMALLPLSDAGQRLAQQEHRRLRRDADILTQWNGEAIPLAALREQALNDED
FT                   WRELVGFAFAHRPLLTSLGCLHRLLQYSALPLPALRGRLEEKASDAELCARLRISGRKA
FT                   LLALQRAQAAQALIALDAGRTQRLRDVMPGGGDHAG"
FT   gene            complement(445487..445687)
FT                   /locus_tag="t0375"
FT   CDS_pept        complement(445487..445687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0375"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2722 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68093"
FT                   /db_xref="GOA:Q8XF02"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XF02"
FT                   /protein_id="AAO68093.1"
FT                   /translation="MDWLAKYWWILVLVFLVGVLLNVIKDLKRIDHKKFLANKPELPPH
FT                   RDFNDKWDDEDDWPKKDQPKK"
FT   gene            complement(445715..446842)
FT                   /gene="dapE"
FT                   /locus_tag="t0376"
FT   CDS_pept        complement(445715..446842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="t0376"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /note="corresponds to STY2721 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68094"
FT                   /db_xref="GOA:Q8Z4S2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4S2"
FT                   /protein_id="AAO68094.1"
FT                   /translation="MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDF
FT                   GDTQNFWAWRGRGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSL
FT                   AAMVVAAERFVAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEP
FT                   SSTEIVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRG
FT                   NDFFPATSMQIANIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLR
FT                   YTVDWWLSGQPFLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVEL
FT                   GPVNATIHKINECVNAADLQLLARMYQRIMEQLVA"
FT   gene            complement(446846..447202)
FT                   /gene="yffB"
FT                   /locus_tag="t0377"
FT   CDS_pept        complement(446846..447202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yffB"
FT                   /locus_tag="t0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2720 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68095"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S3"
FT                   /protein_id="AAO68095.1"
FT                   /translation="MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTF
FT                   IAELGWQPLLNTRGTTWRKLDEGHRSGITDADSAAALMVEQPAIIKRPLLCAPGKPMLL
FT                   GFSESRYQQFFDEV"
FT   gene            complement(447848..450961)
FT                   /gene="acrD"
FT                   /locus_tag="t0378"
FT   CDS_pept        complement(447848..450961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="t0378"
FT                   /product="putative efflux pump"
FT                   /note="corresponds to STY2719 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68096"
FT                   /db_xref="GOA:Q8Z4S4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S4"
FT                   /protein_id="AAO68096.1"
FT                   /translation="MANFFIDRPIFAWVLAILLCLTGALAIFSLPVEQYPDLAPPNVRI
FT                   TANYPGASAQTLENTVTQVIEQNMTGLDNLMYMSSQSSGTGQATITLSFIAGTDPDEAV
FT                   QQVQNQLQSAMRKLPQAVQDQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQ
FT                   DPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSFQMTTKDVTDAIESQNAQIAVGQLGGT
FT                   PSVDKQALNATINAQSLLQTPQQFRDITLRVNQDGSEVKLGDVATVELGAEKYDYLSRF
FT                   NGNPASGLGVKLASGANEMATAKLVLDRLNELAQYFPHGLEYKIAYETTSFVKASIIDV
FT                   VKTLLEAIALVFLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERIMSEEGLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGTTGAIYRQFSITIVSAMVLSVLVAMILTPALCATLLKPLHKGEQHGQRGFFGWFNR
FT                   TFNRNAERYEKGVAKILHRSLRWILIYVLLLGGMVFLFLRLPTSFLPQEDRGMFTTSIQ
FT                   LPSGSTQQQTLKVVEKVENYYFTHEKNNIMSVFSTVGSGPGGNGQNVARMFVRLKDWDA
FT                   RDPTTGSSFAIIERATKAFNQIKEARVFASSPPAISGLGSSAGFDMELQDHAGAGHDAL
FT                   MAARDQLIELAGKNSSLTRVRHNGLDDSPQLQIDIDQRKAQALGVSIDDINDTLQTAWG
FT                   SSYVNDFMDRGRVKKVYVQAAAKYRMLPDDINLWYVRNKDGGMVPFSAFATSRWETGSP
FT                   RLERYNGYSAVEIVGEAAPGVSTGTAMDVMESLVHQLPGGFGLEWTAMSYQERLSGAQA
FT                   PALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLATWMRGLENDVYFQVGLL
FT                   TVIGLSAKNAILIVEFANEMNQKGHALLDATLYASRQRLRPILMTSLAFIFGVLPMATS
FT                   TGAGSGSQHAVGTGVMGGMISATILAIFFVPLFFVLIRRRFPLKPRPE"
FT   gene            complement(451146..452846)
FT                   /gene="narQ"
FT                   /locus_tag="t0379"
FT   CDS_pept        complement(451146..452846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narQ"
FT                   /locus_tag="t0379"
FT                   /product="nitrate/nitrite sensor protein"
FT                   /note="corresponds to STY2718 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68097"
FT                   /db_xref="GOA:Q8Z4S5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S5"
FT                   /protein_id="AAO68097.1"
FT                   /translation="MTVKRPVSASLAKAFFYIVLLSILSTGSALLTLTSSLRDAEAINI
FT                   AGSLRMQSYRLGYDLQSRSPQINAHRQLFQHALNSPVLQNLNAWYVPQAVKTRYARLHA
FT                   NWLEMNSRLQDGDIVWYQSNINNYVDQIDLFVLALQHYAERKVMLVVAISLAGGIGIFT
FT                   LVFFTLRRIRQQVVRPLNQLVTASQRIEHGQFAPLPLDTSLPNELGLLAKTFSQMSSEL
FT                   HKLYRSLEASVEEKTHDLHEAHRRLEVLYQCSQALNTSQIDVHCFRHILQIVREHDAAW
FT                   YLELTVGDNWRISEGTQSPDLPMQMLPVTMQDTVYGELHWQSPNVNASTPLLNSVSTML
FT                   GRGLYFNQAQKHFQQLLLMEERATIARELHDSLAQVLSYLRIQLTLLKRAIPEDNAGAQ
FT                   SIMADFSRALNDAYRQLRELLTTFRLTLQQADLPSALHEMLEDLQSQTPAKLKLDCRLP
FT                   TLALDAQMQVHLLQIVREAVLNAIKHANASEIAVSCVTAPDGDHTVYIRDNGIGIGEPH
FT                   EPAGHYGLNIMRERAERLGGTLNFSQPSGGGTLVSISFRSSNKEESQLT"
FT   gene            453032..454891
FT                   /gene="aegA"
FT                   /locus_tag="t0380"
FT   CDS_pept        453032..454891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aegA"
FT                   /locus_tag="t0380"
FT                   /product="putative oxidoreductase"
FT                   /note="corresponds to STY2717 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68098"
FT                   /db_xref="GOA:Q8Z4S6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S6"
FT                   /protein_id="AAO68098.1"
FT                   /translation="MNRFIMANSQQCLGCHACEVACVMAHNDERHVLTPQRYQPRITVI
FT                   KHQRQRSAVTCHHCEDAPCARSCPNGAIAHINDSVQVNAQKCIGCKSCVVACPFGTMQM
FT                   VLTPVAPNQFKASAHKCDLCQGREQGPACVENCPADALQLVTEDSLTRLAKTRRLRTAR
FT                   QEIRPWHTVDTQHSGTACSKVERMQATPPRGEPDKLAIEARKTTFEEIYLPFRAAQAER
FT                   EAARCLTCGEHSICEWTCPLHNHIPQWIELVKAGDIDAAVELSHQTNCLPEITGRVCPQ
FT                   DRLCEGACTLRDEYGAVTIGNIERYISDRALSKGWRPDLSDVQKSDKRVAIIGAGPAGL
FT                   ACADVLARRREIFSAMGIRFELNCEVGKDISLETLLESYDAVFVGVGTYRSMKADLPNE
FT                   DAPGVYDALPFLIANTKQVMGLPALPDEPFIDTAGLNVVVLGGGDTAMDCVRTALRHGA
FT                   ANVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVELVLDTHGRASGIRFLRTRLG
FT                   EPDGQGRRRPVPVPDSEFVMPADAVIMAFGFHPHGMSWLESHGVKVDNWGRIAASVESE
FT                   FRYQTSNPKIFAGGDAVRGADLVVTAMAEGRHAAQGILDWLAK"
FT   gene            complement(455340..456638)
FT                   /locus_tag="t0381"
FT   CDS_pept        complement(455340..456638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0381"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2716 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68099"
FT                   /db_xref="GOA:Q8Z4S7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4S7"
FT                   /protein_id="AAO68099.1"
FT                   /translation="MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDG
FT                   WIQNQIDAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNT
FT                   KMYATNFALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPA
FT                   DPQYPNKNVAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMP
FT                   LDRYVETTIYKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQ
FT                   VHDEKAWYSMGGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDNKTVAQFTRRSPE
FT                   DATFGLGWRVNGNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSP
FT                   VANPKVNPNVFVSGLLPAATYGWIVDQIYGSLK"
FT   gene            456842..457417
FT                   /gene="yffH"
FT                   /locus_tag="t0382"
FT   CDS_pept        456842..457417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yffH"
FT                   /locus_tag="t0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2714 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68100"
FT                   /db_xref="GOA:Q8XG64"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XG64"
FT                   /protein_id="AAO68100.1"
FT                   /translation="MSQTITLIKDKILSDNYFTLRNITYDLTRRNGEVIRHKREVYDRG
FT                   NGATILLYNSTKKTVVLVRQFRVATWVNGNQDGMLIETCAGLLDNDEPEVCIRKEAIEE
FT                   TGYDVGEVRKIFELYMSPGGVTELIHFFIAEYHDSERASIGGGVEDEEIEVLELPFSRA
FT                   LEMVRSGEIRDGKTVLLLNYLQTSHLMD"
FT   gene            457542..458585
FT                   /locus_tag="t0383"
FT   CDS_pept        457542..458585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0383"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2713 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68101"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T78"
FT                   /protein_id="AAO68101.1"
FT                   /translation="MRYRVILFCLFGLLPVQLLWAAPAQRTFSDWQVTCNNQNFCVARN
FT                   TGEHHGLVMTLSRSAGARTDAVLRIDRGGLAPPDAKEAAIAPRLLLDGKPLSFNSSHWR
FT                   VSPWHLMTGDPATITAFLQTIQDAQAITLKNGVQTLSLAGLKAALLFIDAQQKRVGSET
FT                   AWIEKGNEPPLSVPPAPALKGIAVINPTPVPLSEEERDDLLDYAAWRVNGIRCSLDPLR
FT                   RETQVSALTDDKALLIVNCEAGAYNTIDLAWVVSRKKTLVSRAVRLRLPFNRGVESNDM
FT                   ELMNAFFDEKTRELVTLAKGRGLTDCGIQTRWRYDGDRFRLVRYAEEPSCDSWHGPDAW
FT                   PTLWITR"
FT   gene            458713..458943
FT                   /locus_tag="t0384"
FT   CDS_pept        458713..458943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0384"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2712 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFH0"
FT                   /protein_id="AAO68102.1"
FT                   /translation="MKINNGPVLCPHCGCLSAYYEIDRLAAIREKVNKEGGSAAWDSTL
FT                   QAHKKKAFCLMCHKSIDEVVIGQSDAPESTK"
FT   gene            complement(459006..461006)
FT                   /gene="tktB"
FT                   /locus_tag="t0385"
FT   CDS_pept        complement(459006..461006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktB"
FT                   /locus_tag="t0385"
FT                   /product="transketolase 2"
FT                   /note="corresponds to STY2711 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68103"
FT                   /db_xref="GOA:Q8Z4S9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4S9"
FT                   /protein_id="AAO68103.1"
FT                   /translation="MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLK
FT                   HNPTDPTWYDRDRFILSNSHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGY
FT                   TPGVETTTGPLGQGLANAVGLAIAERTLGAQFNRPDHEIVDHYTYVFMGDGCLMEGISH
FT                   EVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHAPEA
FT                   VKKAILEAQSVKDKPSLIICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHP
FT                   AFEIPKEIYRAWDGREKGEKAQQQWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESAT
FT                   QKFINDLQANPAKIATRKASQNTLNAYGPLLPELLGGSADLAPSNLTIWKGLTSLKEDP
FT                   AGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVY
FT                   THDSIGLGEDGPTHQAMEQLASLRLTPNFSTWRPCDQVEAAVGWKLAIERQHGPTALIL
FT                   SRQNLAQVERTPEQVKAIARGGYILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHN
FT                   VRVVSLPSTDIFDAQDEAYRESVLPAHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYG
FT                   ESAPADKLFPYFGFTVENIVEKARRVLNIKG"
FT   gene            complement(461026..461976)
FT                   /gene="talA"
FT                   /locus_tag="t0386"
FT   CDS_pept        complement(461026..461976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talA"
FT                   /locus_tag="t0386"
FT                   /product="transaldolase A"
FT                   /note="corresponds to STY2710 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68104"
FT                   /db_xref="GOA:Q8Z4T0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4T0"
FT                   /protein_id="AAO68104.1"
FT                   /translation="MNQLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE
FT                   QYGHLIEDAIAWGKKHGGTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDVRLSFDK
FT                   EKSIEKARHLVDLYQQQDVDKSRILIKLAATWEGIRAAEQLEKEGINCNLTLLFSFAQA
FT                   RACAEAGVYLISPFVGRIYDWYQARSPLEPYVVEEDPGVKSVRNIYDYFKQHRYETIVM
FT                   GASFRRTEQILALTGCDRLTISPNLLKELKEKEEPVIRKLVPSSQMFHRPTPMTEAEFR
FT                   WEHNQDAMAVEKLSEGIRLFAVDQRKLEDLLAAKL"
FT   gene            462248..464527
FT                   /gene="maeB"
FT                   /locus_tag="t0387"
FT   CDS_pept        462248..464527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="t0387"
FT                   /product="NADP-dependent malate dehydrogenase"
FT                   /note="corresponds to STY2709 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68105"
FT                   /db_xref="GOA:Q8Z4T1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T1"
FT                   /protein_id="AAO68105.1"
FT                   /translation="MDEQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIEKDPLAAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   DVFDIEVDELDPDKFINVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSK
FT                   GVIYKGREPNMAETKAAYAVDDSGKRTLDEVIDGADIFLGCSGPKVLTQEMVKKMARAP
FT                   MILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAIN
FT                   EEMKLAAVRAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIADFDAYIDKLTEFVYKTNLFMKPIFSQARKDPKRVVLPEGEEARVLHA
FT                   TQELITLGLAKPILIGRPSVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWSEYYQI
FT                   MKRRGVTQEQAQRAMIGNHTAIGAIMVQRGEADAMICGTIGDYHEHFSVVKAVFGYRDG
FT                   VHTAGAMNALLLPSGNTFIADTYVNEDPTPEQLAEIAVMAAETVRRFGIEPKVALLSHS
FT                   NFGSSNSLSASKMRETLERVRERAPDLMIDGEMHGDAALVESIRNDRMPDSPLKGAANI
FT                   LVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVSKPVHVLTPIASVRRIVNMVALAVVE
FT                   AQTTPL"
FT   gene            464716..465174
FT                   /gene="tnpA"
FT                   /locus_tag="t0388"
FT   CDS_pept        464716..465174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="t0388"
FT                   /product="transposase for insertion sequence element IS200"
FT                   /note="corresponds to STY2707 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68106"
FT                   /db_xref="GOA:Q8Z4T2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T2"
FT                   /protein_id="AAO68106.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLC
FT                   EWKNVRILEAECCADHIYMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            465655..465990
FT                   /gene="eutS"
FT                   /locus_tag="t0389"
FT   CDS_pept        465655..465990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutS"
FT                   /locus_tag="t0389"
FT                   /product="putative ethanolamine utilization protein EutS"
FT                   /note="corresponds to STY2706 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68107"
FT                   /db_xref="GOA:Q8Z4T3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4T3"
FT                   /protein_id="AAO68107.1"
FT                   /translation="MNKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMT
FT                   LTPGETAMIAGDLAMKAADVHIGFLDRFSGALVIYGTVGAVEEALLQTVSGLGRLLNFT
FT                   LCELTKS"
FT   gene            466003..466482
FT                   /gene="eutP"
FT                   /locus_tag="t0390"
FT   CDS_pept        466003..466482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutP"
FT                   /locus_tag="t0390"
FT                   /product="putative ethanolamine utilization protein EutP"
FT                   /note="corresponds to STY2705 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68108"
FT                   /db_xref="GOA:P0A209"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A209"
FT                   /protein_id="AAO68108.1"
FT                   /translation="MKRIAFVGAVGAGKTTLFNALRGNYSLARKTQAVEFNDHGDIDTP
FT                   GEYFSHPRWYHALITTLQDVDTLIYVHAANDKESRLPAGLLDVGTRKRHIAVISKTDMP
FT                   DADVAATRQLLCEIGFREPIFELNGHDPQSVRQLVDYLAALSEQEEEAGEKTYHS"
FT   gene            466460..467149
FT                   /gene="eutQ"
FT                   /locus_tag="t0391"
FT   CDS_pept        466460..467149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutQ"
FT                   /locus_tag="t0391"
FT                   /product="putative ethanolamine utilization protein EutQ"
FT                   /note="corresponds to STY2704 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68109"
FT                   /db_xref="GOA:Q8Z4T4"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T4"
FT                   /protein_id="AAO68109.1"
FT                   /translation="MKKLITANDIRAAHARGEQAMSVVLRASIITPEAREVAELLGFTI
FT                   TECDESVPASTSAQACKSESQRIREAIIAQRPEGQFTESLVAQLMEKVLKEKQSLELGT
FT                   MQPSFTSVTGKGGVKVIDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSMAAGFMQWDNA
FT                   FFPWTLNYDEIDMVLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTPTSVRFLYVAW
FT                   PANWQSV"
FT   gene            467146..467943
FT                   /locus_tag="t0392"
FT   CDS_pept        467146..467943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0392"
FT                   /product="putative cobalamin adenosyltransferase"
FT                   /note="corresponds to STY2703 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68110"
FT                   /db_xref="GOA:Q8Z4T5"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T5"
FT                   /protein_id="AAO68110.1"
FT                   /translation="MNDFITETWLRANHTLSEGSEIHLPADARLTPSARELLESRRLRI
FT                   KFLDQQGRLFVDDDEQQPVHGLTSSDTHPQACCELCRQPVVKKPDTLTHLTADKMVAKS
FT                   DPRLGFRAALDSAIALTVWLQIELAEPWQPWLFDIRSRLGNIMRADAIDEPLAAQSIVG
FT                   LNEDELHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETLAAQVFITRSFE
FT                   VLRPDILQALNRLSSTVYVMMILSVAKHPLTVAQIQQRLGEKP"
FT   gene            467940..468956
FT                   /gene="eutD"
FT                   /locus_tag="t0393"
FT   CDS_pept        467940..468956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutD"
FT                   /locus_tag="t0393"
FT                   /product="putative phosphate acyltransferase"
FT                   /note="corresponds to STY2702 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68111"
FT                   /db_xref="GOA:Q8Z4T6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T6"
FT                   /protein_id="AAO68111.1"
FT                   /translation="MIIERARELAVRAPARVVFPDALDERVLKAAHYLQQCGLARPVLV
FT                   ASPFALRQFALSHRMAMDGIQVIDPHSNLSMRQRFAQRWLARAGEKTPPDAVEKLSDPL
FT                   MFAAAMVSAGEADVCIAGNLSSTANVLRAGLRVIGLQPGCKTLSSIFLMLPQYAGPALG
FT                   FADCSVVPQPTAAQLADIAIASADTWRAITGEEPRVAMLSFSSNGSARHPNVANVQQAT
FT                   EFVRERAPQLLVDGELQFDAAFVPEVAAQKAPDSPLQGRANVMIFPSLEAGNIGYKIAQ
FT                   RLGGYRAVGPLIQGLAAPLHDLSRGCSVQEIIELALVAAVPRQADVSRERSLHTLVE"
FT   gene            468997..469686
FT                   /gene="eutN"
FT                   /locus_tag="t0394"
FT   CDS_pept        468997..469686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutN"
FT                   /locus_tag="t0394"
FT                   /product="putative ethanolamine utilization protein EutN"
FT                   /note="corresponds to STY2701 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68112"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T7"
FT                   /protein_id="AAO68112.1"
FT                   /translation="MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLCTAMV
FT                   RGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGAATFDGRPDKTR
FT                   SVAIRHECAPLPDSAQIQGLRPNGQSMEADMKLAVVTGQIVCTVRHQGLAHDKLLMVEM
FT                   IDAQGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDEVVAG
FT                   GKVVFHK"
FT   gene            469698..471101
FT                   /gene="eutE"
FT                   /locus_tag="t0395"
FT   CDS_pept        469698..471101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutE"
FT                   /locus_tag="t0395"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="corresponds to STY2700 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68113"
FT                   /db_xref="GOA:Q8Z4T8"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T8"
FT                   /protein_id="AAO68113.1"
FT                   /translation="MNQQDIEQVVKAVLLKMKDSSQPASTVHEMGVFASLDDEVAAAKR
FT                   AQQGLKSVAMRQLAIHAIREAGEKHARELAELAVSETGMGRVDDKFAKNVAQARGTPGV
FT                   ECLSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINNAISLIAAGNSVVFAPHPA
FT                   AKKVSQRAITLLNQAVVAAGGPENLLVTVANPDIETAQRLFKYPGIGLLVVTGGEAVVD
FT                   AARKHTNKRLIAAGAGNPPVVVDETADLPRAAQSIVKGASFDNNIICADEKVLIVVDSV
FT                   ADELMRLMEGQHAVKLTAAQAEQLQPVLLKNIDERGKGTVSRDWVGRDAGKIAAAIGLN
FT                   VPDQTRLLFVETPANHPFAVTEMMMPVLPVVRVANVEDAIALAVQLEGGCHHTAAMHSR
FT                   NIDNMNQMANAIDTSIFVKNGPCIAGLGLGGEGWTTMTITTPTGEGVTSARTFVRLRRC
FT                   VLVDAFRIV"
FT   gene            471112..471951
FT                   /gene="eutJ"
FT                   /locus_tag="t0396"
FT   CDS_pept        471112..471951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutJ"
FT                   /locus_tag="t0396"
FT                   /product="putative ethanolamine utilization protein EutJ"
FT                   /note="corresponds to STY2699 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68114"
FT                   /db_xref="GOA:P0A207"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A207"
FT                   /protein_id="AAO68114.1"
FT                   /translation="MAHDEQLWLTPRLQKAAALCNQTPAASDTPLWLGVDLGTCDVVSM
FT                   VVDGNAQPVAVCLDWADVVRDGIVWDFFGAVTLVRRHLDTLEQQLGCRFTHAATSFPPG
FT                   TDPRISINVLESAGLEVSHVLDEPTAVADLLALDNAGVVDIGGGTTGIAIVKQGKVTYS
FT                   ADEATGGHHISLTLAGNRRIPLEEAEQYKRSNAQEIWPVVKPVYEKMAEIVARHIEGQG
FT                   IADLWLAGGSCMQPGVEALFRQRFPELQVHLPQHSLFMTPLAIANSGRAKAEGLYAS"
FT   gene            471941..473128
FT                   /gene="eutG"
FT                   /locus_tag="t0397"
FT   CDS_pept        471941..473128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutG"
FT                   /locus_tag="t0397"
FT                   /product="putative alchohol dehydrogenase"
FT                   /note="corresponds to STY2698 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68115"
FT                   /db_xref="GOA:Q8Z4T9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4T9"
FT                   /protein_id="AAO68115.1"
FT                   /translation="MQAELQTALFQAFNTLNLQRVKTFSVPPVTLCGLGALGACGQEAQ
FT                   ARGVSHLFVMVDSFLHQAGMTAPLARSLAMKGVAMTVWPCPPGEPCITDVCAAVAQLRE
FT                   AACDGVVAFGGGSVLDAAKAVALLVTNPDQTLSAMTERSTLRPRLPLIAVPTTAGTGSE
FT                   TTNVTVIIDAVSGRKQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYS
FT                   ALNATPFTDSLAIGAIAMIGKSLPKAVGYGQDLAARENMLLASCMAGMAFSSAGLGLCH
FT                   AMAHQPGAALHIPHGQANAMLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVC
FT                   ELIAEVGQSKRLADAGAKPEHYSAWAQAALEDICLRSNPRTATQAQIIDLYAAAG"
FT   gene            473247..474473
FT                   /gene="eutH"
FT                   /locus_tag="t0398"
FT   CDS_pept        473247..474473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutH"
FT                   /locus_tag="t0398"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2697 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68116"
FT                   /db_xref="GOA:Q8Z4U0"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U0"
FT                   /protein_id="AAO68116.1"
FT                   /translation="MGINEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEESG
FT                   GQFEEGFMAMGALGLAMVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMG
FT                   GFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIV
FT                   TIPIGCIAGGLIAMYSGVQINGQPVEFTFALILMNMIPVLIVAVLVALGLKFIPEKMIN
FT                   GFQIFAKFLVALITIGLAAAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSIS
FT                   CVLLGAYPMVLLLTRWFEKPLMNVGKLLNVNNIAAAGMVATLANNIPMFGMMKQMDTRG
FT                   KVINCAFAVSAAFALVDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKDDAAQ
FT                   VKTEAEAQS"
FT   gene            474470..475873
FT                   /gene="eutA"
FT                   /locus_tag="t0399"
FT   CDS_pept        474470..475873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutA"
FT                   /locus_tag="t0399"
FT                   /product="putative ethanolamine utilization protein EutA"
FT                   /note="corresponds to STY2696 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68117"
FT                   /db_xref="GOA:Q8Z4U1"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U1"
FT                   /protein_id="AAO68117.1"
FT                   /translation="MNTRQLLSVGIDIGTTTTQVIFSRLELVNRAAVSQVPRYEFIKRD
FT                   ISWQSPVFFTPVDKQGGLKEAELKALILAQYQAAGIAPESVDSGAIIITGESAKTRNAR
FT                   PAVMALSQSLGDFVVASAGPHLESVIAGYGAGAQSLSEQRMCRVLNIDIGGGTSNYALF
FT                   DAGKVSGTACLNVGGRLLETDAQGRVVYAHQPGQMIIDEVFGSGTDARALAAAQLGQVA
FT                   RRMADLIVEVITGALSPLAQSLMQTGLLPADITPEVITLSGGVGECYRNQPADPFCFSD
FT                   IGPLLATALHEHPRLREMNVQFPAQTVRATVIGAGAHTLSLSGSTIWLEDVQLPLRNLP
FT                   VAIPQDDADLVNAWRQALLQLDLDPQTDAYVLALPSTLPVRYAALLTVINALTAFVARY
FT                   PNPHPLLVVAEQDFGKALGMLLRPQLPQLPLAVIDEVVVRAGDYIDIGTPLFGGSVVPV
FT                   TVKSLAFPS"
FT   gene            475885..477246
FT                   /gene="eutB"
FT                   /locus_tag="t0400"
FT   CDS_pept        475885..477246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="t0400"
FT                   /product="ethanolamine ammonia-lyase heavy chain"
FT                   /note="corresponds to STY2695 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68118"
FT                   /db_xref="GOA:Q8Z4U2"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U2"
FT                   /protein_id="AAO68118.1"
FT                   /translation="MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERV
FT                   AAKQVLSEMTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDE
FT                   TSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQP
FT                   NDTRDDVQSIAAQIYEGLSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQG
FT                   CVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGE
FT                   NCLYFETGQGSALSAGANFGADQVTMEARNYGLARYYDPFLVNTVVGFIGPEYLYNDRQ
FT                   IIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDD
FT                   IMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMANGRLTKRAGDPSLFF"
FT   gene            477265..478161
FT                   /gene="eutC"
FT                   /locus_tag="t0401"
FT   CDS_pept        477265..478161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="t0401"
FT                   /product="ethanolamine ammonia-lyase light chain"
FT                   /note="corresponds to STY2694 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68119"
FT                   /db_xref="GOA:Q8Z4U3"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4U3"
FT                   /protein_id="AAO68119.1"
FT                   /translation="MDQKQIEEIVRSVMASMGQDVPQPVAPSTQEGAKPQCAAPTVTES
FT                   CALDLGSAEAKAWIGVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSR
FT                   SKDTVLKEVPEEWGKAQGLLEVRSEISDKNLYLTRPDMGRRLSPEAIDALKSQCVMNPD
FT                   VQVVVSDGLSTDAITANYEEILPPLLAGLKQAGLNVGTPFFVRYGRVKIEDQIGEILGA
FT                   KVVILLVGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQGGTPPVEAAAVIVD
FT                   LAKRMLEQKASGINMTR"
FT   gene            478171..478830
FT                   /gene="eutL"
FT                   /locus_tag="t0402"
FT   CDS_pept        478171..478830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutL"
FT                   /locus_tag="t0402"
FT                   /product="ethanolamine utilization protein EutL"
FT                   /note="corresponds to STY2693 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68120"
FT                   /db_xref="GOA:P0A1D0"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1D0"
FT                   /protein_id="AAO68120.1"
FT                   /translation="MPALDLIRPSVTAMRVIASVNDGFARELKLPPHIRSLGLITADSD
FT                   DVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMV
FT                   ASIENGAAFQWANDAENTAFLAHVVSRTGSYLSSTAGIALGDPMAYLVAPPLEATFGID
FT                   AAMKSADVQLVTYVPPPSETNYSAAFLTGSQAACKAACNAFTDAVLDIARNPVQRA"
FT   gene            478843..479337
FT                   /gene="eutK"
FT                   /locus_tag="t0403"
FT   CDS_pept        478843..479337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutK"
FT                   /locus_tag="t0403"
FT                   /product="ethanolamine utilization protein EutK"
FT                   /note="corresponds to STY2692 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68121"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR032298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U4"
FT                   /protein_id="AAO68121.1"
FT                   /translation="MINALGLLEVDGMVAAVDAADAMLKAANVRLLSHQVLDPGRLTLV
FT                   VEGDLAACRAALDAGSAAAQHTGRVISRKEIGRPEEDTQWLIGGFARATTPTEKAPQVP
FT                   ATPEFAEALLALLASVRQGMTAGEVAAHFGWPLEQARNVLEQLFSDGALRKRSSRYRIK
FT                   N"
FT   gene            479385..480437
FT                   /gene="yfeG"
FT                   /locus_tag="t0404"
FT   CDS_pept        479385..480437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeG"
FT                   /locus_tag="t0404"
FT                   /product="ethanolamine operon transcriptional regulator"
FT                   /note="corresponds to STY2691 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68122"
FT                   /db_xref="GOA:Q8Z4U5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U5"
FT                   /protein_id="AAO68122.1"
FT                   /translation="MKKTRTANLHHLYHEALPEDVKLTPRVEVDNVHQRRTTDVYEHAL
FT                   TITAWQQIYDQLHLGKFHGEFTEILLDEIQVFREYTGLALRQSCLVWPNSFWFGIPATR
FT                   GEQGFIGAQGLGSAEIATRPGGTEFELSTPDDYTILGVVISEDVISRQATFLHNPERVL
FT                   HMLRNQLALEVKEQHKAALWGFVQQALATFSESPETLHQPAVRKVLSDNLLLAMGTMLE
FT                   EAKPIHSAESISHQGYRRLLSRAREYVLENMSEPLTVLDLCNQLHVSRRTLQNAFHAIL
FT                   GIGPNAWLKRIRLNAVRRELISPWSQSTTVRDAAMQWGFWHLGQFATDYQQLFAEKPSL
FT                   TLHQRMRQWA"
FT   gene            complement(480637..481914)
FT                   /locus_tag="t0405"
FT   CDS_pept        complement(480637..481914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0405"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2690 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68123"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U6"
FT                   /protein_id="AAO68123.1"
FT                   /translation="MDERIPCKNPQCSHFILPATAARTEGYCMPCVQARYRQEQEEYIR
FT                   KNRKTIDAFSGITNPVEMLKLVHEPREHDPLIEWIPCPIPTDELYKKLSDDESRDMVDY
FT                   AEELFDSGWQEEAQEIALCLAAFTQANLDNFLRQVINEEELELSSPLPFHRAPPDVRDA
FT                   LLQKVETDDENRDGILCALAWIGDEVVVEHFNRWRQEPPAWSASLHILPHRYAHQAGWE
FT                   LTENGRRRDLYFTQCTHLVKQAPEQPAVFRAVAEYGENCPHCSLPLINLFEVAPSAVGL
FT                   STQGWPGQIRILTCQCCTAYNTVFATVDPQGQPRWYEKNALSTLAVENSSDWITLPLDV
FT                   LHPGESRLPLFAAEIFLPTTFSQLGGHPAWVQDTDYPTCPTCAQTMMFLAQLSYEDIEE
FT                   EEYAEGMLYGFICPSCQTTATSYQQT"
FT   gene            complement(482043..482372)
FT                   /locus_tag="t0406"
FT   CDS_pept        complement(482043..482372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0406"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2689 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68124"
FT                   /db_xref="GOA:Q8Z4U7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U7"
FT                   /protein_id="AAO68124.1"
FT                   /translation="MQTNTRKVVTSDAKWHPHLGISFIGCLLAITLEIYFEERIFIPHS
FT                   GGVSFGLIVLLVINMVTIPVVMALIALLCFIIHIPRKSVNCILLCLLACILTIAGLFIA
FT                   YPVGR"
FT   gene            complement(482393..483292)
FT                   /gene="hemF"
FT                   /locus_tag="t0407"
FT   CDS_pept        complement(482393..483292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="t0407"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="corresponds to STY2688 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68125"
FT                   /db_xref="GOA:Q8Z4U8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4U8"
FT                   /protein_id="AAO68125.1"
FT                   /translation="MKPDAHHVKQFLLRLQDDICQTLSAVDGANFIEDSWRREAGGGGR
FT                   SRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPT
FT                   SHANVRFFIAEKPGADPVWWFGGGFDLTPYYGFEEDAVHWHRTARDLCQPFGDDVYPRY
FT                   KKWCDDYFFLKHRNEQRGIGGLFFDDLNTPDFDHCFAFMQAVGNGYTEAYLPIVERRKA
FT                   MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDWQPE
FT                   AGSPEAALSEFIQVRDWI"
FT   gene            complement(483295..484164)
FT                   /gene="amiA"
FT                   /locus_tag="t0408"
FT   CDS_pept        complement(483295..484164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiA"
FT                   /locus_tag="t0408"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase"
FT                   /note="corresponds to STY2687 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68126"
FT                   /db_xref="GOA:Q8Z4U9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4U9"
FT                   /protein_id="AAO68126.1"
FT                   /translation="MSTFKLLKTLTSRRQVLKTGLAALTLSGMSHAIAKEETLKTSNGH
FT                   SKPKTKKTGSKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGIDARL
FT                   TRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYL
FT                   SERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPIHKLHSRT
FT                   TEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIATAIANGIISYFHWFDN
FT                   QKAHTKKR"
FT   gene            484377..484802
FT                   /locus_tag="t0409"
FT   CDS_pept        484377..484802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0409"
FT                   /product="putative acetyltransferase"
FT                   /note="corresponds to STY2686 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68127"
FT                   /db_xref="GOA:P63424"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="InterPro:IPR023072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63424"
FT                   /protein_id="AAO68127.1"
FT                   /translation="MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKVNHDVSLF
FT                   LVAEVSGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQ
FT                   IMVRDDNDVVLGMYERLGYEHSDALSLGKRLIEDEEY"
FT   gene            484789..485238
FT                   /locus_tag="t0410"
FT   CDS_pept        484789..485238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2685 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68128"
FT                   /db_xref="GOA:Q8Z4V1"
FT                   /db_xref="InterPro:IPR021318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V1"
FT                   /protein_id="AAO68128.1"
FT                   /translation="MKSTEFHPADYDVHGCLRLPFLFWCVLLLQARAWVLFVIAGSSRG
FT                   QGNTLLNFFYPDHDNFWLGLLPGVPAVVAFLLSGRREAVPGVWRWLRGLLILAQLVSLC
FT                   WLPVMWLGGDPVNGVGLALLLADIVALIWLLTNQRLRACFSLEKE"
FT   gene            485300..485875
FT                   /locus_tag="t0411"
FT   CDS_pept        485300..485875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0411"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY2684 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68129"
FT                   /db_xref="InterPro:IPR010938"
FT                   /db_xref="InterPro:IPR038714"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V2"
FT                   /protein_id="AAO68129.1"
FT                   /translation="MKSLRLTLLALPLALTGCSTLSSVNWSAANPWNWFGSSTEVTEQG
FT                   VGALTAATPLEEPAIAEALDGDYRLRSGMKTDNGNVVRFFEAMKGDSVAMVINGEQGTV
FT                   SRIDVLDSDIPTAAGGKIGTPFSDLYSKAFGHCEPVSSDSHTSVECKAEGSQHISYVFS
FT                   GEWSGPEGLMPPDDVLKNWDVRKIIWRR"
FT   gene            485970..486869
FT                   /locus_tag="t0412"
FT   CDS_pept        485970..486869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2683 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68130"
FT                   /db_xref="GOA:Q8XGB1"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGB1"
FT                   /protein_id="AAO68130.1"
FT                   /translation="MSQVQSGILPEHCRAAIWIEANVKGDLDALRAASRTFADKLATFE
FT                   VKFPDAHLGAVVAFGNNTWRALSGGVGAEELKDFIPYGKGLAPATQYDVLIHILSLRHD
FT                   VNFSVAQAAMEAFGDCIDVKEEVHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDG
FT                   VDAGGSYVFVQRWEHNLKQLNRMSIHDQEMMIGRTKEANEEIDGDARPATSHLSRVDLK
FT                   EDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTK
FT                   PVTGGYYFAPSLDRLLAL"
FT   gene            487106..487897
FT                   /gene="yfeF"
FT                   /locus_tag="t0413"
FT   CDS_pept        487106..487897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeF"
FT                   /locus_tag="t0413"
FT                   /product="putative oxidoreductase"
FT                   /note="corresponds to STY2682 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68131"
FT                   /db_xref="GOA:P0A2D2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2D2"
FT                   /protein_id="AAO68131.1"
FT                   /translation="MGKLTGKTALITGASQGIGEGIARVFARHGANLILLDISDEIEKL
FT                   ADELGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEE
FT                   DRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMVADPGETAYALSKAAIV
FT                   GLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDPESVLTEMAKAIPLRRLA
FT                   DPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV"
FT   gene            488055..489071
FT                   /gene="cysP"
FT                   /locus_tag="t0414"
FT   CDS_pept        488055..489071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="t0414"
FT                   /product="thiosulphate-binding protein precursor"
FT                   /note="corresponds to STY2681 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68132"
FT                   /db_xref="GOA:Q8Z4V3"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V3"
FT                   /protein_id="AAO68132.1"
FT                   /translation="MAVNLLKKRLLTLAAMLLLAGQAQATELLNSSYDVSRELFAALNP
FT                   PFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIP
FT                   ADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYL
FT                   AAWGAADNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVN
FT                   NIRKQYEAQGFEVVIPKTNILAEFPVAWVDKYVKANGTEKAAKAYLNWLYSPQAQTIIT
FT                   HYYYRVNNPEIMGKQADKFPQTGLFRVEDKFGTWPEVMKTHFASGGELDKLLAAGRK"
FT   gene            489071..489904
FT                   /gene="cysU"
FT                   /locus_tag="t0415"
FT   CDS_pept        489071..489904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysU"
FT                   /locus_tag="t0415"
FT                   /product="sulphate transport system permease protein CysT"
FT                   /note="corresponds to STY2680 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68133"
FT                   /db_xref="GOA:Q8Z4V4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V4"
FT                   /protein_id="AAO68133.1"
FT                   /translation="MLAVSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWS
FT                   QYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPF
FT                   ALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVL
FT                   EELGPEYEEAAQTLGATRLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNI
FT                   AWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH"
FT   gene            489904..490779
FT                   /gene="cysW"
FT                   /locus_tag="t0416"
FT   CDS_pept        489904..490779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="t0416"
FT                   /product="sulphate transport system permease protein CysW"
FT                   /note="corresponds to STY2679 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68134"
FT                   /db_xref="GOA:Q8Z4V5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V5"
FT                   /protein_id="AAO68134.1"
FT                   /translation="MAEVTQLKRYDVPRINWGKWFLIGVGMLVSAFILLVPMIYIFVQA
FT                   FSKGLMPVLQNLADPDMLHAIWLTVLIALIAVPMNLVFGILLAWLVTRFNFPGRQLLLT
FT                   LLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQMMFSWPGMVLVTIFVTCPFVVR
FT                   ELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVS
FT                   VVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEK
FT                   RAQQEENHEH"
FT   gene            490769..491863
FT                   /gene="cysA"
FT                   /locus_tag="t0417"
FT   CDS_pept        490769..491863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="t0417"
FT                   /product="sulphate transport ATP-binding protein CysA"
FT                   /note="corresponds to STY2678 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68135"
FT                   /db_xref="GOA:Q8Z4V6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4V6"
FT                   /protein_id="AAO68135.1"
FT                   /translation="MSIEIARIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLL
FT                   RIIAGLEHQSSGHIRFHGTDVSRLHARERKVGFVFQHYALFRHMTVFDNIAFGLTVLPR
FT                   RDRPTAAAIKTKVTQLLEMVQLAHLADRFPAQLSGGQKQRVALARALAVEPQILLLDEP
FT                   FGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPD
FT                   RVWREPATRFVLEFMGEVNRLTGTVRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVD
FT                   ISRRTSLDSPLPVQVIEASPKGHYTQLVVQPLGWYHDPLTVVMAGDDVPQRGERLFVGL
FT                   QNARLYHGDQRIEPHEALALAESA"
FT   gene            491984..492895
FT                   /gene="cysM"
FT                   /locus_tag="t0418"
FT   CDS_pept        491984..492895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="t0418"
FT                   /product="cysteine synthase B"
FT                   /note="corresponds to STY2677 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68136"
FT                   /db_xref="GOA:Q8Z4V7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V7"
FT                   /protein_id="AAO68136.1"
FT                   /translation="MNTLEQTIGNTPLVKLQRLGPDNGSEIWVKLEGNNPAGSVKDRAA
FT                   LSMIVEAEKRGEIKPGDALIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMR
FT                   AYGAELILVTKEQGMEGARDLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTS
FT                   GRITHFVSSMGTTGTITGVSRFLREQEKTVTIVGLQPEEGSSIPGIRRWPTEYMPGIFN
FT                   ASLVDEVLDIHQNDAENTMRELAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICD
FT                   RGDRYLSTGVFGEEHFSQGAGI"
FT   gene            complement(492928..493305)
FT                   /locus_tag="t0419"
FT   CDS_pept        complement(492928..493305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0419"
FT                   /product="putative exported protein"
FT                   /note="corresponds to STY2676 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68137"
FT                   /db_xref="InterPro:IPR035242"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V8"
FT                   /protein_id="AAO68137.1"
FT                   /translation="MKKDFTMKKIVCAVVALLLTLPAWAKLNAHEEARINAMLNVLAQK
FT                   KDLTFVRNGDAHNCEEAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKIPG
FT                   KSDENAQPYLHALIAETDKTL"
FT   gene            complement(493364..494083)
FT                   /locus_tag="t0420"
FT   CDS_pept        complement(493364..494083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0420"
FT                   /product="putative amidotransferase"
FT                   /note="corresponds to STY2675 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68138"
FT                   /db_xref="GOA:Q8Z4V9"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4V9"
FT                   /protein_id="AAO68138.1"
FT                   /translation="MRVHFVIHESFESAGAYLKWAEDRGYTISWSRVYAGEALPPNADE
FT                   FDMLVVFGGPQSPRTTREECPYFDSQAEQHLINQAISARKIVVGICLGSQLIGEALGAK
FT                   VCQSPEKEIGHYPIVLTEAGQQHPLFNHFGSPLIVGHWHNDMPGLTDQAIILATSEGCP
FT                   RQIVQYGNFVYGFQCHMEFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRAWNYQQMN
FT                   EKLWRFLDELTLAHSQK"
FT   gene            complement(494098..495390)
FT                   /gene="ptsJ"
FT                   /locus_tag="t0421"
FT   CDS_pept        complement(494098..495390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsJ"
FT                   /locus_tag="t0421"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2674 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68139"
FT                   /db_xref="GOA:Q8Z4W0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W0"
FT                   /protein_id="AAO68139.1"
FT                   /translation="MIDGKTANEIFDSIRQHIIAGTLRAKDSLPPVRELASELKVNRNT
FT                   VAAAYKRLITAGLAQSLGRNGTVIKGSPSPVALEGGDPHTPLHDLSGGNPDPQRLPDLS
FT                   RYFARLSRTPHLYGDAPVSPELHAWAARWLRDATPVAGEIDITSGAIDAIERLLCAHLL
FT                   PGDSVAVEDPCFLSSINMLRYAGFSASPVSVDSEGMQPEKLEQALNQGARAVILTPRAH
FT                   NPTGCSLSARRAAALQNILARYPQVLVIIDDHFALLSSSPWQPVIAQTTQHWAVIRSVS
FT                   KALGPDLRLAIVASDSSTSAKLRLRLNAGSQWVSHLLQDLVYACLTDPEYQHRLAQTRL
FT                   FYATRQQKLARALQQYGIAISPGDGVNAWLPLDTHSQATAFTLAKSGWLVREGEAFGVS
FT                   APSHGLRITLSTLNDGEINTLAADIHQALNR"
FT   gene            495473..496339
FT                   /gene="pdxK"
FT                   /locus_tag="t0423"
FT   CDS_pept        495473..496339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxK"
FT                   /locus_tag="t0423"
FT                   /product="pyridoxine kinase"
FT                   /note="corresponds to STY2672 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68140"
FT                   /db_xref="GOA:Q8Z4W1"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023479"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4W1"
FT                   /protein_id="AAO68140.1"
FT                   /translation="MGQESDIQSVLFDDNHRALQTDIVAVQSQVVYGSVGNSIAVPAIK
FT                   AQGLRVTAVPTVLFSNTPHYKTFYGGIIPAEWFAGYLTALNERDALRELKAITTGYMGS
FT                   ADQIVLLSKWLMAIRASHPEVCILVDPVIGDTDSGMYVQAEIPQAYRTHLLPQAQGLTP
FT                   NVFELEMLSGKPCRTLEEAVAAAQSLLSDTLKWVVITSAPGESLETITVAVVTAQVVEV
FT                   FAHPRVATELKGTGDLFCAELVSGIVQGKKLTTAAKDAAQRVLEVMTWTQQCGCDELIL
FT                   PPAGEAR"
FT   gene            496336..496575
FT                   /locus_tag="t0422"
FT   CDS_pept        496336..496575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0422"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2671 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W2"
FT                   /protein_id="AAO68141.1"
FT                   /translation="MKSYRLVVRQQGRIVGHFETSGLDALEDICVARAMFGITGGYQCE
FT                   LQVSDSERRILESGPDGMKILMREKCFRPVTSQL"
FT   gene            complement(496725..497234)
FT                   /gene="crr"
FT                   /locus_tag="t0424"
FT   CDS_pept        complement(496725..497234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crr"
FT                   /locus_tag="t0424"
FT                   /product="glucose-specific IIA component of PTS system"
FT                   /note="corresponds to STY2670 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68142"
FT                   /db_xref="GOA:P0A284"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="PDB:1O53"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A284"
FT                   /protein_id="AAO68142.1"
FT                   /translation="MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAEK
FT                   IVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGF
FT                   KRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETP
FT                   VIRIKK"
FT   gene            complement(497275..499002)
FT                   /locus_tag="t0425"
FT   CDS_pept        complement(497275..499002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0425"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2668 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68143"
FT                   /db_xref="GOA:P0A250"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A250"
FT                   /protein_id="AAO68143.1"
FT                   /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLS
FT                   GRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAA
FT                   HEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSAIQEEVILVAADL
FT                   TPSETAQLNLQKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTAQVKNGDYLILDA
FT                   VNNQVYVNPTNDVIEQLRAVQEQVATEKAELAKLKDLPAITLDGHQVEVCANIGTVRDV
FT                   EGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDK
FT                   ELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEV
FT                   RALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC"
FT   gene            complement(499051..499308)
FT                   /gene="ptsH"
FT                   /locus_tag="t0426"
FT   CDS_pept        complement(499051..499308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="t0426"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="corresponds to STY2667 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68144"
FT                   /db_xref="GOA:P0AA08"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AA08"
FT                   /protein_id="AAO68144.1"
FT                   /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAK
FT                   SLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE"
FT   gene            complement(499692..500663)
FT                   /gene="cysK"
FT                   /locus_tag="t0427"
FT   CDS_pept        complement(499692..500663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="t0427"
FT                   /product="cysteine synthase A"
FT                   /note="corresponds to STY2666 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68145"
FT                   /db_xref="GOA:P0A1E4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1E4"
FT                   /protein_id="AAO68145.1"
FT                   /translation="MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRI
FT                   GANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLL
FT                   KALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWE
FT                   DTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKP
FT                   GPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAA
FT                   LKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ"
FT   gene            complement(501036..501797)
FT                   /gene="cysZ"
FT                   /locus_tag="t0428"
FT   CDS_pept        complement(501036..501797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysZ"
FT                   /locus_tag="t0428"
FT                   /product="putative sulfate transport protein CysZ"
FT                   /note="corresponds to STY2665 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68146"
FT                   /db_xref="GOA:Q8Z4W3"
FT                   /db_xref="InterPro:IPR022985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4W3"
FT                   /protein_id="AAO68146.1"
FT                   /translation="MVSSSTTVPRSGVYYFSQGWKLVTLPGIRRFVILPLLVNIVLMGG
FT                   AFWWLFTQLDAWIPSLMSHVPDWLQWLSYLLWPIAVISVLLVFGYFFSTLANWIAAPFN
FT                   GLLAEQLEARLTGATPPDTGILGIMKDVPRIMKREWQKLAWYLPRAIVLLVLYFIPGIG
FT                   QTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQKVANMQFGALTSLFTMI
FT                   PVLNLFIMPVAVCGATAMWVDCWRAKHALWK"
FT   gene            502029..503015
FT                   /locus_tag="t0429"
FT   CDS_pept        502029..503015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0429"
FT                   /product="cell division protein"
FT                   /note="corresponds to STY2664 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68147"
FT                   /db_xref="GOA:P0A2N7"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2N7"
FT                   /protein_id="AAO68147.1"
FT                   /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMK
FT                   SKRDDDSYDDDVEEDEGVGEVRVHRVNHAPGQSQEHDAPRQSPQHQYQPPYASAQPRPA
FT                   APPQPQAPMQQPVQQPVQPAPQPQQVQPSAPPVQPPQQQPAPPSQAPQPVAQPAPPPSA
FT                   QTFQPAEPVVEAEPVVEEAPVVEKPQRKEAVIIMNVAAHHGSELNGEVLLNSIQQSGFK
FT                   FGDMNIFHRHLSPDGSGPALFSLANMVNPGTFDPEMTDFTTPGVTIFMQVPSYGDALQN
FT                   FKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDRIREVMDANA"
FT   gene            503087..505102
FT                   /gene="ligA"
FT                   /locus_tag="t0431"
FT   CDS_pept        503087..505102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="t0431"
FT                   /product="DNA ligase"
FT                   /note="corresponds to STY2663 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68148"
FT                   /db_xref="GOA:Q8Z4W4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4W4"
FT                   /protein_id="AAO68148.1"
FT                   /translation="MEPIEQQLTELRTTLRHHEYLYHVMDAPEILDAEYDRLMRELREL
FT                   EAQRPDLITPDSPTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKS
FT                   TENVIWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDN
FT                   IPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTF
FT                   FCYGVGILEGGELPDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLG
FT                   FDIDGVVIKVNSLALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPV
FT                   ARLEPVQVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEET
FT                   RPIVFPTHCPVCGSDVERVEGEAVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI
FT                   IDQLVEREYVHTPADLFRLTAGKLTGLDRMGPKSAQNVVNALEKAKATTFARFLYALGI
FT                   REVGEATAAGLAAYFGTLEALQAATIDELQKVPDVGIVVATHVFNFFAEESNRDVIGQL
FT                   LAEGVHWPAPVVINAQEIDSPFAGKTVVLTGSLSQMSRDDAKARLVALGAKVAGSVSKK
FT                   TDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLGA"
FT   gene            505095..505322
FT                   /gene="ypeB"
FT                   /locus_tag="t0430"
FT   CDS_pept        505095..505322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypeB"
FT                   /locus_tag="t0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2662 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68149"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W5"
FT                   /protein_id="AAO68149.1"
FT                   /translation="MPEMEKEQLLEIANTVMPFGKYQGRRLIDLPEEYLLWFARKDQFP
FT                   AGKLGELMQITLLIKTEGLTQLVQPLKRPL"
FT   gene            complement(505319..506317)
FT                   /gene="yfeH"
FT                   /locus_tag="t0432"
FT   CDS_pept        complement(505319..506317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeH"
FT                   /locus_tag="t0432"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2661 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68150"
FT                   /db_xref="GOA:Q93IN6"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IN6"
FT                   /protein_id="AAO68150.1"
FT                   /translation="MKLFRILDPFTLTLITVVLLASFFPAEGGFVPVVEGITTAAIALL
FT                   FFMHGAKLSREAIIAGGSHWRLHLWVMCSTFVLFPVLGVLFAWWAPVNVDPMLYSGFLY
FT                   LCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNIHGAQGSLEE
FT                   VGKIMLQLLLPFVLGHLSRPWIGNWVARNKKWIAKTDQTSILLVVYSAFSEAVVNGIWH
FT                   KVGWGSLLFIVVVSLILLAIVIAINVFVARKCGFNKADEITIVFCGSKKSLANGIPMAN
FT                   ILFPTSVLGMMVLPLMIFHQIQLMVCAGLARRYKRQTEKLQAQQESRAAKA"
FT   gene            506407..507333
FT                   /locus_tag="t0433"
FT   CDS_pept        506407..507333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0433"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2660 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68151"
FT                   /db_xref="GOA:Q83T76"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T76"
FT                   /protein_id="AAO68151.1"
FT                   /translation="MNYSLRQLRIFITVAQAKSFSRAGDRIGLSQSAVSHSVKELERQT
FT                   GVRLLDRTTREVVLTEAGQQLATRLERVLDELNSILRDAGRVGTQLTGTVRVAASQTIS
FT                   AHLIPQCIAQSNSLYPAIDFVLHDRPQQWVLESIRQGEVDFGIVIDPGAAVDLQCEAIL
FT                   SEPFLLLCRQDHPLAHQEWVSWQDLKQASLVLQDYASGSRPLIDAALAHFAIEADIVQE
FT                   IGHPATLFPMVEAGIGISVLPALALPLPQGSHLQVKRLTPVVERQLMLARRKNRSLSTA
FT                   AQALWDVVRTQASELTAARAKDPLYQL"
FT   gene            complement(507395..508156)
FT                   /gene="yfeN"
FT                   /locus_tag="t0434"
FT   CDS_pept        complement(507395..508156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeN"
FT                   /locus_tag="t0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2659 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68152"
FT                   /db_xref="GOA:Q8Z4W7"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W7"
FT                   /protein_id="AAO68152.1"
FT                   /translation="MKKILTLTLSSLLIIPALTHAEFKGGFADIGLHYLDWTSDTTEKT
FT                   SKKSHKDDFGYLELEGGANFSWGEMYGFFDWENFYNGRHAKPSSEQRYTFKNTNRIYLG
FT                   DTGLNLYLHAYGTYGSPHRANFHDDMFLYGLGYNFTGNGYWFKPFFAKRYTDQTYYTGD
FT                   NGYVLGWVAGYSFSLGSEKFSVTNWNEYEFDRDASYAAGNGGKDGINGAVALWWNATPH
FT                   LTAGVQYRYADNKLGESFLQDGIIYSIKYLF"
FT   gene            508412..509245
FT                   /gene="xapA"
FT                   /locus_tag="t0435"
FT   CDS_pept        508412..509245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xapA"
FT                   /locus_tag="t0435"
FT                   /product="xanthosine phosphorylase"
FT                   /note="corresponds to STY2658 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68153"
FT                   /db_xref="GOA:Q8Z4W8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010943"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W8"
FT                   /protein_id="AAO68153.1"
FT                   /translation="MPHALFSHNPEYCIDIIHAHKPAFTPRVAFILGSGLGALADQIED
FT                   AVAISYEKLPGFPVSTVHGHAGELVLGHLAGVPVACMKGRGHFYEGRGMAVMTDAIRTL
FT                   KLLGCEVLFCTNAAGSLRPEVGPGSLVALSDHINTMPGTPMVGPNDDRYGDRFFSLANA
FT                   YDADYRAMLQSVAAEKGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVI
FT                   SARHCGLKVVAVSAITNLAEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRKLA"
FT   gene            509300..510556
FT                   /gene="xapB"
FT                   /locus_tag="t0436"
FT   CDS_pept        509300..510556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xapB"
FT                   /locus_tag="t0436"
FT                   /product="xanthosine permease"
FT                   /note="corresponds to STY2657 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68154"
FT                   /db_xref="GOA:Q8Z4W9"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4W9"
FT                   /protein_id="AAO68154.1"
FT                   /translation="MGITSRLKVMSFLQYFIWGSWLVTLGSYMINTLDFTGANVGMVYS
FT                   SKGLAAIIMPGIMGIIADKWLRAERAYMLCHLVCAGALLYATTVTDPQTMFWVMLVNAM
FT                   AYMPTIALSNSVSYSCLAKAGQDPVTSFPPVRVFGTIGFIVAMWTVSLMGLELSSAQLY
FT                   IASGASLLLALYALTLPKIPVAEKKANTTLVSKLGLDAFVLFKNPRMAIFFLFAMMLGA
FT                   VLQITNVFGNPFLHDFARNPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIK
FT                   TVMLMSMLAWTLRFGFFAFGDPSPFGFVLLLLSMIVYGCAFDFFNISGSVFVEQEVDSS
FT                   IRASAQGLFMTMVNGVGAWIGSLLSGMAVDYFSIDGVKDWQTIWLVFAAYALALAVIFA
FT                   LFFKYQHHPEKLSTKSLAH"
FT   gene            510825..511709
FT                   /gene="xapR"
FT                   /locus_tag="t0437"
FT   CDS_pept        510825..511709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xapR"
FT                   /locus_tag="t0437"
FT                   /product="xanthosine operon transcriptional regulator"
FT                   /note="corresponds to STY2655 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68155"
FT                   /db_xref="GOA:Q8Z4X0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X0"
FT                   /protein_id="AAO68155.1"
FT                   /translation="MERAHRIDLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKEL
FT                   EQQLGTLLFIRHSRSVALTHAGKVLMEESRRLLANANQALARVEQIGRGEAGRIELGVV
FT                   GTALWGRMRPAMRHFLKANPNVEVLFREKSPGMQMALLERRELDAGIWRMAIEPAVGFT
FT                   SIRLHESAFMVAVPEDHDLASRDSVPLSALRNEYFVTLPSVHSDWGFLQRVCQQAGFSP
FT                   MIIREVVEPQTVLAMISMGIGITLMADGYAQMSWPGVVFRPLEERIPADLYIVYDQQQA
FT                   TPALEKLVAALTV"
FT   gene            complement(511872..511947)
FT                   /locus_tag="t0438"
FT   tRNA            complement(511872..511947)
FT                   /locus_tag="t0438"
FT                   /product="tRNA-Lys"
FT   gene            complement(511952..512027)
FT                   /locus_tag="t0439"
FT   tRNA            complement(511952..512027)
FT                   /locus_tag="t0439"
FT                   /product="tRNA-Val"
FT   gene            complement(512069..512144)
FT                   /locus_tag="t0440"
FT   tRNA            complement(512069..512144)
FT                   /locus_tag="t0440"
FT                   /product="tRNA-Val"
FT   gene            complement(512190..512265)
FT                   /locus_tag="t0441"
FT   tRNA            complement(512190..512265)
FT                   /locus_tag="t0441"
FT                   /product="tRNA-Val"
FT   gene            512524..513939
FT                   /gene="gltX"
FT                   /locus_tag="t0442"
FT   CDS_pept        512524..513939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="t0442"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="corresponds to STY2654 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68156"
FT                   /db_xref="GOA:P0A2K4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2K4"
FT                   /protein_id="AAO68156.1"
FT                   /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTD
FT                   LERSTPEAIEAIMDGMNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKER
FT                   LEQLREDQMAKGEKPRYDGRCRHSHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFS
FT                   NQELDDLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVP
FT                   MYAHVSMINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFTREE
FT                   MIKLFSLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQL
FT                   AELVKLLGERCKTLKEMAQSCRYFYEDFSEFDADAAKKHLRPVARQPLEVVRDKLSAIT
FT                   DWSAENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERIN
FT                   KALGFIAERESQQ"
FT   gene            complement(513993..514385)
FT                   /gene="yfeD"
FT                   /locus_tag="t0443"
FT   CDS_pept        complement(513993..514385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeD"
FT                   /locus_tag="t0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2653 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68157"
FT                   /db_xref="GOA:Q8Z4X2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X2"
FT                   /protein_id="AAO68157.1"
FT                   /translation="MKRLRSKMTTEELAECLGVARQTVNRWIREQHWKTEKFPGVKGGR
FT                   ARLIHIDASVREFILNIPAFRKLPAFYQAEEAFAEYANATHSHAYRQIIDAVENMSAQE
FT                   QEKLALFLSREGIRGFLTRLGINEAD"
FT   gene            complement(514387..514749)
FT                   /gene="yfeC"
FT                   /locus_tag="t0444"
FT   CDS_pept        complement(514387..514749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeC"
FT                   /locus_tag="t0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2652 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68158"
FT                   /db_xref="GOA:Q8XFP2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFP2"
FT                   /protein_id="AAO68158.1"
FT                   /translation="MFKERMTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKAR
FT                   LVHVNEQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTSLLVR
FT                   EGITGLLQRLGIRDSK"
FT   gene            514971..515046
FT                   /locus_tag="t0445"
FT   tRNA            514971..515046
FT                   /locus_tag="t0445"
FT                   /product="tRNA-Ala"
FT   gene            515089..515164
FT                   /locus_tag="t0446"
FT   tRNA            515089..515164
FT                   /locus_tag="t0446"
FT                   /product="tRNA-Ala"
FT   gene            515355..517544
FT                   /gene="yfeA"
FT                   /locus_tag="t0447"
FT   CDS_pept        515355..517544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="t0447"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2651 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68159"
FT                   /db_xref="GOA:Q8Z4X3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X3"
FT                   /protein_id="AAO68159.1"
FT                   /translation="MPDKCNVLKNIKIFLLAFCLTVPAILLSRLISPRATIDSSYIFLA
FT                   WLPLCVMFSVLFLFGRRGVAPMVGGMMLTNEWNFHLPLPQAMVLLFCQTFPVLLVCAIV
FT                   RWQLGARWRYGIPNQGIWLRVFWLGLMTPFGIKISMHLAGHYLAFPVTISTFFGTGTAI
FT                   FSIVDLLSLISAALIFTLFFYYPLRMIVSPHYMRIFWRRDVAPYLAKEKRLFTLLWFAT
FT                   LATLLAVLCTPFETKYIAGYLVPVLFIGFTIGVGKISYPLLNFSWALTALFLLSYNRNF
FT                   LQGVGSEYSLAFILSVLISFSICLLYMARINQRSEWLNRQWHSQALTDPLTQLPNLRAL
FT                   GQFLLQDAGQSVCYLRMENLEFLSRHYGMQMRVHCEREVFRVLQPLLLEKEKIFHLPGS
FT                   ELLLVLTGPETEARLQYMLNVLNNRKIYWNNTGLDMEYGASWGTFDGRQETLQPLLGQL
FT                   SWLAEQSCSHRRVLALTQSIEAASGQTTERVLRLQKIRQALERGALVLYAQPIRDAQGK
FT                   GYDEILTRLRCDDGIMMPNQFIPLIAQFNLSVRFDMQVMEALLQWLSAHPSAEQGARFS
FT                   VNLMPLTLLQKETASRIMQLFKRYGVPPASVIIEITEEQAFSHSEISMHNINQLRKFGL
FT                   KIAIDDFGTGYANYERLKRLKADIIKIDGCFVKDILTDSLDAMIVKSITDLAKAKSLSV
FT                   VAEFVETPAQRDLLLQLGVHSLQGYLIGRPRPLGK"
FT   gene            complement(517597..518799)
FT                   /gene="nupC"
FT                   /locus_tag="t0448"
FT   CDS_pept        complement(517597..518799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="t0448"
FT                   /product="nucleoside permease NupC"
FT                   /note="corresponds to STY2650 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68160"
FT                   /db_xref="GOA:Q8Z4X4"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X4"
FT                   /protein_id="AAO68160.1"
FT                   /translation="MDRVLHFVLALAVVAVLALLVSSDRKKIRIRYVIQLLVIEVLLAW
FT                   FFLNSDVGLGFVKGFSEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISAL
FT                   IGILQHIRVLPVVIRAIGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKMSR
FT                   NRMYTMAATAMSTVSMSIVGAYMTMLDPKYVVAALVLNMFSTFIVLSLINPYTVDASEE
FT                   NIQMSNLHEGQSFFEMLGEYILAGFKVAIIIAAMLIGFIALIAALNALFATVTGWFGYS
FT                   ISFQGILGYIFYPVAWVMGVPSSEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAE
FT                   GIISVFLVSFANFSSIGIIAGAIKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALV
FT                   L"
FT   gene            519142..520383
FT                   /gene="mntH"
FT                   /locus_tag="t0449"
FT   CDS_pept        519142..520383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="t0449"
FT                   /product="manganese transport protein MntH"
FT                   /note="corresponds to STY2649 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68161"
FT                   /db_xref="GOA:Q8Z4X5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4X5"
FT                   /protein_id="AAO68161.1"
FT                   /translation="MTDNRVENSSGRAARKLRLALMGPAFIAAIGYIDPGNFATNIQAG
FT                   ASFGYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEII
FT                   AMATDLAEFIGAAIGFKLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLF
FT                   VAAAYIVELFFSQPDMAQLGKGMVIPALPNPEAVFLAAGVLGATIMPHVIYLHSSLTQH
FT                   LHGGTRQQRYSATKWDVAIAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYLTLEP
FT                   LLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITMLPSFIVIL
FT                   MGLDPTRILVMSQVLLSFGIALALVPLLIFTSNATLMGELVNTRRVKQIGWIIVVLVVA
FT                   LNIWLLVGTVMGLS"
FT   gene            complement(520444..520770)
FT                   /locus_tag="t0450"
FT   CDS_pept        complement(520444..520770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2648 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68162"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFD1"
FT                   /protein_id="AAO68162.1"
FT                   /translation="MFRSLILAAALLAFTPLAANAGEITLLPSIKLQIGDRDDYGNYWD
FT                   GGRWRDRDYWHNHYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGRGRGH
FT                   KHHH"
FT   gene            complement(520884..521882)
FT                   /locus_tag="t0451"
FT   CDS_pept        complement(520884..521882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0451"
FT                   /product="putative ion-channel protein"
FT                   /note="corresponds to STY2647 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68163"
FT                   /db_xref="GOA:Q8Z4X6"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X6"
FT                   /protein_id="AAO68163.1"
FT                   /translation="MIYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENS
FT                   RALLQRAFDLGITHFDLANNYGPPPGSAECNFGRILQEDFLPWRDELVISTKAGYTMWD
FT                   GPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRHGKAL
FT                   YVGISNYPADLARQAIDILEDLGTPCLIHQPKYSLFERWVEDGLLTLLQEKGVGSIAFS
FT                   PLAGGQLTDRYLNGIPEDSRAASGSRFLKPEQITADKLEKVRRLNELAARRGQKLSQMA
FT                   LAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSAAECAEIDAILEGRF"
FT   gene            522062..523714
FT                   /locus_tag="t0452"
FT   CDS_pept        522062..523714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0452"
FT                   /product="putative decarboxylase"
FT                   /note="corresponds to STY2646 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68164"
FT                   /db_xref="GOA:Q8Z4X7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X7"
FT                   /protein_id="AAO68164.1"
FT                   /translation="MQNPYTVADYLLDRLAGCGIGHLFGVPGDYNLQFLDHVIDHPTLR
FT                   WVGCANELNAAYTADGYARMSGAGALLTTFGVGELSAINGIAGSYAEYVPVLHIVGAPC
FT                   SAAQQRGELMHHTLGDGDFRHFYRMSQAISAASAILDEQNACFEIDRVLGEMLAARRPG
FT                   YIMLPADVAKKTAIPPTEALALPVHEAQSGVETAFRYHARQCLMNSRRIALLADFLAGR
FT                   FGLRPLLQRWMAETPIAHATLLMGKGLFDEQHPNFVGTYSAGASSKEVRQAIEDADRVI
FT                   CVGTRFVDTLTAGFTQQLPAERTLEIQPYASRIGETWFNLPMAQAVSTLRELCLECAFA
FT                   PPPTRSAGQPVRIDKGELTQESFWQTLQQCLKPGDIILVDQGTAAFGAAALSLPDGAEV
FT                   VVQPLWGSIGYSLPAAFGAQTACPDRRVILIIGDGAAQLTIQEMGSMLRDGQAPVILLL
FT                   NNDGYTVERAIHGAAQRYNDIASWNWTQIPPALNAAQQAECWRVTQAIQLAEVLERLAR
FT                   PQRLSFIEVMLPKADLPELLRTVTRALEARNGG"
FT   gene            complement(523734..524969)
FT                   /locus_tag="t0453"
FT   CDS_pept        complement(523734..524969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0453"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2645 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68165"
FT                   /db_xref="GOA:Q8Z4X8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR022969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4X8"
FT                   /protein_id="AAO68165.1"
FT                   /translation="MFHPRARTMLLLSLPALIIGVASSLVLIASMKVASVFQQFLWQRL
FT                   PASIGIAYDSPFWIVGMLTLTGIVVGLIIRYSPGHAGPDPAIEPLISMPVSPSALPGLL
FT                   LALIIGLAGGVSLGPEHPIMTINIALAAAFGSRLFPRITALDWTILASAGTIGALFGTP
FT                   VAAALIFSQTLSGSNDIPMWDRLFAPLMAAAAGSLTTSLFFHPHFSLPIAHYTQMRLVD
FT                   IASGAIVAAIAIAAGMVAVWCLPRLHELLHRLKNPVLILGIGGFILGILGVIGGPLTLF
FT                   KGLDEMQQMAFSQTLGAGDYFTLAVVKLAALVIAAASGFRGGRIFPAVFIGAALGLMLH
FT                   AHVEAVPAAITVSCAILGLVLVVTRDGWLSLFMAAVVVPDTNLLPLLCIVMLPAWLLLA
FT                   GKPLLAANRHEP"
FT   gene            525173..526138
FT                   /gene="glk"
FT                   /locus_tag="t0454"
FT   CDS_pept        525173..526138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="t0454"
FT                   /product="glucokinase"
FT                   /note="corresponds to STY2644 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68166"
FT                   /db_xref="GOA:P58618"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58618"
FT                   /protein_id="AAO68166.1"
FT                   /translation="MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVV
FT                   RVYLDEHGVSVEDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAV
FT                   SMAIPMLKKEHLIQFGGGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDF
FT                   APNSEEEAMILEILRAEIGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERA
FT                   LADSCIDCRRALSLFCVIMGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGF
FT                   EDKGRFKDYVHGIPVYLIVHDNPGLLGSGAHLRQTLGHIL"
FT   gene            526861..528099
FT                   /locus_tag="t0455"
FT   CDS_pept        526861..528099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0455"
FT                   /product="putative aminotransferase"
FT                   /note="corresponds to STY2642 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68167"
FT                   /db_xref="GOA:Q8Z4X9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4X9"
FT                   /protein_id="AAO68167.1"
FT                   /translation="MADSRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGN
FT                   PDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISHWYQERYDVDIDPETEAIVT
FT                   IGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELER
FT                   AIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGAFTPL
FT                   QVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEQYAA
FT                   MGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAVRGIKTMFRADGV
FT                   LPSHPKPVEASTE"
FT   gene            528278..528736
FT                   /gene="tnpA"
FT                   /locus_tag="t0456"
FT   CDS_pept        528278..528736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="t0456"
FT                   /product="transposase for insertion sequence element IS200"
FT                   /note="corresponds to STY2640 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68168"
FT                   /db_xref="GOA:P59697"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59697"
FT                   /protein_id="AAO68168.1"
FT                   /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLC
FT                   EWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(529332..530252)
FT                   /locus_tag="t0457"
FT   CDS_pept        complement(529332..530252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0457"
FT                   /product="putative acyltransferase"
FT                   /note="corresponds to STY2639 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68169"
FT                   /db_xref="GOA:Q8Z4Y0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y0"
FT                   /protein_id="AAO68169.1"
FT                   /translation="MFPQSKFSRAFLHPRYWLTWFGVGVLWLLVQLPYPVLRFLGTRTG
FT                   KLARPFLKRRESIAQKNIELCFPTLSREEREKLIAENFHSLGMALLETGMAWFWPDSRV
FT                   RKWFDVDGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNPLMEW
FT                   VQTRGRMRSNKAMIGRNNLRGIVGALKKGEAVWFAPDQDYGPKGSSFAPFFAVENVATT
FT                   NGTYVLSRLSGAAMLTVTMVRKSDNSGYRLYITPEMEGYPADENQAAAYMNKIIEKEIM
FT                   RAPEQYLWIHRRFKTRPLGEASLYI"
FT   gene            530773..531015
FT                   /locus_tag="t0458"
FT   CDS_pept        530773..531015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2638 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68170"
FT                   /db_xref="GOA:Q8XG09"
FT                   /db_xref="InterPro:IPR024470"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG09"
FT                   /protein_id="AAO68170.1"
FT                   /translation="MIYLWTFLAISILAVSGYIGQVMGAFSAVSSFTGMVILAALIYLL
FT                   NVWLQDGDDIVSGLLLFLAPACGLIIRFMVGYGKR"
FT   gene            complement(531254..532645)
FT                   /gene="pgtP"
FT                   /locus_tag="t0459"
FT   CDS_pept        complement(531254..532645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtP"
FT                   /locus_tag="t0459"
FT                   /product="phosphoglycerate transporter protein"
FT                   /note="corresponds to STY2637 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68171"
FT                   /db_xref="GOA:Q8Z4Y1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y1"
FT                   /protein_id="AAO68171.1"
FT                   /translation="MLTILKTGRSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVR
FT                   NNFTLSTPYLKEQLDLSATQIGLLSSCMLIAYGISKGVMSSLADKASPKVFMACGLVLC
FT                   VIVNVGLGFSSAFWIFAALVVFNGLFQGMGVGPSFITIANWFPRRERGRVGAFWNISHN
FT                   VGGGIVAPIVGAAFAILGSEHWQSASYIVPACVAVIFALIVLVLGKGSPREEGLPSLEQ
FT                   MMPEEKVILKTKNTAKAPENMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLP
FT                   IYLLTVKHFSKEQMSVAFLFFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCL
FT                   IGYWKSESLLMVTIFAAIVGCLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGA
FT                   SLGTSLFGVMVDKLGWYGGFYLLMGGIVCCILFCYLSHRGALELERQRQNALHNQDSLQ
FT                   LADAQ"
FT   gene            533081..534274
FT                   /gene="pgtC"
FT                   /locus_tag="t0460"
FT   CDS_pept        533081..534274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtC"
FT                   /locus_tag="t0460"
FT                   /product="phosphoglycerate transport regulatory protein
FT                   PgtC precursor"
FT                   /note="corresponds to STY2635 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68172"
FT                   /db_xref="GOA:P0A234"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A234"
FT                   /protein_id="AAO68172.1"
FT                   /translation="MFGSCQAYSRELVMATTFSPSATAWIIQRWQTEPGSVMIRTLNRT
FT                   SGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALLDSAPAASQKLVPRSIRSTSV
FT                   AVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALLMSSPSRSDTNHLMVESLLQ
FT                   QKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGPVIDNYANLLLNDPNLAFT
FT                   YFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILADANTGKYPVAPLSADNPR
FT                   AAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDAWRALHSAETRLKRPLP
FT                   EIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLNNQRLAIHKLEELK"
FT   gene            534271..536277
FT                   /gene="pgtB"
FT                   /locus_tag="t0461"
FT   CDS_pept        534271..536277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtB"
FT                   /locus_tag="t0461"
FT                   /product="phosphoglycerate transport system sensor protein
FT                   PgtB"
FT                   /note="corresponds to STY2634 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68173"
FT                   /db_xref="GOA:Q8Z4Y2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017116"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y2"
FT                   /protein_id="AAO68173.1"
FT                   /translation="MKGRLLQRLRQLSISNSLRGAFLTGALLTLIVSMVSLYSWHEQSS
FT                   QVRYSLDEYFPRIHSAFLIEGNLNLAVDQLNEFLLAPNTTVRLQLRTQIIQHLDKIERL
FT                   SQGLQLAERRQLAVILQDSRTLLAELDNALYNMFLVREKVSELSARIDWLHDDFTTELN
FT                   SLVQDFTWQQGTLLDQIEANQGDAAQYLQRSREVQNEQQQVYTLARIENQIVDDLRDRL
FT                   NELKSGNNDGMLVETHIRYLENLKKTADENIRALDDWPSTITLRQTIDELLEIGMVKNK
FT                   MPDTMRDYVAAQKALLDASRAREATLGRFRTLLEAQLGSSHQQMQTFNQRLEQIVRVSG
FT                   GLILVTTLLALLLAWGLNHYFIRSRLVKRFTALNQAVVQIGLGRTDSTIPVYGRDELGR
FT                   IARLLRHTLGQLNMQRRQLEQEVAERKEIEADLRAMQDELIQTAKLAVVGQTMTTLAHE
FT                   INQPLNALSMYLFTAGRAIEQGQSGQARNTLTKAEGLINRIDAIIRSLRQFTRRAELET
FT                   PLYPVDLRQTFVAAWELLAMRHQSRQGALSLPTDTVWVSGDEVRIQQVLVNVLANALDA
FT                   CSHDAAIAVTWQTQGEALEVYIADNGPGWPGALLPSLLKPFTTSKAVGLGIGLSISVSL
FT                   MAQMKGDLRLASTLTRNACVVLQFSVTDVDDVE"
FT   gene            536267..537514
FT                   /gene="pgtA"
FT                   /locus_tag="t0462"
FT   CDS_pept        536267..537514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtA"
FT                   /locus_tag="t0462"
FT                   /product="phosphoglycerate transport system transcriptional
FT                   regulatory protein PgtA"
FT                   /note="corresponds to STY2633 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68174"
FT                   /db_xref="GOA:Q8Z4Y3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y3"
FT                   /protein_id="AAO68174.1"
FT                   /translation="MLNDECSILLIDDDVDVLDAYTQMLEQAGYRVRGFTHPFEAKEWV
FT                   KADWEGIVLSDVCMPGCSGIDLMTLFHQDDDQLPILLITGHGDVPMAVDAVKKGAWDFL
FT                   QKPVDPGKLLILIEDALRQRRSVIARRQYCQQTLQVDLIGRSEWMNQFRQRLQQLAETD
FT                   IAVWFYGEHDTGRMTGARYLHQLGRNAKGPFVRYELTPENAGQLETFIDQAQGGTLVLS
FT                   YPEYLTREQQHHLARLQSLEHRPFRLVGVGSASLVEQAAANQIAAELYYCFAMTQIACQ
FT                   SLSQRPDDIEPLFRHYLRKACLRLNHPVPEIAGELLKGIMRRAWPSNVRELANAAELFA
FT                   VGVLPLAETVNPQLLLQEPTPLDRRVEEYERQIITEALNIHQGRINEVAEYLQIPRKKL
FT                   YLRMKKYGLSKEHYKF"
FT   gene            537782..538720
FT                   /gene="pgtE"
FT                   /locus_tag="t0463"
FT   CDS_pept        537782..538720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgtE"
FT                   /locus_tag="t0463"
FT                   /product="outer membrane protease E"
FT                   /note="corresponds to STY2632 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68175"
FT                   /db_xref="GOA:Q8Z4Y4"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020079"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y4"
FT                   /protein_id="AAO68175.1"
FT                   /translation="MKKHAIAVMMIAVFSESVYAESTLFIPDVSPESVTTSLSVGVLNG
FT                   KSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVD
FT                   HDWMSSEQPGWTDRSIHPDTSANYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTA
FT                   RGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNA
FT                   HDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIID
FT                   KTSGNTAYFGGDAAGIANNNYTVTAGLQYRF"
FT   gene            538942..539187
FT                   /pseudo
FT                   /locus_tag="t0464"
FT                   /note="corresponds to STY2631a from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            539584..540084
FT                   /pseudo
FT                   /locus_tag="t0465"
FT                   /note="corresponds to STY2631 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(540201..542123)
FT                   /locus_tag="t0466"
FT   CDS_pept        complement(540201..542123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0466"
FT                   /product="putative lipopolysaccharide modification
FT                   acyltransferase"
FT                   /note="corresponds to STY2629 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68176"
FT                   /db_xref="GOA:Q8Z4Y5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y5"
FT                   /protein_id="AAO68176.1"
FT                   /translation="MEHLKYRPDIDGLRAIAVLSVVIFHYFPSLLPGGFVGVDIFFVIS
FT                   GYLITSIILKSASNKSFSYLDFYKRRVLRIFPALSIVLVSCLIVGWIYLFQDDYKLLGK
FT                   HVFSGSFFISNFTLWSESGYFDSKSYLKPLLHLWSLGIEEQFYIIWPVVILLCFRSKNH
FT                   NRNIVLSCATIFIISYAISIFTMASDGGANYYSPASRFWELMAGAIISTLRFIGINTSL
FT                   SKLMSLLGIILIALSITMIDEKMSFPGYIAIIPILGASLIIASNGNDLVVSKLLSVRPV
FT                   VFFGLISYPLYLWHWPIYSFYRSIFAGSPDYHELTLLLLLSFFLAILTYYLIEKPLRNS
FT                   RSKYITAILLALSVFGTGLIGAFIFHINGVKDREINKSASEYASVTDVYNYYKYGELLR
FT                   GGICHSVQLTAAISNGCIKNGKHNIFIIGDSYAAALFNGLSHYIDNKGSDYIISQMTDG
FT                   NAPPLFVDGKDDLQRSVITLNNNRINEIKRVQPEVVLLTWSVRGTNGVHDKKLAIDALS
FT                   LTIKKIKEASPDSRIVFIGPVPEWNANLVKIISNYLSEFKKTPPLYMTYGLNSEISEWD
FT                   SYFSNNVPKMGIEYISAYKALCNESGCLTRVGNGPDFITAVDWGHLTKPGSDFLFNKIG
FT                   NKIIK"
FT   gene            complement(542176..542394)
FT                   /pseudo
FT                   /gene="gtrB"
FT                   /locus_tag="t0467"
FT                   /note="corresponds to STY2627b from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(542363..542752)
FT                   /gene="gtrA"
FT                   /locus_tag="t0468"
FT   CDS_pept        complement(542363..542752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtrA"
FT                   /locus_tag="t0468"
FT                   /product="bactoprenol-linked glucose transferase"
FT                   /note="corresponds to STY2627A from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68177"
FT                   /db_xref="GOA:Q8Z4Y6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y6"
FT                   /protein_id="AAO68177.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCMYGMHTHQALTNFSDFVIA
FT                   VSFSFYANARFTFNASTTAILYMMYMGFMGTLSAVVGWMADQCSLPPLVTLITFSAISL
FT                   VCGFIYSRFIIFRDKNENLSCRPGF"
FT   gene            543479..543694
FT                   /pseudo
FT                   /locus_tag="t0469"
FT                   /note="corresponds to STY2626 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            complement(543845..543919)
FT                   /locus_tag="t0470"
FT   tRNA            complement(543845..543919)
FT                   /locus_tag="t0470"
FT                   /product="tRNA-Arg"
FT   gene            complement(543995..544936)
FT                   /gene="yfdC"
FT                   /locus_tag="t0471"
FT   CDS_pept        complement(543995..544936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdC"
FT                   /locus_tag="t0471"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2625 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68178"
FT                   /db_xref="GOA:Q8Z4Y7"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Y7"
FT                   /protein_id="AAO68178.1"
FT                   /translation="MDSLNDDKINRHSSDLEVESEEKQSGKEIEVDEDRLPSRAMAIHE
FT                   HIRQDGEKEMERDAMALLWSAIAAGLSMGASLLAKGIFHVQLEGVPGGFLLENLGYTFG
FT                   FIIVIMARQQLFTENTVTAVLPVMQNPTLSNVGLLMRLWGVVLLGNLIGTGVAAWAFEY
FT                   MPIFDEETRDAFVKIGMEVMKNSPTEMFANAIISGWIIATMVWMFPAAGGAKIVVIILM
FT                   TWLIALGDTTHIVVGSVEILYLVFNGTLPWSDFFWPFALPTLAGNICGGTFIFALMSHA
FT                   QIRNDMSNKRKEEARLRGERLERERKKAEKQR"
FT   gene            545225..545980
FT                   /gene="vacJ"
FT                   /locus_tag="t0472"
FT   CDS_pept        545225..545980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacJ"
FT                   /locus_tag="t0472"
FT                   /product="VacJ lipoprotein precursor"
FT                   /note="corresponds to STY2624 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68179"
FT                   /db_xref="GOA:Q8XFB9"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFB9"
FT                   /protein_id="AAO68179.1"
FT                   /translation="MKLRLSALALGTTLLVGCASSGTEQQGRSDPFEGFNRTMYNFNFN
FT                   VLDPYVVRPVAVAWRDYVPQPARNGLSNFTGNLEEPAIMVNYFLQGDPYQGMVHFTRFF
FT                   LNTLLGMGGFIDVAGMANPKLQRVEPHRFGSTLGHYGVGYGPYMQLPFYGSFTLREDGG
FT                   DMADTLYPVLSWLTWPMSIGKWTIEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHD
FT                   FIANGGKLKPQENPNAQAIQDELKEIDSE"
FT   gene            complement(546041..547354)
FT                   /gene="fadL"
FT                   /locus_tag="t0473"
FT   CDS_pept        complement(546041..547354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadL"
FT                   /locus_tag="t0473"
FT                   /product="long-chain fatty acid transport protein
FT                   precursor"
FT                   /note="corresponds to STY2623 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68180"
FT                   /db_xref="GOA:Q8Z4Y8"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Y8"
FT                   /protein_id="AAO68180.1"
FT                   /translation="MVMSQKTLFTKSALAVAVAIISTQAWSAGFQLNEFSSSGLGRAYS
FT                   GEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSRRTLDADNIAPTA
FT                   WVPNVHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRL
FT                   NEAWSFGLGFDAVYARAKIERFAGDLGQLVAAQNPALAPVAGQILSDTKIAHLNGNQWG
FT                   FGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLPIAINRFNLPIPTATGGATQSG
FT                   YLTLNLPEMWEVSGYNRVAPQWAIHYSLAYTSWSQFQELKAKSTAGDTLFEKHEGFKDA
FT                   YRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASV
FT                   DVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF"
FT   gene            547719..548003
FT                   /locus_tag="t0474"
FT   CDS_pept        547719..548003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2622 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68181"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG86"
FT                   /protein_id="AAO68181.1"
FT                   /translation="MSKCSADETPVCCCMDVGTIMDNSDCTASYSRVFATRAEAEETLA
FT                   ALTEKARSVESEPCQITPTFTEESEGVRLDIDFVFACEAETLIFQLGLR"
FT   gene            548181..549491
FT                   /locus_tag="t0475"
FT   CDS_pept        548181..549491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0475"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /note="corresponds to STY2621 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68182"
FT                   /db_xref="GOA:Q8Z4Y9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Y9"
FT                   /protein_id="AAO68182.1"
FT                   /translation="MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVV
FT                   GELLARSEIPADAIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQ
FT                   AVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRL
FT                   RLRDLLPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKL
FT                   AEEVMTTYVPPYKNPFAEDNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAA
FT                   VILMTESRAKELGLRPLGYLRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLF
FT                   DMHEAFAAQTLANLQLLGSERFAREVFGRAQATGEVDDAKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLHELRRRGGGFGLVTACAAGGLGAAMVLEAE"
FT   gene            549491..551638
FT                   /locus_tag="t0476"
FT   CDS_pept        549491..551638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0476"
FT                   /product="putative fatty acid oxidation complex alpha
FT                   subunit"
FT                   /note="corresponds to STY2620 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68183"
FT                   /db_xref="GOA:Q8Z4Z0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Z0"
FT                   /protein_id="AAO68183.1"
FT                   /translation="MTTTSAFMLSVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQ
FT                   IRENKALQGVVFISAKADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPV
FT                   IAAIHGACLGGGLEMALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVST
FT                   ALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGP
FT                   LGRALLFRLVRKKTAQKTQGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQ
FT                   SQALRAVFFASTEVKKDPGSDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDI
FT                   NTQGINHALKYSWDLLETKVRRRHIKASERDKQLALISGSTDYRGFSHRDLVIEAVFED
FT                   LPLKQQMVAEVEQNCATHTIFASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVE
FT                   VIPHASTSAQTIATTVKLAKKQGKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVE
FT                   HIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKG
FT                   RKNGRGFYLYGEKGRKSKKQVDPAIYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFD
FT                   EKVIRSARDGDIGAVFGIGFPPFLGGPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQ
FT                   LVRMAERREHFWTNGETDQGN"
FT   gene            551847..552332
FT                   /locus_tag="t0477"
FT   CDS_pept        551847..552332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0477"
FT                   /product="phosphohistidine phosphatase"
FT                   /note="corresponds to STY2619 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68184"
FT                   /db_xref="GOA:Q8Z4Z1"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z1"
FT                   /protein_id="AAO68184.1"
FT                   /translation="MQVFIMRHGDAALDAASDSVRPLTSCGCDESRLMANWLKGQKVDI
FT                   ERVLVSPFLRAEQTLDVVGDCMNLPTQVDVLPELTPCGDVGLVSAYLQALANEEIGSVL
FT                   VISHLPLVGYLVSELCPGETPPMFTTSAIANVTLDESGKGTFNWQMSPCNLKMAKAI"
FT   gene            complement(552381..552932)
FT                   /locus_tag="t0478"
FT   CDS_pept        complement(552381..552932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2618 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68185"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67247"
FT                   /protein_id="AAO68185.1"
FT                   /translation="MKKKTSLSEEDQALFRQLMVGTRKIKQDTIVHRPLRKKITEVPTR
FT                   RLIQEQADASHYFSDEFQPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLDLHGLT
FT                   QLQAKQELGALIAACRREHIFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYG
FT                   GDAALLVLIEVEEWQPPELP"
FT   gene            553098..554030
FT                   /locus_tag="t0479"
FT   CDS_pept        553098..554030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2617 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68186"
FT                   /db_xref="GOA:P0A294"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A294"
FT                   /protein_id="AAO68186.1"
FT                   /translation="MDKIFVDEAVSELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEA
FT                   VQLVLPSLYLPLDIPEDMRTARLTSSEKHRIVERVIRRINERIPVAYLTNKAWFCGHEF
FT                   YVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAYAFPDAEVDAVD
FT                   ISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNE
FT                   YRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQYPDVPFTWL
FT                   EFDNGGDGVFMLTKAQLLAAREHFNIYKD"
FT   gene            554066..555151
FT                   /gene="aroC"
FT                   /locus_tag="t0480"
FT   CDS_pept        554066..555151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="t0480"
FT                   /product="chorismate synthase"
FT                   /note="corresponds to STY2616 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68187"
FT                   /db_xref="GOA:P16280"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16280"
FT                   /protein_id="AAO68187.1"
FT                   /translation="MAGNTIGQLFRVTTFGESHGLALGGIVDGVPPGIPLTEADLQHDL
FT                   DRRRPGTSRYTTQRREPDQVKILSGVFDGVTTGTSIGLLIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDI
FT                   PLEIKDWRQVELNPFFCPDADKLDALDELMRALKKEGDSIGAKVTVMASGVPAGLGEPV
FT                   FDRLDADIAHALMSINAVKGVEIGEGFNVVALRGSQNRDEITAQGFQSNHAGGILGGIS
FT                   SGQHIVAHMALKPTSSITVPGRTINRMGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVL
FT                   MDHLLRHRAQNADVKTEIPRW"
FT   gene            555155..555979
FT                   /gene="mepA"
FT                   /locus_tag="t0481"
FT   CDS_pept        555155..555979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="t0481"
FT                   /product="penicillin-insensitive murein endopeptidase
FT                   precursor"
FT                   /note="corresponds to STY2615 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68188"
FT                   /db_xref="GOA:Q8Z4Z2"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Z2"
FT                   /protein_id="AAO68188.1"
FT                   /translation="MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSIGSFANGCI
FT                   IGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAQQRGLGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASL
FT                   IKLAAQDNDVTRIFVNPAIKQQLCLDAGSDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL"
FT   gene            555979..556788
FT                   /gene="yfcA"
FT                   /locus_tag="t0482"
FT   CDS_pept        555979..556788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcA"
FT                   /locus_tag="t0482"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2614 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68189"
FT                   /db_xref="GOA:Q8XEQ5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEQ5"
FT                   /protein_id="AAO68189.1"
FT                   /translation="MDNFYDLFMVSPLLLVVLFFVAVLAGFIDSIAGGGGLLTIPALMA
FT                   AGMSPANALATNKLQACGGSLSSSLYFIRRKVVNLAEQKLNILMTFIGSMSGALLVQHV
FT                   QADILRQILPILVIFIGLYFLLMPKLGEEDRQRRLYGLPFALIAGGCVGFYDGFFGPAA
FT                   GSFYALAFVTLCGYNLAKSTAHAKVLNATSNVGGLLLFIIGGKVIWATGFVMLVGQFLG
FT                   ARMGSRLVLSKGQKLIRPMIVIVSAVMSARLLYDSHGQEILHWLGMN"
FT   gene            556788..557337
FT                   /pseudo
FT                   /locus_tag="t0483"
FT                   /note="corresponds to STY2613 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            557370..557645
FT                   /locus_tag="t0484"
FT   CDS_pept        557370..557645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2611 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68190"
FT                   /db_xref="InterPro:IPR014987"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XER1"
FT                   /protein_id="AAO68190.1"
FT                   /translation="MIAEFESRILALIDDMVEHASDDELFASGYLRGHLTLAIAELESG
FT                   DDHSVEAVYANVSQSLEKAIGAGELSPRDQALVKAMWDNLFDKAKQ"
FT   gene            complement(557697..559757)
FT                   /locus_tag="t0485"
FT   CDS_pept        complement(557697..559757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2610 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68191"
FT                   /db_xref="GOA:Q8Z4Z3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Z3"
FT                   /protein_id="AAO68191.1"
FT                   /translation="MRHQAHIVKIAIPPVRRVTYVKQYAIQPATLEFNAEGTPVSRDFD
FT                   DVYFSNDNGLEETRYVFLGGNRLAERFPVHSHPLFIVAESGFGTGLNFLTLWQAFDSFR
FT                   SAHPQATLQRLHFISFEKFPLTRDDLALAHQHWPELAPWAEQLQAQWPLPLPGCHRLLL
FT                   DRGRVTLDLWFGDINELTDQLDATLNQTVDAWFLDGFAPAKNPDMWTPNLFNAMARLAR
FT                   PGATLATFTSAGFVRRGLQEAGFTMQKHKGFGRKREMLCGVMEQHLMPTLSAPWFYCSG
FT                   SEKRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPAQGASGNRQGALYPLLSKHDA
FT                   AINRFFPTAFTFARRLYDALPVSFDHAWCGVTQLGWDEKSQQKIAQMLSLALPAGLASA
FT                   LNAEEAEQAVGVTTRCGGITYPAGGWLCPEQLTRAVIALATEQGLQTRFRHTLTSLVAQ
FT                   ESRWQLRFTSGETASHETVVLANGHQINRFDQTRPLPVYAVGGQVSHIPTTPALSALRQ
FT                   VLCYDGYLTPQNPHNQQHCIGASYHRGDESTVWREEDQRQNRQRLLDCFPDANWATEVD
FT                   VSGNSARCGVRCATRDHLPMVGNVPDYHATLTHYADLADNKTSAASAPVYPGLFMLGAL
FT                   GSRGLCSAPLCAEILAAQMSNEPIPLDAGTLAALNPNRLWVRKLLKGKAVK"
FT   gene            559857..561071
FT                   /gene="fabB"
FT                   /locus_tag="t0486"
FT   CDS_pept        559857..561071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="t0486"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /note="corresponds to STY2609 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68192"
FT                   /db_xref="GOA:Q8XEK7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEK7"
FT                   /protein_id="AAO68192.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMR
FT                   SQVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAG
FT                   SGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSAC
FT                   ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTY
FT                   DAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM
FT                   QMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGV
FT                   QEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATL
FT                   VMRKL"
FT   gene            561169..561825
FT                   /locus_tag="t0487"
FT   CDS_pept        561169..561825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2608 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68193"
FT                   /db_xref="GOA:Q8Z4Z4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z4"
FT                   /protein_id="AAO68193.1"
FT                   /translation="MPTNTLDKIRHSLSCVAVLFGLFGIFVFASFSPSYAWLYLGGLAA
FT                   PFIYSIVFVYAIAAWSIYSKYYPFLSLGRLSFVECFVPALALVCLTVLYNVFSGPEPWM
FT                   AELSRQFFLHKFLNTLVMCFLAPVAEEIIFRGFLLNSSIGWGRYSRVSGIIITSLAFAF
FT                   MHTQYLFAVTFVYLFVFSSILCVVRMRSRGLMIPITLHILNNAWVIFGLLFSATE"
FT   gene            complement(561892..562410)
FT                   /locus_tag="t0488"
FT   CDS_pept        complement(561892..562410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0488"
FT                   /product="putative lipoprotein"
FT                   /note="corresponds to STY2607 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68194"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z5"
FT                   /protein_id="AAO68194.1"
FT                   /translation="MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFMNDVNTP
FT                   DDTTALMQRYVAKEVIHRLALIQSLYEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFL
FT                   GGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRDADKDYEQPIYDAGAITQAEAWSA
FT                   KVAPEYEKH"
FT   gene            complement(562410..562778)
FT                   /locus_tag="t0489"
FT   CDS_pept        complement(562410..562778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0489"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2606 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68195"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z6"
FT                   /protein_id="AAO68195.1"
FT                   /translation="MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHA
FT                   KDYGPMLRSAGFTAIGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMW
FT                   AGPGYRAARPSYTIYRKN"
FT   gene            complement(562947..563195)
FT                   /locus_tag="t0490"
FT   CDS_pept        complement(562947..563195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0490"
FT                   /product="putative DNA-binding protein"
FT                   /note="corresponds to STY2605 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68196"
FT                   /db_xref="GOA:Q8Z4Z7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z7"
FT                   /protein_id="AAO68196.1"
FT                   /translation="MEPKSQDWHRADIKSALEKRGITLRDLSRQAGLSPDSLRNVFTRS
FT                   WPRAERIIADALGITPQEIWPSRYGDMQIKNDADIAE"
FT   gene            563367..563741
FT                   /locus_tag="t0491"
FT   CDS_pept        563367..563741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0491"
FT                   /product="putative bacteriophage protein"
FT                   /note="corresponds to STY2604 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68197"
FT                   /db_xref="GOA:Q8Z4Z8"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z4Z8"
FT                   /protein_id="AAO68197.1"
FT                   /translation="MAKEWFTVKECLGLPGFPGSEPAVRERLYKYSEGKAGVRRKRVKS
FT                   KAEEFHISVFPLYVHRYLDDSGEEPTPEPISLQEAEPEDIWEMMFRLLTPEQRKQVTGR
FT                   FKVRGMKAVFLFLFDDTPPR"
FT   gene            563921..565099
FT                   /locus_tag="t0492"
FT   CDS_pept        563921..565099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0492"
FT                   /product="putative transmembrane transporter"
FT                   /note="corresponds to STY2603 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68198"
FT                   /db_xref="GOA:Q8Z4Z9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z4Z9"
FT                   /protein_id="AAO68198.1"
FT                   /translation="MTAVSQKTTTPSADFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHE
FT                   LGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMLACGLAGAAWLLAALL
FT                   PVSAPVKFALLIVGRLILGFGESQLLTGTLTWGLGLVGPTRSGKVMSWNGMAIYGALAA
FT                   GAPLGLLIHSHFGFAALAGTTMVLPLLAWAFNGTVRKVPAYTGERPSLWSVVGLIWKPG
FT                   LGLALQGVGFAVIGTFISLYFVSNGWTMAGFTLTAFGGAFVLMRILFGWMPDRFGGVKV
FT                   AVVSLLVETAGLLLLWLAPTAWIALVGAALTGAGCSLIFSALGVEVVKRVPAQVRGTAL
FT                   GGYAAFQDISYGVTGPLAGMLATSYGYPSVFLAGAISAVVGILVTILSFRRG"
FT   gene            complement(565096..566097)
FT                   /gene="div"
FT                   /locus_tag="t0493"
FT   CDS_pept        complement(565096..566097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="div"
FT                   /locus_tag="t0493"
FT                   /product="Div protein"
FT                   /note="corresponds to STY2602 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68199"
FT                   /db_xref="GOA:O06951"
FT                   /db_xref="InterPro:IPR023597"
FT                   /db_xref="UniProtKB/TrEMBL:O06951"
FT                   /protein_id="AAO68199.1"
FT                   /translation="MHPISGAPAQPPGEGRNPLSAASEQPLSMQQRTVLERLITRLISL
FT                   TQQQSAEVWAGMKHDLGIKNDAPLLSRHFPAAEQNLTQRLGVAQQNHANRQVLSQLTEL
FT                   LGVGNNRQAVSDFIRQQYGQTALSQLTPDQLKNVLTLLQQGQLSIPQPQQRPATDRPLL
FT                   PAEHNTLNQLVTKLAAATGESNKLIWQSMLELSGVKSGELIPAKQFTHLATWLQARQTL
FT                   SLQHAPTLHTLQAALKQPLEPDELTAIKEYAQHTYQIQPQTVLTTAQVQDLLNHIFLRR
FT                   VEREADELEPLSIQPIYRPFAPMIETVKNLSARPGLLFIALIIVLALFWLVS"
FT   gene            566201..567337
FT                   /gene="pdxB"
FT                   /locus_tag="t0494"
FT   CDS_pept        566201..567337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxB"
FT                   /locus_tag="t0494"
FT                   /product="erythronate-4-phosphate dehydrogenase"
FT                   /note="corresponds to STY2601 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68200"
FT                   /db_xref="GOA:P60801"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60801"
FT                   /protein_id="AAO68200.1"
FT                   /translation="MKILVDENMPYARELFSRLGEVKAVPGRPIPVEELNHADALMVRS
FT                   VTKVNESLLSGTPINFVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSALL
FT                   MLAERDGFSLRDRTIGIVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTLDE
FT                   LVQEADVLTFHTPLYKDGPYKTLHLADETLIRRLKPGAILINACRGPVVDNAALLARLN
FT                   AGQPLSVVLDVWEGEPDLNVALLEAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGRE
FT                   QRVALETLLPAPEFGRITLHGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLR
FT                   KNYLERREWSSLYVMCDDETAAALLCKLGFNAVHHPAH"
FT   gene            567405..568418
FT                   /gene="usg"
FT                   /locus_tag="t0495"
FT   CDS_pept        567405..568418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usg"
FT                   /locus_tag="t0495"
FT                   /product="putative semialdehyde dehydrogenase"
FT                   /note="corresponds to STY2600 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68201"
FT                   /db_xref="GOA:Q8XGD4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGD4"
FT                   /protein_id="AAO68201.1"
FT                   /translation="MSEGWNIAILGATGAVGEALLETLAERQFPVGEIYALARHESAGE
FT                   HLRFGGKSVIVQDAADFDWTQAQLAFFVAGAEASAAWIDDATNAGCLVIDSSGLFALEP
FT                   DVPLVVPEVNPYVLADYRNRNVIAVADSLTSQLLAALKPLIDQGGLSRIAVTSMLSASA
FT                   QGKKAVDALAGQSAKLLNGIPIDEDDFFGRQLAFNMLPLLPDREGSVRQERRIVDEVRK
FT                   ILQDDGVMISASVVQSPVFYGHAQMVSFEALRPLAAEEAREAFSRGEDIVLSEETDYPT
FT                   QVGDASGNPQLSIGCVHNDYGMPEQIQFWSVADNVRFGGALMAVKIAEKLVQEYLY"
FT   gene            568418..569230
FT                   /gene="truA"
FT                   /locus_tag="t0496"
FT   CDS_pept        568418..569230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="t0496"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="corresponds to STY2599 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68202"
FT                   /db_xref="GOA:Q8Z500"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z500"
FT                   /protein_id="AAO68202.1"
FT                   /translation="MSGQQSSPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ
FT                   VANEPINVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVP
FT                   DDFHARFSATARRYRYIIYNHRLRPAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTS
FT                   FRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPES
FT                   WIAELLAARDRTLAAATAKAEGLYLVAVDYPDRFDLPKPPMGPLFLAD"
FT   gene            569279..569938
FT                   /gene="dedA"
FT                   /locus_tag="t0497"
FT   CDS_pept        569279..569938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="t0497"
FT                   /product="DedA protein"
FT                   /note="Dsg-1 protein; corresponds to STY2598 from Accession
FT                   AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68203"
FT                   /db_xref="GOA:Q8XEL7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEL7"
FT                   /protein_id="AAO68203.1"
FT                   /translation="MDLIYFIIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLETNDLNVHVMVALMLIAAIVGDAVNYTIGRLFGEKLFSNP
FT                   NSKIFRRSYLDKTHQFYEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIG
FT                   ALLWVLLFTYAGYFFGTIPLIQDNLKLLIVGIIVVSILPGVIEIVRHKRAASRAAK"
FT   gene            570088..571002
FT                   /gene="accD"
FT                   /locus_tag="t0498"
FT   CDS_pept        570088..571002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="t0498"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /note="corresponds to STY2597 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68204"
FT                   /db_xref="GOA:Q8XFJ5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFJ5"
FT                   /protein_id="AAO68204.1"
FT                   /translation="MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEV
FT                   CPKCDHHMRMSARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGE
FT                   KDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLVCFSASG
FT                   GARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPK
FT                   ALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLP
FT                   APNPDAPREGVVVPPAPDQESEA"
FT   gene            571070..572338
FT                   /gene="folC"
FT                   /locus_tag="t0499"
FT   CDS_pept        571070..572338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="t0499"
FT                   /product="folylpolyglutamate synthase"
FT                   /note="corresponds to STY2596 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68205"
FT                   /db_xref="GOA:Q8Z501"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z501"
FT                   /protein_id="AAO68205.1"
FT                   /translation="MKNKSIPQAASPLASWLSYLENLHSKSIDLGLERVSQVAARLDIL
FT                   KPAPFVFTVAGTNGKGTTCRTLESVLIAAGYRVGVYSSPHLVRYTERVRVQGKELAESA
FT                   HTASFAEIEAARGDISLTYFEYGTLSALWLFKQANLDVVILEVGLGGRLDATNIVDADV
FT                   AVITSIALDHTDWLGPDRESIGREKAGIFRAEKPAIVGEPEMPATIADVAQETGALLLR
FT                   RGVDWRYEVTATHWAFTDGDGTLAGLPLPQVPQPNAATALAALRASGLNIDEQAIRDGI
FT                   AQATLPGRFQIVSESPRVIFDVAHNPHAAEYLTGRLKMLPKRGRVLAVIGMLHDKDIAG
FT                   TLAWLKSVVDDWYCAPLEGPRGATAEQLLEHLGKGNVYDSVAQAWQAAIDAAQPEDTVL
FT                   VCGSFHTVAHVMEVIDAGRIGGE"
FT   gene            572328..573002
FT                   /gene="dedD"
FT                   /locus_tag="t0500"
FT   CDS_pept        572328..573002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedD"
FT                   /locus_tag="t0500"
FT                   /product="DedD protein"
FT                   /note="corresponds to STY2595 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68206"
FT                   /db_xref="GOA:Q8Z502"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032898"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z502"
FT                   /protein_id="AAO68206.1"
FT                   /translation="MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVP
FT                   KPGDRDEPDMMPAATQALPTQPPEGAAEEVRAGDAAAPSLDPSRMASNNVELDPIPVET
FT                   PKPKPVEKPKPQPKPQQPVVAVSTPTPAPQPATDDKPAPTGKAYVVQLGALKNADKVNE
FT                   IVGKLRSAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMGYS
FT                   PN"
FT   gene            573313..573801
FT                   /gene="cvpA"
FT                   /locus_tag="t0501"
FT   CDS_pept        573313..573801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="t0501"
FT                   /product="colicin V production protein"
FT                   /note="DedE; corresponds to STY2593 from Accession
FT                   AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68207"
FT                   /db_xref="GOA:Q8XFT6"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFT6"
FT                   /protein_id="AAO68207.1"
FT                   /translation="MVWIDYAIIAVIAFSCLVSLIRGFVREALSLVTWGCAFFVASHYY
FT                   TYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICF
FT                   GALRGALIVAAILFFLDTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT"
FT   gene            573839..575356
FT                   /gene="purF"
FT                   /locus_tag="t0502"
FT   CDS_pept        573839..575356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="t0502"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="corresponds to STY2592 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68208"
FT                   /db_xref="GOA:Q8Z503"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z503"
FT                   /protein_id="AAO68208.1"
FT                   /translation="MCGIVGISGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVNDIFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDSFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPHGIRPLVLGKRDVGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAIYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLNDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDFLDSLRNDDAKAVLFQNEMENLEMHNEG"
FT   gene            complement(575392..576819)
FT                   /locus_tag="t0503"
FT   CDS_pept        complement(575392..576819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0503"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2591 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68209"
FT                   /db_xref="GOA:Q8Z504"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z504"
FT                   /protein_id="AAO68209.1"
FT                   /translation="MASTNQELASALRMFSRFFDLIHQPLAVINERGEYVYYNQESADL
FT                   DGYSIERAMGKHMLDVYPGMKETQSTMLSSLKKGVEYIGHYQIYYNARGQAVDYQHTTA
FT                   SLYASDGGMVGVIEIGRNMSGVRRLQEQVVELNQLLYADHHEKHHAIITENPEMLSNIA
FT                   KAKRLAASNIPVTIVGETGTGKELFSRLIHQCSKRANKPFIALNCGALPPTLIESTLFG
FT                   TVRGAYTGAENSQGYLELANGGTLFLDELNAMPIEMQSKLLRFLQDKTFWRLGGQQQLH
FT                   SDVRIVAAMNEAPVKLIQQERLRADLFYRLSVGMLTLPPLRARPEDIPLLANYFIDKYR
FT                   NDVPQDIHGLSETARADLLNHAWPGNVRMLENAIVRSMIMQEKDGLLKHIIFEQDELNL
FT                   GVPETAPENPLPSSPDPQYEGSLEVRVANYERHLIETALDTHQGNIAAAARSLNVSRTT
FT                   LQYKVQKYAIRFGVVRN"
FT   gene            577030..578427
FT                   /locus_tag="t0504"
FT   CDS_pept        577030..578427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0504"
FT                   /product="putative amino acid decarboxylase"
FT                   /note="corresponds to STY2590 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68210"
FT                   /db_xref="GOA:Q8Z505"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z505"
FT                   /protein_id="AAO68210.1"
FT                   /translation="MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYP
FT                   TPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQY
FT                   EVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKV
FT                   ANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQ
FT                   VPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAG
FT                   ITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVEC
FT                   HVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLCDGGDYFHMGVKG
FT                   EEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGETRLIRREDSYED
FT                   MVKYDIY"
FT   gene            578518..579939
FT                   /locus_tag="t0505"
FT   CDS_pept        578518..579939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0505"
FT                   /product="putative amino acid transporter"
FT                   /note="corresponds to STY2589 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68211"
FT                   /db_xref="GOA:Q8Z506"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z506"
FT                   /protein_id="AAO68211.1"
FT                   /translation="MSNTNSGLLGIKDIVFMNVIAILSLRQIPNVAPYGASAMLLWVIA
FT                   AFCLFFPLAMVCGELSTGWPKDGGIFVWIKEAFGKRIAWIVVVCFLFSCVLFFPLMLQF
FT                   GFTALGYMIGGGLAENKAFIGIGSAVIFWLLTLMNIRGMEWTKIINSISAWCGVFIPSA
FT                   ILILLAVVWLCTGHQMQTDYTTAKNWIPDLGHWDTIVFLSSMMFAFAGLEVAPMIAGRT
FT                   RNPQRDFPRAMAVSAAVIVGIYMVGTWALNTLLPAGKTDIVAGVMQAMHAAADTLHMPW
FT                   LIPVMAICMFFGALGQINSWLVGPIYMLQEASREDNLLGDRIGKLHPVWKTPAFALTIQ
FT                   AIIVTVLCFSTFISPSVAAAYWMLTALTTITYFIPYLVMFPAFWRLRKTQPDTPRSFKI
FT                   PGKVLPAILPALGFLSIAFAVALLFIPPSQIDMGGYFQYAGKIIGGAVLAVVVAEYIYH
FT                   RAQKRNARLSMAGGK"
FT   gene            579941..581044
FT                   /locus_tag="t0506"
FT   CDS_pept        579941..581044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2588 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68212"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z507"
FT                   /protein_id="AAO68212.1"
FT                   /translation="MYMPVLEINLRKLEENARTEKALLASSGIDVMAVNKVFDGCVETA
FT                   QAVLNGGITVIAESRTYNLKKIRETGCTTCLLRSPCLSEIEDVVRYADISLNSEPVVLR
FT                   ALSQEAQRQGKTHQVLLMVDMGDLREGIWFGEYQRILETVTLITGLPGLELYGLGTNFN
FT                   CYGTVLPTVKNGEDFLALAARLEADSGIPVRRLSAGNCTSYHLLDKGIWPQGLNHLRIG
FT                   GLHEFGIEYVDMKYLNEFHHSAKPVDKACSDMYILEAEIIELNSKPTVPVGELGVDAFL
FT                   QSKTFVDRGIRRRALLAFGRQDVPSDNCVPCDDAITILGQTSDHTLVDIEDCRQSLKVG
FT                   DVVRFELDYTGLLMACQTKGVAWRFTR"
FT   gene            581108..582397
FT                   /locus_tag="t0507"
FT   CDS_pept        581108..582397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0507"
FT                   /product="putative amino acid permease"
FT                   /note="corresponds to STY2587 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68213"
FT                   /db_xref="GOA:Q8Z508"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z508"
FT                   /protein_id="AAO68213.1"
FT                   /translation="MDTLQQSPPAEPEGGLRRNLKKRHLLMMSLGGTIGTGLFIGIAEP
FT                   LSSVGPAGTLLAYLFAGTIMLATMMCLGELSCAFPHSGSFQHYALMFMPSPCWSYTIGW
FT                   LYWFSWVFSLAADLTAAGFIAHQFFPAVPVYMFCLAILLILTAINLTSAKSFGECEYWL
FT                   SAIKVFAIVLFICAGGVMIYSLMGHSDWHPTLKTDGMWFPHGWEQIVVCMTIVIYSFQG
FT                   VELVGNAAGETESPHIILPKVILGIGLRIILFYGLAIAVLALVYPHELTPNGQSPFVWV
FT                   FSHAGIPGADTLMTLVIFSAAVSAANSAIYASSRMLWSMAGDRFAPACFGKTNGGGVPV
FT                   YAILITALLALVSLLTRYIPAQQFYLYLIASTGQVGCLAWITIGWCQYRFRQSVRNGTY
FT                   ASDLLRYRSPLFPWTARFVIITNFAIMVGT"
FT   gene            582541..583110
FT                   /gene="ubiX"
FT                   /locus_tag="t0508"
FT   CDS_pept        582541..583110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="t0508"
FT                   /product="putative decarboxylase"
FT                   /note="corresponds to STY2586 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68214"
FT                   /db_xref="GOA:P0A246"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A246"
FT                   /protein_id="AAO68214.1"
FT                   /translation="MKRLIVGISGASGAIYGVRLLQILRDVDSVETHLVMSQAARQTLA
FT                   LETHFSLREVQALADVTHDARDIAASISSGSYPTAGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVILKERRPLVLCVRETPLHIGHLRLMTQAAEIGAVIMPPVPAFYHLPQTLDDVI
FT                   NQTVNRVLDQFDIPLPHDLFVRWQGA"
FT   gene            583399..584181
FT                   /gene="argT"
FT                   /locus_tag="t0509"
FT   CDS_pept        583399..584181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argT"
FT                   /locus_tag="t0509"
FT                   /product="lysine-arginine-ornithine-binding periplasmic
FT                   protein precursor"
FT                   /note="corresponds to STY2585 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68215"
FT                   /db_xref="GOA:Q8Z509"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z509"
FT                   /protein_id="AAO68215.1"
FT                   /translation="MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAK
FT                   GDFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIA
FT                   FSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYA
FT                   NQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLR
FT                   KDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD"
FT   gene            584419..585201
FT                   /gene="hisJ"
FT                   /locus_tag="t0510"
FT   CDS_pept        584419..585201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="t0510"
FT                   /product="histidine-binding periplasmic protein"
FT                   /note="corresponds to STY2584 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68216"
FT                   /db_xref="GOA:Q8Z510"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z510"
FT                   /protein_id="AAO68216.1"
FT                   /translation="MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQ
FT                   GELVGFDIDLAKELCNRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIA
FT                   FTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQ
FT                   GQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPIGKDYKFGGPAVKDEKLFGVGTGMGLR
FT                   KEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG"
FT   gene            585384..586070
FT                   /gene="hisQ"
FT                   /locus_tag="t0511"
FT   CDS_pept        585384..586070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisQ"
FT                   /locus_tag="t0511"
FT                   /product="histidine transport system permease protein"
FT                   /note="corresponds to STY2583 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68217"
FT                   /db_xref="GOA:P0A2J0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030199"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2J0"
FT                   /protein_id="AAO68217.1"
FT                   /translation="MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVT
FT                   GLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIY
FT                   GAYFTETFRGAFMAVPKGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVG
FT                   VKRADL"
FT   gene            586067..586774
FT                   /gene="hisM"
FT                   /locus_tag="t0512"
FT   CDS_pept        586067..586774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisM"
FT                   /locus_tag="t0512"
FT                   /product="histidine transport system permease"
FT                   /note="corresponds to STY2582 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68218"
FT                   /db_xref="GOA:P0A2I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2I8"
FT                   /protein_id="AAO68218.1"
FT                   /translation="MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGLLAVILA
FT                   VGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTDLLNAFFRSGLNC
FT                   TVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAY
FT                   SNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLLISYVLISLFR
FT                   RAERRWLQHVSSK"
FT   gene            586785..587561
FT                   /gene="hisP"
FT                   /locus_tag="t0513"
FT   CDS_pept        586785..587561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisP"
FT                   /locus_tag="t0513"
FT                   /product="histidine transport ATP-binding protein"
FT                   /note="corresponds to STY2581 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68219"
FT                   /db_xref="GOA:Q8Z511"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z511"
FT                   /protein_id="AAO68219.1"
FT                   /translation="MMSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGK
FT                   STFLRCINFLEKSSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNL
FT                   WNHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVS
FT                   IARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
FT                   VIFLHQGKIEEEGNPEQVFGNPQSPRLQQFLKGSLK"
FT   gene            complement(587613..588506)
FT                   /locus_tag="t0514"
FT   CDS_pept        complement(587613..588506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2580 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68220"
FT                   /db_xref="GOA:Q8Z512"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z512"
FT                   /protein_id="AAO68220.1"
FT                   /translation="MQILITGGTGLIGRHLIPRLLILGHQVTVVTRNPDNARQILDSRV
FT                   TLWKGLAEREHLNEIDAIINLAGEPIADKRWTSQQKERLCQSRWAITQKLVDLIHASAT
FT                   PPSVLISGSATGYYGDLGDVVVTEDEPPHNEFTHKLCARWEQIACRAQSDQTRVCLLRT
FT                   GVVLAPQGGILGKMVPPFRLGLGGPVGNGRQYLAWIHIDDMVNGILWLLDNDLRGPFNM
FT                   VSPYPVHNEQFAHALGRALRRPAIIRIPATAIRLLMGESSVLVLGGQRALPKRLEAAGF
FT                   AFRWYDLEEALADVIR"
FT   gene            complement(588630..589277)
FT                   /locus_tag="t0515"
FT   CDS_pept        complement(588630..589277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0515"
FT                   /product="putative glutathione-S transferase"
FT                   /note="corresponds to STY2579 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68221"
FT                   /db_xref="GOA:Q8Z513"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z513"
FT                   /protein_id="AAO68221.1"
FT                   /translation="MIDLYYAPTPNGHKIMLFLEEAELAYRLLKVDISKGNQFRPDFLA
FT                   ISPNNKIPAIVDHAPADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQ
FT                   VGGLGPMLGQNHHFNHFAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIAD
FT                   IASWPWVNAHQRQRIDLDTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA"
FT   gene            589420..590064
FT                   /locus_tag="t0516"
FT   CDS_pept        589420..590064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0516"
FT                   /product="putative glutathione-S transferase"
FT                   /note="corresponds to STY2578 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68222"
FT                   /db_xref="GOA:Q8Z514"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034338"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z514"
FT                   /protein_id="AAO68222.1"
FT                   /translation="MSKPVIVLWSDANFFSPYVLSAWVALQEKGLSFTLKTRDLDQGEH
FT                   LQPGWRGYALTQRVPVLEADNFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQ
FT                   IQAWLRSDLLPLREERPTDVVFAGAKKAPLSEAGKASAAKLFATAEALLGQGTQNLFGE
FT                   WCIADTDLALMINRLVLHGDDVPASLAAYATFQWQRASVQRFIALSSKRSG"
FT   gene            590120..590671
FT                   /locus_tag="t0517"
FT   CDS_pept        590120..590671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2577 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68223"
FT                   /db_xref="GOA:Q8XGM7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGM7"
FT                   /protein_id="AAO68223.1"
FT                   /translation="MKLMFASDIHGSLPATERVLERFAQSGARWLVILGDVLNHGPRNA
FT                   LPEGYAPAQVAERLNAVATQIIAVRGNCDSEVDQMLLHFPITAPWQQILTQERRLFLTH
FT                   GHLFGPTNLPALHTGDVLVYGHTHLPVAQQQEGLYHFNPGSVSIPKGGYAASYGILDDN
FT                   VLSVIALNDQSIIAQVAINS"
FT   gene            590728..591282
FT                   /locus_tag="t0518"
FT   CDS_pept        590728..591282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2576 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68224"
FT                   /db_xref="GOA:P65560"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65560"
FT                   /protein_id="AAO68224.1"
FT                   /translation="MVEQRRLASTEWVDIVNEDNEVIAQSSREQMRAQRLRHRATYIVV
FT                   HDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEH
FT                   GLFYFEDQHCRVWGALFSCVSHGPFALQEDEVSEVCWLTPEEITARCDEFTPDSLKALA
FT                   LWMTRNAKNEAALQEKPEETE"
FT   gene            complement(591288..592307)
FT                   /locus_tag="t0519"
FT   CDS_pept        complement(591288..592307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0519"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2575 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68225"
FT                   /db_xref="GOA:Q83T75"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T75"
FT                   /protein_id="AAO68225.1"
FT                   /translation="MSIPRKRRSTGKVTIADVAQLAGVGTMTVSRALRTPEQVSDKLRE
FT                   KIEAAVHELGYMPNLAASALASASSHTIAMVVPNLAEAGCSEMFAGLQQILQPAGYQIM
FT                   LAESQHRVEQEEKLLETLLASNIAAAILLSVEHSTTVRQWLKNASIPVMEMGAIRSDPI
FT                   DMNIGIDNVAAMYELTEMLIQRGYQNIGLLCANQEQWIFQQHLHGWYKAMLRHHMSPNR
FT                   VINAALPPNFSTGASQLPEFLLAWPELDALVCVSDELACGALYECQRRRIKVPDDLAVV
FT                   GFGDSDVSRVCQPPLTTMAVPHRKIGSEAGRALLERLNQGNWSDRKSIASSLCMRESC"
FT   gene            592560..593003
FT                   /locus_tag="t0520"
FT   CDS_pept        592560..593003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0520"
FT                   /product="putative sugar phosphotransferase component II A"
FT                   /note="corresponds to STY2574 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68226"
FT                   /db_xref="GOA:Q8Z516"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z516"
FT                   /protein_id="AAO68226.1"
FT                   /translation="MLGTWLSDATITLRESVETWPQALEICGKPLLDAGVIAPEYITAI
FT                   VQQHQKLGPYYVLAPGLAMPHARPEEGAKGLGLSLLKLQRGVSFGADEFDPVDIIIMLA
FT                   APDKHSHIEMISALAELFSSDVDMEKLHQAKNLEDIKTIIDRF"
FT   gene            593084..593356
FT                   /locus_tag="t0521"
FT   CDS_pept        593084..593356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0521"
FT                   /product="putative sugar phosphotransferase component II B"
FT                   /note="corresponds to STY2573 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68227"
FT                   /db_xref="GOA:Q8XG32"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG32"
FT                   /protein_id="AAO68227.1"
FT                   /translation="MKIMAICGSGLGSSFMVEMNIKKVLKKLNIDAEVEHSDLSSATPG
FT                   AADLFVMAKDIAASASVPESQLVVINNIIDINELETQLRAWFAKQ"
FT   gene            593377..594768
FT                   /locus_tag="t0522"
FT   CDS_pept        593377..594768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0522"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2572 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68228"
FT                   /db_xref="GOA:Q8Z517"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z517"
FT                   /protein_id="AAO68228.1"
FT                   /translation="MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIK
FT                   TILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKYGASTALIMA
FT                   FGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGLVMA
FT                   FFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLR
FT                   DSSISISLTMMIIYLIMAVSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVR
FT                   LILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLLGQM
FT                   KLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGF
FT                   ANTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKSKKATAEVQEN
FT                   SGAKE"
FT   gene            594765..595595
FT                   /locus_tag="t0523"
FT   CDS_pept        594765..595595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0523"
FT                   /product="putative transketolase N-terminal section"
FT                   /note="corresponds to STY2571 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68229"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z518"
FT                   /protein_id="AAO68229.1"
FT                   /translation="MNVTEITQLARDIRVATLKSLNHLGFGHYGGSMSVVETLAVLYGA
FT                   VMKIDPADPDWPERDYFVLSKGHAGPALYSTLAIKGYFPREELNTLNQNGTRLPSHPDR
FT                   LKTHGVDATTGSLGQGISIAGGMALSHKLARRPNRVFCIVGDGELNEGQCWEAFQFIAH
FT                   HRLNNLTVFIDWNKQQLDGELEEIINPFDLEGKFRAFGFDVVTVKGDDIAGLLAVVQPV
FT                   PPADARPRVVILDSIKGQGVPCLEQLTNSHHLRLTDGMKQTLNEAIHQLEVMHD"
FT   gene            595588..596541
FT                   /locus_tag="t0524"
FT   CDS_pept        595588..596541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0524"
FT                   /product="putative transketolase C-terminal section"
FT                   /note="corresponds to STY2570 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68230"
FT                   /db_xref="GOA:Q8Z519"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z519"
FT                   /protein_id="AAO68230.1"
FT                   /translation="MIKLAPAGLKDDIEMRKVYAGFVAGQIEAGSPIIALEADLMSSMA
FT                   MDSVARDYPQHVINCGIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDY
FT                   QRNNVKVIASDAGVTACHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFANILRQLMDL
FT                   DGFYWLRTIRKQATSIYAPGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQE
FT                   GVSAAVIDMFTLKPIDRMLVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMR
FT                   RVGVKERYGQVGTQDFLQQEYGLTAAAIVEAAKSLL"
FT   gene            complement(596590..598110)
FT                   /locus_tag="t0525"
FT   CDS_pept        complement(596590..598110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0525"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2569 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68231"
FT                   /db_xref="GOA:Q8XGF4"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGF4"
FT                   /protein_id="AAO68231.1"
FT                   /translation="MSVVTESKTARKWAMPDTLVIIFFVAILTSIATWVVPVGMFDSQE
FT                   VQYQVDGQTKTRKVVDPHSFRIVTNEAGEAQYHRVQFFTTGDERPGLMNFPFEGLTSGS
FT                   KFGTAVGIIMFMLVIGGAFGIVMRTGTVDNGILALIRHTRGNEVLFIPVLFVLFSLGGA
FT                   VFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAG
FT                   VPVLSGSGLRIVVWIVATLIGLVFTLVYASRVKKNPLLSRVHESDRYFREQQDEVVQRP
FT                   FTFGDWLVLLVLTGVMIWVVWGVIVHAWFIPEIASQFFTMGVVIGLIGVIFRLNGMTVN
FT                   VMASSFTEGARMMIAPALLVGFAKGILLLVGNGEAGEPSVLNTLLNSIAHGISGLNNAI
FT                   AAWFMLLFQAVFNFFVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIY
FT                   PTSASLMATLGVCRVDFRNWLKVGASLLGLLFIMSSVVVIGAQMMGYH"
FT   gene            complement(598328..600472)
FT                   /gene="pta"
FT                   /locus_tag="t0526"
FT   CDS_pept        complement(598328..600472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="t0526"
FT                   /product="phosphate acetyltransferase"
FT                   /note="corresponds to STY2568 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68232"
FT                   /db_xref="GOA:Q8Z520"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z520"
FT                   /protein_id="AAO68232.1"
FT                   /translation="MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRA
FT                   GGDAPDQTTTIVRANSTLPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVV
FT                   LVEGLVPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLNERIELTRSSFGGAKN
FT                   TNITGVIINKLNAPVDEQGRTRPDLSEIFDDSSKAQVIKIDPAKLQESSPLPVLGAVPW
FT                   SFDLIATRAIDMARHLNATIINEGDIKTRRVKSVTFCARSIPHMLEHFRAGSLLVTSAD
FT                   RPDVLVAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSL
FT                   SLQSFNLEVPVDDHERIEKVQEYVANYVNADWIESLTATSERSRRLSPPAFRYQLTELA
FT                   RKAGKRVVLPEGDEPRTVKAAAICAERGIATCVLLGNPDEINRVAASQGVELGAGIEIV
FT                   DPEVVRESYVARLVELRKSKGMTEPVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTA
FT                   NTIRPPLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSA
FT                   IAFGIEPRVAMLSYSTGTSGAGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVA
FT                   KSKAPNSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGAL
FT                   VDDIVYTIALTAIQASQQQQ"
FT   gene            complement(600549..601751)
FT                   /gene="ackA"
FT                   /locus_tag="t0527"
FT   CDS_pept        complement(600549..601751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="t0527"
FT                   /product="acetate kinase"
FT                   /note="corresponds to STY2567 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68233"
FT                   /db_xref="GOA:P63412"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63412"
FT                   /protein_id="AAO68233.1"
FT                   /translation="MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIK
FT                   WKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVV
FT                   IDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYL
FT                   YALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRN
FT                   GKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTE
FT                   VTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAM
FT                   VRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLT
FT                   A"
FT   gene            602091..602546
FT                   /locus_tag="t0528"
FT   CDS_pept        602091..602546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2566 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68234"
FT                   /db_xref="GOA:Q8Z521"
FT                   /db_xref="InterPro:IPR007334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z521"
FT                   /protein_id="AAO68234.1"
FT                   /translation="MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTR
FT                   YAIRFMPPVAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSLTPLPPSILN
FT                   WFYEVRGKLQEAGQALAPVEGKPDYQALADTLKRAFKQLDKTFLDDL"
FT   gene            602629..603123
FT                   /locus_tag="t0529"
FT   CDS_pept        602629..603123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2565 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68235"
FT                   /db_xref="InterPro:IPR005587"
FT                   /db_xref="InterPro:IPR023145"
FT                   /db_xref="InterPro:IPR023146"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60816"
FT                   /protein_id="AAO68235.1"
FT                   /translation="MEMTNAQRLILSNQYKMMTMLDPTNAERYRRLQTIIERGYGLQMR
FT                   ELDREFGELTEETCRTIIDIMEMYHALHVSWTNLKDTQAIDERRVTFLGFDAATEARYL
FT                   GYVRFMVNIEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIIN
FT                   A"
FT   gene            603116..603793
FT                   /locus_tag="t0530"
FT   CDS_pept        603116..603793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0530"
FT                   /product="putative phosphatase"
FT                   /note="corresponds to STY2564 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68236"
FT                   /db_xref="GOA:Q8Z522"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z522"
FT                   /protein_id="AAO68236.1"
FT                   /translation="MPEEAHVQCKGFLFDLDGTLVDSLPAVERAWCSWADRFNLAHDEV
FT                   LGFIHGKQAITSLRHFMAGKSEAEIAAEFTRLEQIEATETAGITALPGAVDLLNHLNKA
FT                   GIPWAIVTSGSMPVARARHQVAGLPAPEVFVTAERVKRGKPEPDAYLLGAQLLGLAPQE
FT                   CVVVEDAPAGVLSGLAAGCHVIAVNAPADTPRLADVDFALDSLTQLSVAKQPNGDVVVL
FT                   RKT"
FT   gene            603869..605695
FT                   /locus_tag="t0531"
FT   CDS_pept        603869..605695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0531"
FT                   /product="putative sodium/sulphate transporter"
FT                   /note="corresponds to STY2563 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68237"
FT                   /db_xref="GOA:Q8Z523"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z523"
FT                   /protein_id="AAO68237.1"
FT                   /translation="MNGELIWVLSLLAIAVVLFATGKVRMDAVALFVIVAFVLSGTLTL
FT                   SEAFSGFSDPNVILIAALFIIGDGLVRTGVATVVGTWLVKMAGSSEIKMLVLLMITVAG
FT                   LGAFMSSTGVVAIFIPVVLSVSMHMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNS
FT                   ELLREGLHGFNFFSVTPLGVVVLALGIVYMLVMRFMLKGDAPGQQAGKRRTFRDLIREY
FT                   RLTGRARRLAIRPGSPMVGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRA
FT                   RDVLLIDMSAAEVDLREFCAEQLLEPMVLRGEYFSDQALDVGMAEISLIPKSELIGKSV
FT                   REIAFRTRYGLNVVGLKRDGVALEGSLADEPLLMGDIILVVGNWKLISLLGQKGRDFVV
FT                   LNMPVEVSEASPAHSQAPHAIFCLVLMVALMLTDEIPNPSAAIIACLLMGKFRCIDAES
FT                   AYKAIHWPSIILIVGMMPFALALQKTGGVSLVVQGLMDIGGGYGPYMMLGCLFVLCAVI
FT                   GLFISNTATAVLMAPIALAAAKSMGVSPYPFAMAVAMAASAAFMTPVSSPVNTLVLGPG
FT                   NYSFSDFVKLGVPFTLIVMAVCIVMIPMLFPF"
FT   gene            complement(605787..606386)
FT                   /locus_tag="t0532"
FT   CDS_pept        complement(605787..606386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0532"
FT                   /product="putative oxetanocin A biosynthetic enzyme"
FT                   /note="corresponds to STY2562 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68238"
FT                   /db_xref="GOA:Q8Z524"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR022971"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z524"
FT                   /protein_id="AAO68238.1"
FT                   /translation="MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALA
FT                   AIKNRKFGGQLNAERIALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKL
FT                   VDMAPDELHDIFAPLIDENAWSKEEQAIVKQADALCAYLKCLEELSAGNNEFRLAKTRL
FT                   EKTLELRRSQEMDYFMAVFVPSFHLSLDEISQDSPL"
FT   gene            complement(606480..607694)
FT                   /locus_tag="t0533"
FT   CDS_pept        complement(606480..607694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0533"
FT                   /product="putative aminotransferase"
FT                   /note="corresponds to STY2561 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68239"
FT                   /db_xref="GOA:Q8XGH1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGH1"
FT                   /protein_id="AAO68239.1"
FT                   /translation="MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAP
FT                   FGFEAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGV
FT                   SELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRA
FT                   KITPRTRGIVIINPNNPTGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHS
FT                   IAALAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVP
FT                   AQHAIQTALGGYQSISEFILPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDA
FT                   KRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFL
FT                   SGYHQ"
FT   gene            608626..609564
FT                   /gene="lrhA"
FT                   /locus_tag="t0534"
FT   CDS_pept        608626..609564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrhA"
FT                   /locus_tag="t0534"
FT                   /product="NADH dehydrogenase operon transcriptional
FT                   regulator"
FT                   /note="corresponds to STY2560 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68240"
FT                   /db_xref="GOA:Q8Z525"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z525"
FT                   /protein_id="AAO68240.1"
FT                   /translation="MINANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQ
FT                   MQRLEQLVGKELFARHGRNKLLSEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIG
FT                   ASDESADTILPFLLSRISSVYPKLALDVRVKRNAYMVDMVKSQEVDLVVTTNQPHSLDC
FT                   LNLRTSPTHWYCAAEYVLQRGEPVPLVLLDDPSPFRDMVLETLNAAGIPWRLAYVASTL
FT                   LAVRAAVKAGLGVTARPVEMMSPDLRVLGAADGLPPLLDTEYMLCRDPNSQNELAMVIF
FT                   HAMESYQNPWHYNQFSAEGGDDPLMVEGGFE"
FT   gene            609644..609796
FT                   /locus_tag="t0535"
FT   CDS_pept        609644..609796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0535"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2559 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68241"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGZ6"
FT                   /protein_id="AAO68241.1"
FT                   /translation="MPICTRLTAQIVKVAVNQPVAIRSSMWAKNNQNIHFMNLHVKKLE
FT                   KLLLF"
FT   gene            610189..610632
FT                   /gene="nuoA"
FT                   /locus_tag="t0536"
FT   CDS_pept        610189..610632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="t0536"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /note="corresponds to STY2558 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68242"
FT                   /db_xref="GOA:Q8XFY2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFY2"
FT                   /protein_id="AAO68242.1"
FT                   /translation="MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARH
FT                   KNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAA
FT                   IFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR"
FT   gene            610648..611310
FT                   /gene="nuoB"
FT                   /locus_tag="t0537"
FT   CDS_pept        610648..611310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="t0537"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /note="corresponds to STY2557 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68243"
FT                   /db_xref="GOA:Q8XGN7"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XGN7"
FT                   /protein_id="AAO68243.1"
FT                   /translation="MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDM
FT                   VNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFT
FT                   KMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPE
FT                   AYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI"
FT   gene            611397..613199
FT                   /gene="nuoC"
FT                   /locus_tag="t0538"
FT   CDS_pept        611397..613199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="t0538"
FT                   /product="NADH dehydrogenase I chain C"
FT                   /note="chain D; corresponds to STY2556 from Accession
FT                   AL513382: Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68244"
FT                   /db_xref="GOA:P0A1Y7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Y7"
FT                   /protein_id="AAO68244.1"
FT                   /translation="MVNNMTDLTAQDAAWSTRDHLDDPVIGELRNRFGPDAFTVQATRT
FT                   GIPVVWVKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHRDGLPAADFSVFYHLIS
FT                   IERNRDIMLKVALSENDLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQT
FT                   WEGHPLRKDYPARATEFDPFELTKAKQDLEMEALTFKPEDWGMKRGTDNEDFMFLNLGP
FT                   NHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGC
FT                   VNEMPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAF
FT                   TDRQKIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLREFLEWMPKRLDSYEKAAL
FT                   RNTILKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGG
FT                   GVSDCYTRVMLKVEELRQSLRILQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLIT
FT                   HFLQVSWGPVMPAQESFQMVEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAI
FT                   RGSLVSDLIVYLGSIDFVMSDVDR"
FT   gene            613202..613702
FT                   /gene="nuoE"
FT                   /locus_tag="t0539"
FT   CDS_pept        613202..613702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="t0539"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /note="corresponds to STY2555 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68245"
FT                   /db_xref="GOA:P0A1Y9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Y9"
FT                   /protein_id="AAO68245.1"
FT                   /translation="MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQK
FT                   QRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQG
FT                   IQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLE
FT                   RYK"
FT   gene            613699..615036
FT                   /gene="nuoF"
FT                   /locus_tag="t0540"
FT   CDS_pept        613699..615036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="t0540"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /note="corresponds to STY2554 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68246"
FT                   /db_xref="GOA:Q8Z526"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z526"
FT                   /protein_id="AAO68246.1"
FT                   /translation="MKNVIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGL
FT                   SPDEIVSQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLL
FT                   MEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVHLRRAIAEATEAGLLGKNIMGT
FT                   GFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGVWGKPTCVNNVETL
FT                   CNVPAILANGVEWYQNISKSKDAGTKLMGFSGRVKNPGLWELPFGTIAREILEDYAGGM
FT                   RDGLKFKAWQPGGAGTDFLTEAHLDLPMEFESIGKAGSRLGTALAMAVDHEIGMVSLVR
FT                   NLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCA
FT                   HAPGAVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLKERW"
FT   gene            615061..617793
FT                   /gene="nuoG"
FT                   /locus_tag="t0541"
FT   CDS_pept        615061..617793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="t0541"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /note="corresponds to STY2553 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68247"
FT                   /db_xref="GOA:P0A1Y5"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1Y5"
FT                   /protein_id="AAO68247.1"
FT                   /translation="MLMATIHVDGKEYEVNGADNLLQACLSLGLDIPYFCWHPALGSVG
FT                   ACRQCAVKQYQNAEDTRGRLVMSCMTPATDGTFISIDDEEAKQFRESVVEWLMTNHPHD
FT                   CPVCEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRYY
FT                   KDYADGTDLGVYGAHDNVYFGRPEDGTLESEFSGNLVEICPTGVFTDKTHSERYNRKWD
FT                   MQFAPSICQQCSIGCNISPGERYGELRRIENRYNGTVNHYFLCDRGRFGYGYVNLKDRP
FT                   RQPVQRRGDDFITLNAEQAMQGAADILRQSKKVIGIGSPRASIESNFALRELVGAENFY
FT                   TGIARGEQERLQLALKVLREGGIYTPALREIESYDAVLVLGEDVTQTGARVALAVRQAV
FT                   KGKAREMAAAQKVADWQIAAILNIGQRAKHPLFVTNVDDTRLDDIAAWTYRAPVEDQAR
FT                   LGFAIAHALDNTAPAVDGIDSDLQNKIDVIVQALAGAKKPLIISGTNAGSSEVIQAAAN
FT                   VAKALKGRGADVGITMIARSVNSMGLGMMGGGSLDDALGELETGSADAVVVLENDLHRH
FT                   ASATRVNAALAKAPLVMVVDHQRTAIMENAHLVLSAASFAESDGTVINNEGRAQRFFQV
FT                   YDPAYYDNKTIMLESWRWLHSLHSTVENREVDWTQLDHVIDAVIAAMPQFAGIKDAAPD
FT                   ATFRIRGQKLAREPHRYSGRTAMRANISVHEPRQPQDKDTMFAFSMEGNNQPTAPRSEI
FT                   PFAWAPGWNSPQAWNKFQDEVGGKLRHGDPGVRLIEATEGGLDYFTTVPASFQAQDGQW
FT                   RIAPYYHLFGSDELSQRSPVFQSRMPQPYIKLNPADAAKLGVNAGTRVFFSYDGNTVTL
FT                   PVEISEGLAAGQVGLPMGMPGIAPVLAGARLEDLREAQQ"
FT   gene            617790..618767
FT                   /gene="nuoH"
FT                   /locus_tag="t0542"
FT   CDS_pept        617790..618767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="t0542"
FT                   /product="NADH dehydrogenase I chain H"
FT                   /note="corresponds to STY2552 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68248"
FT                   /db_xref="GOA:Q8Z527"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z527"
FT                   /protein_id="AAO68248.1"
FT                   /translation="MSWITPDLIEILLSILKAVVILLVVVTCGAFMSFGERRLLGLFQN
FT                   RYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVS
FT                   PNWVVADLNIGILFSLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTVSYEVFLGLS
FT                   LMGVVAQAGSFNMTDIVNNQAHLWNVIPQFFGFVTFAIAGVAVCHRHPFDQPEAEQELA
FT                   DGYHIEYSGMKFGLFFVGEYIGIVTVSALMVTLFFGGWHGPFLPPFVWFALKTAFFMMM
FT                   FILIRASLPRPRYDQVMSFGWKVCLPLTLINLLVTAAVILWQAQ"
FT   gene            618782..619324
FT                   /gene="nuoI"
FT                   /locus_tag="t0543"
FT   CDS_pept        618782..619324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="t0543"
FT                   /product="NADH dehydrogenase I chain I"
FT                   /note="corresponds to STY2551 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68249"
FT                   /db_xref="GOA:Q8XFD5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFD5"
FT                   /protein_id="AAO68249.1"
FT                   /translation="MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYR
FT                   GRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGL
FT                   CEEACPTTAIQLTPDFELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDK
FT                   GEAENEAKPIDVKSLLP"
FT   gene            619335..619889
FT                   /gene="nuoJ"
FT                   /locus_tag="t0544"
FT   CDS_pept        619335..619889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="t0544"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /note="corresponds to STY2550 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68250"
FT                   /db_xref="GOA:Q8XG37"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG37"
FT                   /protein_id="AAO68250.1"
FT                   /translation="MEFAFYICGLIAILATLRVITHTNPVHALLYLVISLLAISGVFFS
FT                   LGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAVLSAIML
FT                   AVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREER
FT                   AGEVLSNRADDRAKRKTEERA"
FT   gene            619886..620188
FT                   /gene="nuoK"
FT                   /locus_tag="t0545"
FT   CDS_pept        619886..620188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="t0545"
FT                   /product="NADH dehydrogenase I chain k"
FT                   /note="corresponds to STY2549 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68251"
FT                   /db_xref="GOA:Q8XFA3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFA3"
FT                   /protein_id="AAO68251.1"
FT                   /translation="MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALA
FT                   FVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG"
FT   gene            620185..622026
FT                   /gene="nuoL"
FT                   /locus_tag="t0546"
FT   CDS_pept        620185..622026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="t0546"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /note="corresponds to STY2548 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68252"
FT                   /db_xref="GOA:Q8Z528"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z528"
FT                   /protein_id="AAO68252.1"
FT                   /translation="MNMLALTIILPLIGFVLLAFSRGRWSENLSATIGVGSVGLAALVT
FT                   AFVGMDFFANGKQAFSQPLWTWMSVGNFNIGFNLVLDGLSLTMLSVVTGVGFLIHMFAS
FT                   WYMRGEEGYSRFFAYTNLFIASMVVLVLSDNLLLMYLGWEGVGLCSYLLIGFYYSDPKN
FT                   GAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLML
FT                   LGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEILH
FT                   LVGIIGAITLVMAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAF
FT                   FKALLFLASGSVILACHHEQNIFKMGGLRKSIPLVYACFLVGGAALSALPLVTAGFFSK
FT                   DEILAGAMANGHINLMVAGLVGAFMTSLYTFRMIFIVFHGKEQIHAHAGKGITHHLPLI
FT                   VLMILSTFVGALIVPPLQGVLPQTTELAHGRVLTLEITSGVVAIAGILIAAWLWLGKRT
FT                   LVTSIANSAPGHLLGTWWYNAWGFDWLYDKVFVKPFLGIAWLLKRDPLNALMNIPAILS
FT                   RFAGKGLVLSENGYLRWYVASMSIGAVVVLALLMVLR"
FT   gene            622340..623869
FT                   /gene="nuoM"
FT                   /locus_tag="t0547"
FT   CDS_pept        622340..623869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="t0547"
FT                   /product="NADH dehydrogenase I chain M"
FT                   /note="corresponds to STY2547 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68253"
FT                   /db_xref="GOA:Q8Z529"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z529"
FT                   /protein_id="AAO68253.1"
FT                   /translation="MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMELTLALGLQ
FT                   LWLQGGYSLTQSAGIPQWQSEFVLPWIPRFGISIHLALDGLSLLMVVLTGLLGVLAVLC
FT                   SWREIEKYQGFFHLNLMWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASD
FT                   GKTRITAATKFFIYTQASGLVMLIAILALVFVHYKATSVWTFNYEELLNTPMSHGVEYL
FT                   LMLGFFIAFAVKMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPN
FT                   ASAEFAPIAMWLGVIGIFYGAWMAFTQYDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQG
FT                   AVIQMIAHGLSAAGLFILCGQLYERLHTRDMRMMGGLWGKMKWLPALSMFFAVATLGMP
FT                   GTGNFVGEFMILFGSYQVVPMITVISTFGLVFASVYSLAMLHRAYFGKAKSQIASQELL
FT                   GMSLRELFIILLLVVLLVLLGFYPQPILDTSHSAMSNIQQWFVNSVTTTRP"
FT   gene            624056..625333
FT                   /gene="nuoN"
FT                   /locus_tag="t0548"
FT   CDS_pept        624056..625333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="t0548"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /note="corresponds to STY2546 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68254"
FT                   /db_xref="GOA:Q8Z530"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z530"
FT                   /protein_id="AAO68254.1"
FT                   /translation="MDVTPLMRVDGFAMLYTGLVLLASLATCTFAYPWLEGYNDNQEEF
FT                   YLLVLIASLGGILLANANHLAALFLGIELISLPLFGLIGYAFRQKRSLEASIKYTILSA
FT                   AASSFLLFGMALVYAQSGNLSFEALGKSLGDGMLHEPLLLAGFGLMIVGLGFKLSLVPF
FT                   HLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYAPVGDSEAVRVVLGIIAFASII
FT                   FGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQSGEMSMEAVGVYLAGYLFSSLGAF
FT                   GVVSLMSSPFRGPDADSLYSYRGLFWHRPVLAAVMTVMMLSLAGIPMTLGFIGKFYVLA
FT                   VGVQASLWWLVAAVVVGSAIGLYYYLRVAVSLYLHAPQQPGRDAPTNWQYSAGGIVVLI
FT                   SALLVLVLGVWPQPLISLVQLATPLM"
FT   gene            complement(625474..626478)
FT                   /locus_tag="t0549"
FT   CDS_pept        complement(625474..626478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0549"
FT                   /product="putative receptor/regulator protein"
FT                   /note="corresponds to STY2545 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68255"
FT                   /db_xref="GOA:Q8Z531"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z531"
FT                   /protein_id="AAO68255.1"
FT                   /translation="MDNFQKDIDDRANLTLSNRFELLLFRLGTSLHEQKSELFGINVFK
FT                   LREIIPMPAFTRPAGMKAPLLGMVNIRDQVIPVIDLPAVAGCKPETGLNILLITEYVRS
FT                   VQAFAVESVENIMRLDWQQVHTAEKAVNGRYITSIACLDDNKETNNLALVLDVEQILYD
FT                   IVPSSHDLRATNLKTNKFYITPGAVAIVAEDSKVACAMLEKGLNAMEIPHQMHVTGKDA
FT                   WERIQQLAQEAEAEGKPISEKIALVLTDLEMPEMDGFTLTRKIKTDERLKKIPVVIHSS
FT                   LSGSANEDHVRKVKADGYVAKFEINELSSVIQEVMERAAQNISGPLVSRQLLS"
FT   gene            complement(626544..627461)
FT                   /locus_tag="t0550"
FT   CDS_pept        complement(626544..627461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0550"
FT                   /product="putative hydrolase"
FT                   /note="corresponds to STY2544 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68256"
FT                   /db_xref="GOA:P60194"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013469"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60194"
FT                   /protein_id="AAO68256.1"
FT                   /translation="MELIFLGTSAGVPTRSRNVTAILLHLQHPTQPGVWLFDCGEGTQH
FT                   QMLNTAFHPGKLERIFISHLHGDHLFGLPGLLCSRSMAGNPHPLTVYGPQGVREFIATT
FT                   LRLSGSWTDFPLQIEEISAGDILDDGLRKVTAFRLEHPLECYGYRVVEHDKPGALNARA
FT                   LKAAGVTPGPLFQALKAGKTVTLADGRQINGADYLAPAVAGKSVAIFGDTAPCEAALAL
FT                   AQGVDVMVHETTLDASMEEKANARGHSSTRQTATLAREAAVGRLIMTHISSRYDDKGCQ
FT                   RLLAECRAIFPATELAYDFSVFPV"
FT   gene            627522..627983
FT                   /locus_tag="t0551"
FT   CDS_pept        627522..627983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2543 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68257"
FT                   /db_xref="GOA:Q8XG97"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XG97"
FT                   /protein_id="AAO68257.1"
FT                   /translation="MIDWQDLHHSELTVPQLYALLKLRCAVFVVEQRCPYLDVDGDDLV
FT                   GDNRHILGWHQDELVAYARILKSDNESDPVVIGRVIVSDAWRGAKLGQQLMAKTLESCG
FT                   RHWPDKPLYLGAQAHLQPFYARFGFIPVTDVYDEDGIPHRGMAREVHQA"
FT   gene            628032..628343
FT                   /locus_tag="t0552"
FT   CDS_pept        628032..628343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2542 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68258"
FT                   /db_xref="GOA:Q8XF60"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XF60"
FT                   /protein_id="AAO68258.1"
FT                   /translation="MRMSYQFGESRVDDDLTLLSETLEEVLRSSGDPADQKYIELKARA
FT                   EQALEEVKNRVSHASDSYYYRAKQAVYKADDYVHEKPWQGIGVGAAVGLVLGLLLARR"
FT   gene            628444..629739
FT                   /gene="menF"
FT                   /locus_tag="t0553"
FT   CDS_pept        628444..629739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="t0553"
FT                   /product="isochorismate synthase"
FT                   /note="corresponds to STY2541 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68259"
FT                   /db_xref="GOA:Q8Z532"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z532"
FT                   /protein_id="AAO68259.1"
FT                   /translation="MHSITTALENLTRQLSQEIPATPGLCVFDAPFPLNDAFDALSWLA
FT                   SQSSFPQFYWQQRNGDEEAAVLGAITVFSSLDLAQRFLRQHAQPDLRIWGLNAFEPKEG
FT                   YLLLPRLEWRRSGGTATLRLHLHSDVSLRDDARLAKAFLASLVGIKPVPALRLSLTSEQ
FT                   HWPDKDGWVKLIQQATHTIAQEAFDKVVLARATDLQFSRPVNAAAMMASSRRLNLNCYH
FT                   FFMAFSADTAFLGSSPERLWRRRETALRTEALAGTVANHPDNHKAWQLGEWLMKDDKNQ
FT                   RENMLVVEDICQRLQNCTHSLDVLPPQVLRLRKVQHLRRCIWTALNQADDTLCLHQLQP
FT                   TAAVAGIPREPARCFIEQHEPFEREWYAGSAGYLSTRQSEFCVTLRSAKVTANVVRLYA
FT                   GAGIVRGSDPEQEWQEIDNKAAGLRTLLQMDA"
FT   gene            629825..631495
FT                   /gene="menD"
FT                   /locus_tag="t0554"
FT   CDS_pept        629825..631495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="t0554"
FT                   /product="menaquinone biosynthesis protein"
FT                   /note="corresponds to STY2540 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68260"
FT                   /db_xref="GOA:Q8Z533"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z533"
FT                   /protein_id="AAO68260.1"
FT                   /translation="MSVSAFNRRWAAVILEALTRHGVRHVCIAPGSRSTPLTLAAAENP
FT                   AFIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAVANLYPALIEAGLTGEKLILLT
FT                   ADRPPELIDCGANQAIRQAGMFASHPSQTLSLPRPTQDIPARWLVSTIDNALAMLHAGA
FT                   LHINCPFAEPLYGDMNDTGLVWQQRLGDWWQDEKPWLREARRLASDKQRDWFFWRQKRG
FT                   VVVAGRMSAEEGKKVAQWAQTLGWPLIGDVLSQTGQPLPCADLWLGNAKAVTELQQAQI
FT                   VVQLGSSLTGKRLLQWQATCVPEEYWVIDNIEGRLDPAHHRGRRLVAKIADWLELHPAE
FT                   KRKPWCVEIPRLAELAWQRVVAQRDTFGEAQLAHRIRDYLPEQGQLFVGNSLVVRLIDA
FT                   LSQLPAGYPVYSNRGASGIDGLLSTAAGVQRASAKSTLAIVGDLSALYDLNALALLRQV
FT                   SAPFVLIVVNNNGGQIFSLLPTPQSKRERFYLMPQNVHFDHAAAMFNLRYHRPENWEEL
FT                   ESALAGAWRTPATTVIELVVNDTDGAQTLQQLLAQVSHL"
FT   gene            631492..632250
FT                   /gene="yfbB"
FT                   /locus_tag="t0555"
FT   CDS_pept        631492..632250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfbB"
FT                   /locus_tag="t0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2538 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68261"
FT                   /db_xref="GOA:Q8Z534"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z534"
FT                   /protein_id="AAO68261.1"
FT                   /translation="MMLHAQHMPGQPGTPSLVFLHGFSGDCREWQPVGEQFHGCSRLYI
FT                   DLPGHGGSAAIPVGGFADVIRLLRATLISYNILKFWLVGYSLGGRVAMMAACQGIPGLC
FT                   GLVVEGGHPGLQNEQARAERRLSDGRWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQA
FT                   LTALRSQNNGETLAAMLEATSLAVQPDLREVLNALAFPFYYLCGERDSKFRALAQEVAA
FT                   TCHVIRNAGHNAHRENPAGVVDSLAQILRL"
FT   gene            632265..633122
FT                   /gene="menB"
FT                   /locus_tag="t0556"
FT   CDS_pept        632265..633122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="t0556"
FT                   /product="naphthoate synthase"
FT                   /note="corresponds to STY2537 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68262"
FT                   /db_xref="GOA:Q8XFL0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFL0"
FT                   /protein_id="AAO68262.1"
FT                   /translation="MIYPDETMLYAPVEWHDCSEGYTDIRYEKSTDGIAKITINRPQVR
FT                   NAFRPLTVKEMIQALADARYDDNVGVIILTGEGDKAFCAGGDQKVRGDYGGYQDDSGVH
FT                   HLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFD
FT                   GGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLEKETVRWCREML
FT                   QNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKF
FT                   KRNP"
FT   gene            633122..634084
FT                   /gene="menC"
FT                   /locus_tag="t0557"
FT   CDS_pept        633122..634084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="t0557"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="corresponds to STY2536 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68263"
FT                   /db_xref="GOA:P58485"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58485"
FT                   /protein_id="AAO68263.1"
FT                   /translation="MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLRDGEREGWGEI
FT                   SPLPGFSQETWEEAQTALLTWVNDWLQGSEGLPEMPSVAFGASCALAELTGVLPEAADY
FT                   RAAPLCTGDPDDLVLRLADMPGEKIAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDAN
FT                   RAWTPLKAQQFAKYVNPDYRARIAFLEEPCKTRDDSRAFARETGIAIAWDESLREADFT
FT                   FEAEEGVRAVVIKPTLTGSLDKVREQVAAAHALGLTAVISSSIESSLGLTQLARIAAWL
FT                   TPGTLPGLDTLHLMQAQQVRPWPGNALPCLKRDELERLL"
FT   gene            634081..635448
FT                   /gene="menE"
FT                   /locus_tag="t0558"
FT   CDS_pept        634081..635448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="t0558"
FT                   /product="O-succinylbenzoic acid-CoA ligase"
FT                   /note="corresponds to STY2535 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68264"
FT                   /db_xref="GOA:Q8Z535"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z535"
FT                   /protein_id="AAO68264.1"
FT                   /translation="MTFTDWPWRHWRQVRSQAPALRLNDEVLSWRALCERIDALAGGFA
FT                   AQGVREGDGVLLRAGNQPRTLLAWLALMQCGARVLPVNPQLPQTLLEALVPKLTLRFAL
FT                   TLEGENAFSGLTVLQLRKSTVAYAVAWQPQRLVSMTLTSGSTGLPKAAVHTCQAHLASA
FT                   QGVLSLMPFGPQDDWLLSLPLFHVSGQGIMWRWLFAGARMTVRDKQPLEQMLAGCTHAS
FT                   LVPTQLWRLLANRAAVTLKAVLLGGAVIPVELTDQASKQGIRCWCGYGLTEFASTVCAK
FT                   EADGSDDVGAPLPGREIRIVDNEVWLRAASMAEGYWRDGKLIPLVNDEGWFATRDRGEL
FT                   NHGRLTIAGRLDNLFFSGGEGIQPEEVERVINAHPLVQQAFVVPVEDKEFGHRPVAVVE
FT                   YASQAGDVNLAEWVRDKLARFQQPVRWLTLPSELKNGGIKISRRALQQWVCKICKN"
FT   gene            635546..635803
FT                   /gene="pmrD"
FT                   /locus_tag="t0559"
FT   CDS_pept        635546..635803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmrD"
FT                   /locus_tag="t0559"
FT                   /product="polymyxin B resistance protein"
FT                   /note="corresponds to STY2534 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68265"
FT                   /db_xref="InterPro:IPR038679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z536"
FT                   /protein_id="AAO68265.1"
FT                   /translation="MEWLVKKSHYVKKRACHVLVLCDSGGSLKMIAEANSMILLSPGDI
FT                   LSPLQDAQYCINREKHQTLKIVDARCYSCDEWQRLTRKPL"
FT   gene            complement(635798..636175)
FT                   /locus_tag="t0560"
FT   CDS_pept        complement(635798..636175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0560"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2533 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68266"
FT                   /db_xref="GOA:Q8Z537"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR022832"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z537"
FT                   /protein_id="AAO68266.1"
FT                   /translation="MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNA
FT                   ATLALFAGLAGYLVSVFCWQKTLHMLALSKAYALLSLSYVLVWVASMLLPGLQGAFSLK
FT                   AMLGVLCIMAGVMLIFLPARS"
FT   gene            complement(636175..636510)
FT                   /locus_tag="t0561"
FT   CDS_pept        complement(636175..636510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0561"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2532 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68267"
FT                   /db_xref="GOA:P81891"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR022883"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81891"
FT                   /protein_id="AAO68267.1"
FT                   /translation="MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALI
FT                   CMGAAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVLPRHWLGVALIISGI
FT                   IILGSAA"
FT   gene            complement(636507..638153)
FT                   /gene="pqaB"
FT                   /locus_tag="t0562"
FT   CDS_pept        complement(636507..638153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqaB"
FT                   /locus_tag="t0562"
FT                   /product="melittin resistance protein"
FT                   /note="corresponds to STY2531 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68268"
FT                   /db_xref="GOA:Q8Z538"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR022839"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z538"
FT                   /protein_id="AAO68268.1"
FT                   /translation="MMKSIRYYLAFAAFIALYYVIPVNSRLLWQPDETRYAEISREMLA
FT                   SGDWIVPHFLGLRYFEKPIAGYWINSLGQWLFGATNFGVRAGAILTTLLAAALVAWLTF
FT                   RLWRDKRTALLASVIFLSLFAVYSIGTYAVLDPMIALWLTAGMCCFWQGMQATTRTGKI
FT                   GMFLLLGATCGLGVLTKGFLALAVPVVSVLPWVIVQKRWKDFLLYGWLAVLSCFVVVLP
FT                   WAIAIARREADFWHYFFWVEHIQRFAMSDAQHKAPFWYYLPVLLAGSLPWLGLLPGALK
FT                   LGWRERNGAFYLLGWTIMPLLFFSIAKGKLPTYVLSCFAPIAILMARFVLHNVKEGVAA
FT                   LRVNGGINLVFGIIGIVAAFVVSSWGPLKSPVWTHIETYKVFCVWGVFTVWAFVGWYSL
FT                   CHSPKYLLPAFCPLGLALLFGFSVPDRVMESKQPQFFVEMTQAPLASSRYILADSVGVA
FT                   AGLAWSLKRDDIMLYGHAGELRYGLSYPDVQNKFVKADDFNAWLNQHRQEGIITLVLSI
FT                   DKDEDISALSLPPADNVDYQGRLVLIQYRPK"
FT   gene            complement(638150..639049)
FT                   /locus_tag="t0563"
FT   CDS_pept        complement(638150..639049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2530 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68269"
FT                   /db_xref="GOA:Q8Z539"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023557"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z539"
FT                   /protein_id="AAO68269.1"
FT                   /translation="MTKVGLRIDVDTLRGTREGVPRLLATLHRHGVQASFFFSVGPDNM
FT                   GRHLWRLIKPRFLWKMLRSNAASLYGWDILLAGTAWPGKNIGNANAGIIRETATYHETG
FT                   LHAWDHHAWQTHSGHWSIRQLEEDIARGITALEAIIGKPVTCSAAAGWRADGRVVRAKE
FT                   PFNLRYNSDCRGTTLFRPLLMPGQTGTPQIPVTLPTWDEVIGPAVQAQSFNTWIISRML
FT                   QDKGTPVYTIHAEVEGIVHQPLFEDLLVRARDAGITFCPLGELLPASPESLPLGQIVRG
FT                   HIPGREGWLGCQQAVSAS"
FT   gene            complement(639046..641028)
FT                   /locus_tag="t0564"
FT   CDS_pept        complement(639046..641028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0564"
FT                   /product="putative lipopolysaccharide modification protein"
FT                   /note="corresponds to STY2529 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68270"
FT                   /db_xref="GOA:Q8Z540"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR021168"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z540"
FT                   /protein_id="AAO68270.1"
FT                   /translation="MKAVIFAYHDMGCQGVQAVLDAGYEIAAIFTHADNLAENTFFGSV
FT                   SRLAAGLGIPVYAPDNVNHPIWVDRIAELAPDIIFSFYYRNLLSEEILHLAPAGAFNLH
FT                   GSLLPAYRGRAPLNWVLVNGESETGVTLHRMVKRADAGEIVASQRVAIAQDDVALTLHH
FT                   KLCQAARQLLNSILPTMKCGNIPSVPQRESDATYYGRRRPEDGLIDWHKPVSTVHNLVR
FT                   AVAAPWPGAFSYNGSQKFTIWSSRICPDAQGALPGSVISVSPLRVACADGALEIITGQA
FT                   GDGITVQGSQLAQTLGLVAGACLNRPPATSGKRRIRVLILGVNGFIGNHLTERLLDEEN
FT                   YEVYGMDIGSNAISRFLLHPRFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYT
FT                   RNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYGMCTDASFDEDKSNLIVGPVNK
FT                   PRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNAARIGSSRAITQLIL
FT                   NLVEGTPIKLIDGGQQKRCFTDIRDGIEALFRIIVNEGDRCDGKIINIGNPDNEASIQE
FT                   LATLLLDSFDKHPLRCHFPPFAGFQVVESRSYYGKGYQDVAHRKPSIDNARRCLDWEPS
FT                   IAMRDTVEETLDFFLRSVDIAERAS"
FT   gene            complement(641025..642008)
FT                   /gene="pmrF"
FT                   /locus_tag="t0565"
FT   CDS_pept        complement(641025..642008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmrF"
FT                   /locus_tag="t0565"
FT                   /product="putative lipopolysaccharide modification protein"
FT                   /note="corresponds to STY2528 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68271"
FT                   /db_xref="GOA:Q8Z541"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR022857"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z541"
FT                   /protein_id="AAO68271.1"
FT                   /translation="MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILL
FT                   IDDGSSDSSAELMVKASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQ
FT                   NPPEEIPRLVAKADEGFDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCML
FT                   RAYRRPIIDTMLRCHERSTFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMY
FT                   DLVTCLTTTPLRLLSLLGSVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFI
FT                   GAQFIGMGLLGEYIGRIYNDVRARPRYFVQQVIYPESTSFTEESHQ"
FT   gene            complement(642011..643168)
FT                   /locus_tag="t0566"
FT   CDS_pept        complement(642011..643168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0566"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /note="corresponds to STY2527 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68272"
FT                   /db_xref="GOA:Q8Z542"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z542"
FT                   /protein_id="AAO68272.1"
FT                   /translation="MAEGKMMSDFLPFSRPAMGAEELAAVKTVLDSGWITTGPKNQELE
FT                   AAFCRLTGNQYAVAVSSATAGMHIALMALGIGEGDEVITPSMTWVSTLNMIVLLGATPV
FT                   MVDVDRDTLMVTPEHIEAAITPQTKAIIPVHYAGAPADLDAIYALGARYGIPVIEDAAH
FT                   ATGTSYKGRHIGARGTAIFSFHAIKNITCAEGGIVVTDNPQFADKLRSLKFHGLGVDAW
FT                   DRQSGGRAPQAEVLAPGYKYNLPDFNAAIALAQLQKLDALNARRAAIAAQYHQAMADLP
FT                   FQPLSLPPWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHFRAAHTQKYYR
FT                   ERFPTLTLPDTEWNSERICSLPLFPDMTESDFDRVITALHQIAGQ"
FT   gene            643443..644048
FT                   /gene="ais"
FT                   /locus_tag="t0567"
FT   CDS_pept        643443..644048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ais"
FT                   /locus_tag="t0567"
FT                   /product="Ais protein"
FT                   /note="corresponds to STY2526 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68273"
FT                   /db_xref="GOA:Q8Z543"
FT                   /db_xref="InterPro:IPR011310"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z543"
FT                   /protein_id="AAO68273.1"
FT                   /translation="MLAFTLRFIKNKRYFAILAGALVIIAGLASQHAWSGNGLPQINGK
FT                   ALAALAKQHPVVVLFRHAERCDRSDNTCLSDSTGITVNGAQDARALGKAFSADIQNYNL
FT                   YSSNTVRTIQSATWFSAGRSLTADKKMMDCGSGIYASINTLLKKSQNKNIVIFTHNHCL
FT                   TYIAKNKRGVKFDPDYLNALVMYAENGKLFLDGEFVPG"
FT   gene            complement(644093..644518)
FT                   /locus_tag="t0568"
FT   CDS_pept        complement(644093..644518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2525 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68274"
FT                   /db_xref="GOA:Q8Z544"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023781"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z544"
FT                   /protein_id="AAO68274.1"
FT                   /translation="MRQRTIVCPLIQNDGCYLLCKMADNRGVFPGQWALSGGGVEPGER
FT                   IEEALRREIREELGEQLILSDITPWTFRDDIRVKTYADGRQEEIYMIYLIFDCVSANRD
FT                   ICINDEFQDYAWVKPEELALYDLNVATRHTLALKGLL"
FT   gene            644692..645339
FT                   /locus_tag="t0569"
FT   CDS_pept        644692..645339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2524 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68275"
FT                   /db_xref="InterPro:IPR009998"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z545"
FT                   /protein_id="AAO68275.1"
FT                   /translation="MFLEWFLSALIPQRLAVQFCRFGEFFFMCLLERVKMKKSILLGFA
FT                   GMLFVSASAQAISISGQAGEDYTNIGVGFGTESTGLALSGNWMHNDDDGDAAGVGLGLN
FT                   IPVGPLLATVGGKGIYTNPKDSDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGI
FT                   ESYEEANAGARFTIMRPLSIEAGYRYLNLAGKDGNRDNAIADGPYVGVNASF"
FT   gene            645454..646650
FT                   /locus_tag="t0570"
FT   CDS_pept        645454..646650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2523 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68276"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z546"
FT                   /protein_id="AAO68276.1"
FT                   /translation="MLNVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGVPLSRRNTVGD
FT                   NLDSLVAILRERSQHADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHQAWLTEMERYF
FT                   QQRGRVMAPSNRKQAELPASAEFINNPVGTACGFALQLNRCLMFFTPGVPSEFKVMVEK
FT                   EILPRLRARFSLPEPPLCLRLTTFGRSESDLAQRLDSLPLPPGVTMGYRSSMPIIELKL
FT                   TGPATQREAMLALWPEVKRVAGQNLIFEGTENLPAQIARRLQERQLSLTLSEQYTSGLL
FT                   ALQLSRAGAPVLASEVVPSQEETLAQTAHWTTERRSNHYAGLALAVSGLENEHLNFALA
FT                   TPDGTYALRVRFSANRYSLAIRQEVCAMMALNMLRRWLNGEDITSEHGWIDVVESLTS"
FT   gene            646900..647682
FT                   /locus_tag="t0571"
FT   CDS_pept        646900..647682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0571"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2522 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68277"
FT                   /db_xref="GOA:Q8Z547"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z547"
FT                   /protein_id="AAO68277.1"
FT                   /translation="MLESSKVPALTRAIDILNLIARIGPCSAAIIIETLRIPKSTAYLL
FT                   LNELKRQRFISLDHQENYCLWTKLVELSGHALSKMDLRELARPRLTQLMDEIGLLCHLG
FT                   IIDHENAYYILKVESSSTISVRSHEGKSLSLYRSGIGKCLLAWQPAAVRKAIIEKMVWE
FT                   RATLTTITEPQQLNDELERIRQRGWSFDNGEDYPDVRCVAAPVFNARNELTAAISLVGT
FT                   RLQINEENLDYLAGKAIACAKDISRLLGWKSPFDSLAS"
FT   gene            647684..648901
FT                   /locus_tag="t0572"
FT   CDS_pept        647684..648901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0572"
FT                   /product="putative MR-MLE-family protein"
FT                   /note="corresponds to STY2521 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68278"
FT                   /db_xref="GOA:Q8Z548"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z548"
FT                   /protein_id="AAO68278.1"
FT                   /translation="MENIMTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHI
FT                   ATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFI
FT                   EGKCVSDIKLIHDQMLGATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGA
FT                   VRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFW
FT                   LMLDCWMSQDVNYATKLAHACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEH
FT                   HGTLQSFRTLAETGIDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVI
FT                   TFTNTPFSEFLMTSPDCSTLRPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCHL
FT                   KRPYSH"
FT   gene            648957..650246
FT                   /locus_tag="t0573"
FT   CDS_pept        648957..650246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0573"
FT                   /product="putative transport protein"
FT                   /note="corresponds to STY2520 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68279"
FT                   /db_xref="GOA:Q8XFW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFW1"
FT                   /protein_id="AAO68279.1"
FT                   /translation="MSITLLDGVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQID
FT                   TGLSNEAYALGAGIFFVVYAFLGVPANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSE
FT                   AKFLIIRTLLGAAEAGFFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGAL
FT                   LEMHGFMGHPGWFWMFVIEGLLAIGAGIFTFFWLDDTPQQARFLSLEEKNALIRQLASE
FT                   EEKKVTSRLADALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVT
FT                   AVPWVAALLGTWLIPRYSDRTGDRRNVAAVTLLAAGIGIGLSGLVSPVLAILALCVAAV
FT                   GFIAVQPVFWTMPTQLLSGTALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLL
FT                   TLAGVAIIGSLIIFTLSVNRPVAQSGAAHH"
FT   gene            650272..651075
FT                   /locus_tag="t0574"
FT   CDS_pept        650272..651075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0574"
FT                   /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /note="corresponds to STY2519 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68280"
FT                   /db_xref="GOA:Q8Z549"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023593"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z549"
FT                   /protein_id="AAO68280.1"
FT                   /translation="MNALLSNPFKEGLRKRDTQIGLWLSSTTSYMAEIAATSGYDWLLI
FT                   DGEHAPNTVQDLYHQLQAIAPYASQPVIRPIEGSKALIKQVLDIGAQTLLIPMVDTAEQ
FT                   ARQVVSATRYPPLGQRGVGASVARAARWGRIDNYMAQANESLCLLVQVESKVALENLDA
FT                   ILEVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIESCIYRIRAAGKAAGFLAVDPAM
FT                   AQKCLAWGANFVAVGVDTMLYTEALDSRLAMFKSVQSVSTAKRSY"
FT   gene            651081..651257
FT                   /locus_tag="t0575"
FT   CDS_pept        651081..651257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0575"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2518 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68281"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T73"
FT                   /protein_id="AAO68281.1"
FT                   /translation="MPDGTYALRVRFSANRYSLAIRQEVCAMMALNMLRRWLNGEDITS
FT                   EHGWIDVVESLTA"
FT   gene            complement(651344..652297)
FT                   /locus_tag="t0576"
FT   CDS_pept        complement(651344..652297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="corresponds to STY2517 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68282"
FT                   /db_xref="GOA:Q8Z550"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z550"
FT                   /protein_id="AAO68282.1"
FT                   /translation="MSDEALALLFSAVENGDQNCIDLLCNLALRNDNLGHRVEKFLFDL
FT                   FSGKRSGSPDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSK
FT                   KIGIAHKIMGDQFAQTDQEQVGVENLWCSARMLSSDELAAATLGLVQESPLLSVNYPIG
FT                   LIHPTTKENILRTQLLEKMAQSGLSENEVFLINTGDHWLICLFYKLAEKIKCLIFNTYH
FT                   DLNENTKQEIIEAAKIAGISENEDIDFIETNLQNNVPNGCGLFCYHTIQLLSNAGQNDP
FT                   ATTLREFAENFLTLSVEEQTLFNTQTRRQIYEYSLQ"
FT   gene            complement(652287..652490)
FT                   /locus_tag="t0577"
FT   CDS_pept        complement(652287..652490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0577"
FT                   /product="putative membrane protein"
FT                   /note="corresponds to STY2516 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68283"
FT                   /db_xref="GOA:Q8Z551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z551"
FT                   /protein_id="AAO68283.1"
FT                   /translation="MNNNKIRSMPDLIYLPLTIIFLQIIIHDIIFVTFTYQETEQNEYM
FT                   CKFTLPIEHTAISQFIFRRGER"
FT   gene            complement(652792..653982)
FT                   /gene="glpC"
FT                   /locus_tag="t0578"
FT   CDS_pept        complement(652792..653982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="t0578"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /note="corresponds to STY2515 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68284"
FT                   /db_xref="GOA:Q8Z552"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z552"
FT                   /protein_id="AAO68284.1"
FT                   /translation="MSDTRFESCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKD
FT                   GALYDEALKYCINCKRCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFILSHTDLMGSV
FT                   STPFAPVVNTATALKPVRQLLDYALKIDHRRTLPKYSFGTFRRWYRSVAAQQAKYKDQV
FT                   AFFHGCFVNYNHPQLGKDLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAISN
FT                   VESLREAIAVKGIPVIATSSTCTFALRDEYPEVLDVDNAGLREHIELATRWLWRKLDAG
FT                   KTLPLNPLPLKVVYHTPCHMEKMGWTLYTLELLRQIPGLELTVLDSQCCGIAGTYGFKK
FT                   ENYPTSQSIGAPLFRQIEESGADIVVTDCETCKWQIEMSTSKRCEYPITLLAKALG"
FT   gene            complement(653979..655238)
FT                   /gene="glpB"
FT                   /locus_tag="t0579"
FT   CDS_pept        complement(653979..655238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="t0579"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit B"
FT                   /note="corresponds to STY2514 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68285"
FT                   /db_xref="GOA:Q8Z553"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z553"
FT                   /protein_id="AAO68285.1"
FT                   /translation="MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSL
FT                   DLLSALPNGQPVTDITAGLDALRRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYG
FT                   DVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRD
FT                   LNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWQLLYDALSPIATNCDMIIMPA
FT                   CFGLANDTLWRWLNERLPCALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKK
FT                   VTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTAT
FT                   RAEWYQQHFFDPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGV
FT                   CAVSALQAAHHIAERAGEQQ"
FT   gene            complement(655228..656856)
FT                   /gene="glpA"
FT                   /locus_tag="t0580"
FT   CDS_pept        complement(655228..656856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="t0580"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /note="corresponds to STY2513 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68286"
FT                   /db_xref="GOA:Q8Z554"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z554"
FT                   /protein_id="AAO68286.1"
FT                   /translation="MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATG
FT                   ATGRNHGLLHSGARYAVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDGLAFQ
FT                   ATFIRACEAAGIRAEAIDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDARE
FT                   HGAIVLTAHEVTGLIREGATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADL
FT                   SIRMFPAKGSLLIMDHRINQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSN
FT                   RVTADEVDILLREGEKLAPVMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAE
FT                   RDGLDGFITITGGKLMTYRLMAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKR
FT                   IISLPAPLRGSAVYRHGDRTPGWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLD
FT                   LRRRTRVGMGTCQGELCACRAAGLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDA
FT                   LRESEFTRWVYQGLCGLEKEHQDEI"
FT   gene            657089..658447
FT                   /gene="glpT"
FT                   /locus_tag="t0581"
FT   CDS_pept        657089..658447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="t0581"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="corresponds to STY2512 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68287"
FT                   /db_xref="GOA:Q8Z555"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z555"
FT                   /protein_id="AAO68287.1"
FT                   /translation="MLSIFKPALHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVR
FT                   KNFALAMPYLVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPSCGRTMVHWWSQKERGGIVSVWNC
FT                   AHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAIVVALFAFAMMRDTPQSCGLPPIEE
FT                   YKNDYPDDYNEKAEEELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGASGVFFMTLVTIATIVYW
FT                   MNPAGNPNVDMACMIIIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDFFGWDGGFMVMIGGSILAVILLVVVMIGEKRHHDELQLKRNGG"
FT   gene            658452..659522
FT                   /gene="glpQ"
FT                   /locus_tag="t0582"
FT   CDS_pept        658452..659522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="t0582"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   periplasmic precursor"
FT                   /note="corresponds to STY2511 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68288"
FT                   /db_xref="GOA:Q8Z556"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z556"
FT                   /protein_id="AAO68288.1"
FT                   /translation="MKTTLKNLSVALMLAGMTIGSGAVAAEKVVIAHRGASGYLPEHTL
FT                   PAKAMAYAQGADYLEQDLVMTKDDHLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDF
FT                   TLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRIHTFEEEIEFVQGLNHSTGKNI
FT                   GIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYIGKQDNVYLQCFDVAELKRIKNELEPK
FT                   MGMDLNLVQLIAYTDWNETQQKQPDGRWVNYNYDWMFKPGAMKQVAEYADGIGPDYHML
FT                   VAEGSTKGNIKLTGMVQDAHQNKMVVHPYTVRADQLPDYATDVNQLYDILYNKAGVDGL
FT                   FTDFPDKAVMFLQKND"
FT   gene            complement(659638..660516)
FT                   /locus_tag="t0583"
FT   CDS_pept        complement(659638..660516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0583"
FT                   /product="putative transcriptional regulator"
FT                   /note="corresponds to STY2510 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68289"
FT                   /db_xref="GOA:Q8Z557"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z557"
FT                   /protein_id="AAO68289.1"
FT                   /translation="MTLTQIHALLAVLEYGGFTEASKRLYMTQSAVSQAISALEEELGV
FT                   DILIRERRKEIELTAAGSRIVRHLRAIQRDVNAVKEIVEQEKKNPARTLRIGCFPSACA
FT                   CILPGVIRYFESHHPNVKIIPYEENSTAIIDSLQDGSIDAGFVPFPVNGMYCVPIYRDK
FT                   FTVVVPENHPLAANSTVTVEELMDEPLIVSKGRYELSIMALFKEKGIEPIFKYEFNHPD
FT                   TALNFIRQGLGIALLPELTLKATTGKLCSVALEPTFYRQISLLAKEPPVEGSPLFLLQK
FT                   CMETLTDEGLL"
FT   gene            660678..661868
FT                   /locus_tag="t0584"
FT   CDS_pept        660678..661868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0584"
FT                   /product="putative transmembrane transport protein"
FT                   /note="corresponds to STY2509 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68290"
FT                   /db_xref="GOA:A0A0H2VMC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VMC6"
FT                   /protein_id="AAO68290.1"
FT                   /translation="MKEKLWTKDFWAITIVSFIIFFVFYVLLTLLPIYIADRLHASADK
FT                   AGLLVTCFLAAAIVIRPFAGQWVGKYSNKKILVLSSLAFLVITALYPVCHSIESLLFIR
FT                   VLHGITFGVITTVKGTISARLIPASRRGEGISFFSLAMGLAMVVGPWIGLNMARWDAFT
FT                   AAFWLCSAVAALEIVLSLIVTVPPVIRHADGSKPNLGFSAMFDRAALPFALVTFFMTFS
FT                   YAGVSAFLALYARELDLMAAASNFLLCYAILLMICRTFTGNICDKKGPKYVVYPCLLAF
FT                   TIGLVALGYTNGSIMMIISGGLIGIGYGSVTPVFQTQIISSVEPHKIGVANSLFFNAMD
FT                   AGMAIGAFIMGMMVESVGYRMIYVAGAVLVVLAGALYAVQMKKRGVMPLVSTSELH"
FT   gene            complement(661870..662124)
FT                   /gene="yfaE"
FT                   /locus_tag="t0585"
FT   CDS_pept        complement(661870..662124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfaE"
FT                   /locus_tag="t0585"
FT                   /product="putative ferredoxin"
FT                   /note="corresponds to STY2508 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68291"
FT                   /db_xref="GOA:Q8XH23"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XH23"
FT                   /protein_id="AAO68291.1"
FT                   /translation="MGRVTLRITGTQLLCQDEHPSLLAALESHNVEVEYQCREGYCGSC
FT                   RTRLVAGQVDWITEPLAFIQPGEILPCCCRAKGDIEIEM"
FT   gene            complement(662124..663254)
FT                   /gene="nrdB"
FT                   /locus_tag="t0586"
FT   CDS_pept        complement(662124..663254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="t0586"
FT                   /product="ribonucleoside-diphosphate reductase 1 beta
FT                   chain"
FT                   /note="corresponds to STY2507 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68292"
FT                   /db_xref="GOA:Q8Z558"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z558"
FT                   /protein_id="AAO68292.1"
FT                   /translation="MAYTTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQL
FT                   SFFWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPE
FT                   LETWVETWAFSETIHSRSYTHIIRNIVNDPAIVFDDIVTNEQIQKRAEGISAYYDELIE
FT                   MTSYWHLLGEGTHTVNGKTVVVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAER
FT                   ELMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGVDDPEMAEIAEECKQECYDLFVQAA
FT                   QQEKEWADYLFRDGSMIGLNKDILCQYVEYITNIRMQAVGLDLPFQTRSNPIPWINTWL
FT                   VSDNVQVAPQEVEVSSYLVGQIDSEVDTDDLSNFQL"
FT   gene            complement(663367..665652)
FT                   /gene="nrdA"
FT                   /locus_tag="t0587"
FT   CDS_pept        complement(663367..665652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="t0587"
FT                   /product="ribonucleoside-diphosphate reductase 1 alpha
FT                   chain"
FT                   /note="corresponds to STY2506 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68293"
FT                   /db_xref="GOA:Q8Z559"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z559"
FT                   /protein_id="AAO68293.1"
FT                   /translation="MNQSLLVTKRDGRTERINLDKIHRVLDWAAEGLNNVSVSQVELRS
FT                   HIQFYDGIKTSDIHETIIKAAADLISRDAPDYQYLAARLAIFHLRKKAFGQFEPPALYH
FT                   HVVKMVELGKYDNHLLEDYTEEEFKQMDSFIVHDRDMTFSYAAVKQLEGKYLVQNRVTG
FT                   EIYESAQFLYILVVACLFSNYPRETRLDYVKRFYDAVSTFKISLPTPIMSGVRTPTRQF
FT                   SSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPF
FT                   YKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDYGIQIN
FT                   KLMYTRLLKGGDITLFSPSDVPGLYDAFFADQDEFERLYVKYENDDSIRKQRVKAVELF
FT                   SLMMQERASTGRIYIQNVDHCNTHSPFDPVVAPVRQSNLCLEIALPTKPLNDVNDENGE
FT                   IALCTLSAFNLGAIKTLDELEELAILAVRALDALLDYQDYPIPAAKRGAMGRRTLGIGV
FT                   INFAYWLAKNGKRYSDGSANNLTHKTFEAIQYYLLKASNELAKEQGACPWFNETTYAKG
FT                   ILPIDTYKKDLDAIVNEPLHYDWEQLRESIKTHGLRNSTLSALMPSETSSQISNATNGI
FT                   EPPRGYVSIKASKDGILRQVVPDYEHLKDAYELLWEMPNNDGYLQLVGIMQKFIDQSIS
FT                   ANTNYDPSRFPSGKVPMQQLLKDLLTAYKFGVKTLYYQNTRDGAEDAQDDLAPSIQDDG
FT                   CESGACKI"
FT   gene            complement(666007..666735)
FT                   /gene="ubiG"
FT                   /locus_tag="t0588"
FT   CDS_pept        complement(666007..666735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="t0588"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="corresponds to STY2505 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68294"
FT                   /db_xref="GOA:Q8Z560"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z560"
FT                   /protein_id="AAO68294.1"
FT                   /translation="MNTEKPSVAHNVDHNEIAKFEAVASRWWDLKGEFKPLHRINPLRL
FT                   GYITERSGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIE
FT                   VEYVQETVEEHAAKHAQQYDVVTCMEMLEHVPDPQSVVHACAQLVKPGGEVFFSTLNRN
FT                   GKSWLMAVVGAEYILRMVPKGTHDVKKFIKPAELLSWVDETVLKEQHITGLHYNPITNT
FT                   FKLGPGVDVNYMLHTRAKKA"
FT   gene            complement(666818..667513)
FT                   /locus_tag="t0589"
FT   CDS_pept        complement(666818..667513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0589"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2504 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68295"
FT                   /db_xref="GOA:A0A0H2VK86"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VK86"
FT                   /protein_id="AAO68295.1"
FT                   /translation="MKNRLKRDFSHISIEIPKSITQVIKEKIREMIIHGDFDLGQAISE
FT                   NELSNILMISKTPIREAFIWLSYNENLVNIIPRSGTFVFSVTDEDINDLIKMRVILEQG
FT                   AIREAMEKNANNVIVELSNILSKSAKINAERDTQAYLKLDHDFHYVFVKYADNKYISQA
FT                   HLLISARLLAIRYRLDFTAEYITSSNRGHATILDMLKNNNVEGVCNFITHHIGSGFTER
FT                   ARKLLALKA"
FT   gene            667752..669077
FT                   /pseudo
FT                   /locus_tag="t0590"
FT                   /note="corresponds to STY2501 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT   gene            669092..670294
FT                   /locus_tag="t0591"
FT   CDS_pept        669092..670294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0591"
FT                   /product="putative MR-MLE-family protein"
FT                   /note="corresponds to STY2500 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68296"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z561"
FT                   /protein_id="AAO68296.1"
FT                   /translation="MKITSIEVFDCELKKRDQTMSSYNPVLIRVNTDSGLSGIGEVGLA
FT                   YGAGAKAGVGIIRDLASLIVGEDPLNIEKIWEFFFRKTFWGMGGGNVFYAGMSAIDIAL
FT                   WDIKGKYLGVPVYQLLGGKTNEKLRTYASQLQFGWGDKRQILVTPEEYAEAARAALDDG
FT                   YDAIKVDPLEIDRNGDDCVFQNRNRNYSGLLLADQLKMGEARIAAMREAMGDDADIIVE
FT                   IHSLLGTNSAIQFAKAIEKYRIFLYEEPSHPLNSDNMQKVSRSTTIPIATGERSYTRWG
FT                   YRELLEKQSIAVAQPDLCLCGGITEGKKICDYANIYDTTVQVHVCGGPVSTVAALHMET
FT                   AIPNFIIHEHHTNAMKASIRELCTHDYQPENGYYVAPEQPGLGQELNDEVVKEYLAYVI
FT                   K"
FT   gene            670704..673340
FT                   /gene="gyrA"
FT                   /locus_tag="t0592"
FT   CDS_pept        670704..673340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="t0592"
FT                   /product="DNA gyrase subunit A"
FT                   /note="corresponds to STY2499 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68297"
FT                   /db_xref="GOA:Q83T69"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T69"
FT                   /protein_id="AAO68297.1"
FT                   /translation="MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSIDGDSAAAMRYTEIRLAKIAHGLMADLEKETVDFVDNYDGTEKIPDVMPTKI
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDNEDISIEGLMEHIPGPDFPTAAI
FT                   INGRRGIEEAYRTGRGKVYIRARAEVEADAKTGRETIIVHEIPYQVNKARLIEKIAELV
FT                   KDKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHG
FT                   QPKIMNLKDIISAFVRHRREVVTRRTIFELRKARDRAHILEALAIALANIDPIIELIRR
FT                   APTPAEAKAALISRPWDLGNVAAMLERAGDDAARPEWLEPEFGVRDGQYYLTEQQAQAI
FT                   LDLRLQKLTGLEHEKLLDEYKELLEQIAELLHILGSADRLMEVIREEMELIRDQFGDER
FT                   RTEITANSADINIEDLISQENVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEED
FT                   FIDRLLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEANERITAIL
FT                   PVREYEEGVNVFMATASGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDLTSGSDEV
FT                   MLFSAAGKVVRFKEDAVRAMGRTATGVRGIKLAGDDKVVSLIIPRGEGAILTVTQNGYG
FT                   KRTAADEYPTKSRATQGVISIKVTERNGSVVGAVQVDDCDQIMMITDAGTLVRTRVSEI
FT                   SVVGRNTQGVILIRTAEDENVVGLQRVAEPVDDEELDAIDGSVTEGDEDIAPEAESDDD
FT                   VADDADE"
FT   gene            673526..673984
FT                   /gene="tnpA"
FT                   /locus_tag="t0593"
FT   CDS_pept        673526..673984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="t0593"
FT                   /product="transposase for insertion sequence element IS200"
FT                   /note="corresponds to STY2497 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68298"
FT                   /db_xref="GOA:Q7WRV2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WRV2"
FT                   /protein_id="AAO68298.1"
FT                   /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLC
FT                   EWKNVRILEAECCADHIHMLLEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLSIPYPGSLFTGRK"
FT   gene            674170..677016
FT                   /gene="rcsC"
FT                   /locus_tag="t0594"
FT   CDS_pept        674170..677016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsC"
FT                   /locus_tag="t0594"
FT                   /product="sensor protein RcsC"
FT                   /note="corresponds to STY2496 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68299"
FT                   /db_xref="GOA:Q56128"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019017"
FT                   /db_xref="InterPro:IPR030856"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56128"
FT                   /protein_id="AAO68299.1"
FT                   /translation="MKYLASFRTTLKVSRYLFRALALLIWLLIAFVSVFYIVNALHQRE
FT                   SEIRQEFNLSSDQAQRFIQRTSDVMKELKYIAENRLTAENGVMSSRARDDKMVVPDFEP
FT                   LFADSDCAAMGSAWRGSLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGLREM
FT                   PVERDDALKALHERIMKYRNAPQEESGNNLFWISQGARQGVGYFYALTPVYLANRLQAL
FT                   LGVEQSIRMENFFTPGSLPMGVTIIDENGHSLISLTGPDGIIKAEPRWMQERSWFGYTP
FT                   GFRELVLKKSLPPSSLSIVYSVPVDLVLERIRILILNAILLNVLVGAGLFTLARMYERR
FT                   IFIPAESDAQRLEEHEQFNRKIVASAPVGICILRTIDGVNILSNELAHTYLNMLTHEDR
FT                   QRLTQIICGQQVNFVDVLTSNNTNLQISFVHSRYRNENVAICVLVDVSTRVKMEESLQE
FT                   MAQAAEQASQSKSMFLATVSHELRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSL
FT                   LLKIISDILDFSKIESEQLKIEPREFSPREVMNHITANYLPLVVRKQLGLYCFIEPDVP
FT                   VSLNGDPMRLQQVISNLLSNAIKFTDIGCIVLHVRCDGDYLSIRVRDTGVGIPAKEVVR
FT                   LFDPFFQVGTGVQRNFQGTGLGLAICEKLISMMDGDISVDSEPGMGSQFTLRIPLYGAQ
FT                   YPVKKSVEGLAGTCCWLAVRNTSLCQFIETSLARSGVHTQRYEGQEPAADDILIVDDAL
FT                   EHTWQGRAAVVFCRRHIGIPLERAPGEWVHSVASVHELPALLARIYSIELDSEALSSAL
FT                   PTTDKTADSNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNAIDI
FT                   VLSDVNMPNMDGYRLTQRIRQLGLTLPVVGVTANALAEEKQRCLESGMDSCLSKPVTLD
FT                   ALKQTLAVYAERVRKTRA"
FT   gene            complement(677119..677769)
FT                   /gene="rcsB"
FT                   /locus_tag="t0595"
FT   CDS_pept        complement(677119..677769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="t0595"
FT                   /product="regulator of capsule synthesis B component"
FT                   /note="corresponds to STY2495 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68300"
FT                   /db_xref="GOA:Q56127"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR030864"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56127"
FT                   /protein_id="AAO68300.1"
FT                   /translation="MNNMNIIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNL
FT                   PKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIE
FT                   GIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFA
FT                   EGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPTDKE"
FT   gene            complement(677786..680455)
FT                   /gene="yojN"
FT                   /locus_tag="t0596"
FT   CDS_pept        complement(677786..680455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojN"
FT                   /locus_tag="t0596"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="corresponds to STY2494 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68301"
FT                   /db_xref="GOA:Q83T68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR030861"
FT                   /db_xref="InterPro:IPR032306"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038616"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T68"
FT                   /protein_id="AAO68301.1"
FT                   /translation="MSQSDTTVSTRFSLLPGSITRFFLLLIIVLLVTMGVMVQSAVNAW
FT                   LKDKSYQIVDITHAIHKRVDTWRYVTWQIYDNIAATTTPSTGEGLQETRLKQDVYYLEK
FT                   PRRKTEALIFGSHDSATLEMTQRMSTYLDTLWGAENVPWSMYYLNGQDNSLILISTLPL
FT                   KDLSSGFKESTIGNIVDSRRAEMLQQANALDERESFSSLRKLAWQNGHYFTLRTTFNQP
FT                   GHLATVVAFDLPINDLIPPGMPLDSFRIEPDATQTTGRSSEKEAPDSVTISFNGSKIEI
FT                   SSALNSTGMRLIWQVPFGTLLLDTLQNILLPLLLNIGLLALALFGYATFRHQPGRSTES
FT                   TSGNAANNELRVLRAINEEIVSLLPLGLLVYDQEGNRTVISNKIADHLLPHLNLQNITS
FT                   MAEQHQGVIQATINNELYEIRLFRSQIAPRTQIFIIRDQDREVLVNKKLKQAQRLYEKN
FT                   QQGRAAFMQNISNTLKEPVRQLAVNAAAVTTPESLKLADQADVLVRMIDEIQLANMLEN
FT                   DAWKSEATLFSLQDLIDEVVPEVLPAIKRKGLQLLINNHLSGNDERWGDRDALRRILLL
FT                   LIQYAVTTTAMGKITLEVEQDESIAERLTFRILDTGEGVTLNEIDNLHFPYMNETQGDR
FT                   YGKANPLTFWLCNQLARKLGGHLNIKARETLGTRYTVHVKMLPHDQHTQVEERLLDDVS
FT                   VMVDVTSNEVRAIVLRQLENWGATCITPDERQISQEYDLFLTDNPSNLTASGLLLSDDE
FT                   SGVRKIGPGQLRVNFNMSNAMQEAVLQLIEEQLAQEEIPASPLGGDENAELHASGYYAL
FT                   FVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCVTLEHLIREKDA
FT                   PGIEKYISDIDAYVKSLL"
FT   gene            complement(680758..681114)
FT                   /gene="micF"
FT                   /locus_tag="t4642"
FT   misc_RNA        complement(680758..681114)
FT                   /gene="micF"
FT                   /locus_tag="t4642"
FT                   /product="MicF RNA; post-transcriptional regulator of ompF
FT                   gene"
FT   gene            681183..682319
FT                   /gene="ompC"
FT                   /locus_tag="t0597"
FT   CDS_pept        681183..682319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompC"
FT                   /locus_tag="t0597"
FT                   /product="outer membrane protein C"
FT                   /note="corresponds to STY2493 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68302"
FT                   /db_xref="GOA:P0A264"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="PDB:1IIV"
FT                   /db_xref="PDB:3UPG"
FT                   /db_xref="PDB:3UU2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A264"
FT                   /protein_id="AAO68302.1"
FT                   /translation="MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLFGKVDGLHYFS
FT                   DDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFA
FT                   DAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDG
FT                   LDFALQYQGKNGSVSGENTNGRSLLNQNGDGYGGSLTYAIGEGFSVGGAITTSKRTADQ
FT                   NNTANARLYGNGDRATVYTGGLKYDANNIYLAAQYSQTYNATRFGTSNGSNPSTSYGFA
FT                   NKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNK
FT                   NMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF"
FT   gene            682434..683486
FT                   /gene="yojL"
FT                   /locus_tag="t0598"
FT   CDS_pept        682434..683486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojL"
FT                   /locus_tag="t0598"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="corresponds to STY2492 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68303"
FT                   /db_xref="GOA:Q8Z564"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z564"
FT                   /protein_id="AAO68303.1"
FT                   /translation="MKMTFCRAVCLAAAFLLMGCDEAPETTTASPAAQVLEGKTMGTLW
FT                   RVSVVGIDAKRAAELQTKIQTQLDADDWLLSTYKNDSALMRFNHSRSLAPWPVSEAMAD
FT                   IVTSALRIGAKTDGAMDITVGPLVNLWGFGPDRQPLHIPTPAQIDAAKAKTGLQHLQVI
FT                   DRAGHQFLQKDLPDLYVDLSTVGEGYAADHLARLMEQEGIARYLVSVGGALSSRGMNAQ
FT                   GLPWRVAIQKPTDRENAVQAIVDINGHGISTSGSYRNYYELDGKRVSHVIDPQTGRPIE
FT                   HNLVSVTVIAPTALEADGWDTGLMVLGTQKAQEVVRREGLAVFMIMKEGEGFKTWMSPQ
FT                   FKTFLVSDKN"
FT   gene            683567..684628
FT                   /gene="ada"
FT                   /locus_tag="t0599"
FT   CDS_pept        683567..684628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="t0599"
FT                   /product="ADA regulatory protein"
FT                   /note="corresponds to STY2491 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68304"
FT                   /db_xref="GOA:A0A0H2VMD0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VMD0"
FT                   /protein_id="AAO68304.1"
FT                   /translation="MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSK
FT                   RALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQQRRLDKIACACRLLEQETPVTLAS
FT                   LAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFPDSS
FT                   SYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESGRGICAILPGDSDDAL
FT                   LAELHTLFPAARHEPADAPFQQRVRQVAAAINTRDVLLSLPLDIQGTAFQQQVWQALCA
FT                   IPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIPCHRVVRRDGALSGYRWGVRR
FT                   KAQLLKREAQKEE"
FT   gene            684631..685281
FT                   /gene="alkB"
FT                   /locus_tag="t0600"
FT   CDS_pept        684631..685281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="t0600"
FT                   /product="AlkB protein"
FT                   /note="corresponds to STY2490 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68305"
FT                   /db_xref="GOA:Q8Z566"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z566"
FT                   /protein_id="AAO68305.1"
FT                   /translation="MLDLFADEAPWQEPLAPGAVVLRRFAFRAAQSLLDDIGFVASQSP
FT                   FRQMVTPGGYTMSVAMTNCGALGWTTDGHGYCYAVRDPLTDKPWPALPLSFASVCRQAA
FT                   IAAGYASFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGVPAVFQFGGLRRSD
FT                   PLQRILLEHGDIVVWGGESRLFYHGIQPLKAGFHPMTGEFRYNLTFRQAAEKE"
FT   gene            685357..687000
FT                   /gene="yojI"
FT                   /locus_tag="t0601"
FT   CDS_pept        685357..687000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojI"
FT                   /locus_tag="t0601"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="corresponds to STY2489 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68306"
FT                   /db_xref="GOA:Q8Z567"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005898"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z567"
FT                   /protein_id="AAO68306.1"
FT                   /translation="MELLILVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETVD
FT                   TTVMVLPEFLGLLLLLMVVTLGSQLALTALGHHFVYRLRSEFIKRILDTHVERIEQLGS
FT                   ASLLAGLTSDIRNITIAFVRLPELVQGIVLTVGSAAYLAMLSTKMLLVTAIWMAVTIWG
FT                   GFVLVARVYQHMATLRETEDKLYNDYQTVLEGRKELTLNRERAEQIFQQCYTPDAKEYR
FT                   HHIIRADTFHLSAVNWSNIMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLS
FT                   AVGALPTLLTAQVAFNKLNKFALAPYKPDFPQPKAFPDWKTLELRNVVFHYQDNAFSVG
FT                   PINLTIHRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGTILLDGQPVAAGQPEDYRKLF
FT                   SAVFTDVWLFDRLLGPQGKPANPALVEKWLEHLKMTHKLELNDGCILNLKLSKGQKKRI
FT                   ALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHAD
FT                   RLLEMRNGQLTELTGDERDAASRDAVARTA"
FT   gene            complement(687209..687703)
FT                   /gene="eco"
FT                   /locus_tag="t0602"
FT   CDS_pept        complement(687209..687703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eco"
FT                   /locus_tag="t0602"
FT                   /product="ecotin precursor"
FT                   /note="corresponds to STY2488 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68307"
FT                   /db_xref="GOA:Q8Z568"
FT                   /db_xref="InterPro:IPR005658"
FT                   /db_xref="InterPro:IPR023084"
FT                   /db_xref="InterPro:IPR027438"
FT                   /db_xref="InterPro:IPR036198"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z568"
FT                   /protein_id="AAO68307.1"
FT                   /translation="MKMFVPAVVFAALASASAWANNGDTAQPLEKIAPYPQAEKGMKRQ
FT                   VITLTPQQDESTLKVELLIGQTLNVDCNQHRLGGTLETKTLEGWGYDYYVFDNVTSPVS
FT                   TMMACPEGKKEQKFVTAWLGEDGMLRYNSKLPIVVYTPANVDVKYRIWKADANVQNAIA
FT                   R"
FT   gene            688117..688608
FT                   /gene="napF"
FT                   /locus_tag="t0604"
FT   CDS_pept        688117..688608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napF"
FT                   /locus_tag="t0604"
FT                   /product="ferredoxin-type protein NapF"
FT                   /note="corresponds to STY2487 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68308"
FT                   /db_xref="GOA:Q83T66"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q83T66"
FT                   /protein_id="AAO68308.1"
FT                   /translation="MVDLSRRSMLTGSWRNASNGILPPWARETTYFLAHCLRCDACIQA
FT                   CEADILQRGTGGYPSVNFKRGECSFCYACAQACPESLFLPRRTRAWDLIFTLTENCLAR
FT                   QSVECHRCLDSCEPMAITFRPTLSGIYQPQLDSQACNGCGACVAICPVSAIKAENHHAH
FT                   "
FT   gene            688598..688861
FT                   /gene="yojF"
FT                   /locus_tag="t0603"
FT   CDS_pept        688598..688861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojF"
FT                   /locus_tag="t0603"
FT                   /product="putative napAB assembly protein"
FT                   /note="corresponds to STY2486 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68309"
FT                   /db_xref="GOA:Q8XGF6"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGF6"
FT                   /protein_id="AAO68309.1"
FT                   /translation="MRTNWQVCSLVVQAKSQNIAAIGTQLNTLPGCEVALSDVESGQLI
FT                   VVAEADQSETLMQTIESVRNVEGVLAVSLVYHQQDEQGEETP"
FT   gene            688858..691344
FT                   /gene="napA"
FT                   /locus_tag="t0605"
FT   CDS_pept        688858..691344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="t0605"
FT                   /product="probable nitrate reductase"
FT                   /note="corresponds to STY2485 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68310"
FT                   /db_xref="GOA:Q8Z570"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Z570"
FT                   /protein_id="AAO68310.1"
FT                   /translation="MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAP
FT                   CRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPMLRM
FT                   KDGSYHKDGEFTPVSWEQAFDVMEEKFKTALKEKGPEAIGMFGSGQWTIWEGYAAAKLF
FT                   KAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGSNMAEMHPI
FT                   LWSRITNRRLSDPNVKVAVLSTFQHRSFELADNGIVFTPQSDLVILNYIANYIIQNNAV
FT                   NQDFFTKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFDEYKAFVAEYTLDK
FT                   TAEMTGVPKDQLEQLAQLYADPNKRVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQ
FT                   PGCGPFSLTGQPSACGTAREVGTFSHRLPADMVVTNEKHRDICEKHWQIPAGTIPAKVG
FT                   LHAVAQDRALKDGKLNVYWVMCNNNMQAGPNINEDRMPGWRDPRNFIIVSDPYPTVSAL
FT                   SADLILPTAMWVEKEGAYGNAERRTQFWRQQIKAPGEAKSDLWQLVQFSRRFKTEEVWP
FT                   EALLAQKPELRGKTLYDVLFATPAVSKFPLSELKEDQLNDESRELGFYLQKGLFEEYAW
FT                   FGRGHGHDLAPFDDYHNARGLRWPVVEGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKA
FT                   VIFALPFEPAAESPDNEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVVFIHPLDA
FT                   KARDLRRGDKVKVSSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNNLTLDATDPL
FT                   SKETDFKKCAVKLAKV"
FT   gene            691351..692046
FT                   /gene="napG"
FT                   /locus_tag="t0606"
FT   CDS_pept        691351..692046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napG"
FT                   /locus_tag="t0606"
FT                   /product="ferredoxin-type protein NapG"
FT                   /note="corresponds to STY2484 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68311"
FT                   /db_xref="InterPro:IPR004494"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z571"
FT                   /protein_id="AAO68311.1"
FT                   /translation="MSRTAKPQNGRRRFLRDVVRTAGGLAAVGVALGLQQQTARATGVR
FT                   LRPPGALNENVFASACVRCGQCVQACPYDTLKLATLASGLSAGTPYFVARDIPCEMCED
FT                   IPCAKVCPSGALNKDIASIDDSRMGLAVLLDQENCLNFQGLRCDVCYRECPKIDEAITL
FT                   ELDRNMRTGKHARFLPTVHSDACTGCGKCEKVCVLEQPAIKVLPLSLAKGELGHHYRFG
FT                   WLEGKDGKS"
FT   gene            692033..692902
FT                   /gene="napH"
FT                   /locus_tag="t0607"
FT   CDS_pept        692033..692902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napH"
FT                   /locus_tag="t0607"
FT                   /product="ferredoxin-type protein NapH"
FT                   /note="corresponds to STY2483 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68312"
FT                   /db_xref="GOA:Q8Z572"
FT                   /db_xref="InterPro:IPR011886"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z572"
FT                   /protein_id="AAO68312.1"
FT                   /translation="MANRKRDAGREARAKKGWWRSHRWLVLRRISQFMVLGMFLSGPWL
FT                   GFWVLHGNYSSSLLFDTLPLTDPLITLESLASGHLPATVALTGAVIIAVLYALAGKRLF
FT                   CSWVCPLNPVTDLANWMRRKFDLNQSATIPRHIRYVLLVVVLIGSALTGTLLWEWINPV
FT                   SLLGRSLIMGFSSGALLIIALFLFDLLVVEHGWCGHICPMGALYGVLGSKGVVTVTAKK
FT                   REKCNRCMDCFHVCPEPHVLRAPVLDEQSPAQVTHRDCMTCGRCVDVCSEDVFTITIHN
FT                   IIRDASRR"
FT   gene            693018..693467
FT                   /gene="napB"
FT                   /locus_tag="t0608"
FT   CDS_pept        693018..693467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="t0608"
FT                   /product="cytochrome c-type protein NapB precursor"
FT                   /note="corresponds to STY2482 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68313"
FT                   /db_xref="GOA:Q8XGM8"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGM8"
FT                   /protein_id="AAO68313.1"
FT                   /translation="MKSHDLMKALCQWMATLALVVSGAVWAANGVDLSQSPEVSGTQEG
FT                   AIRMPKEQERMPLNYVNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTH
FT                   FMDSDGKVSGNVAPRRYFCLQCHVPQSDTAPIIDNTFTPSQGYGK"
FT   gene            693477..694079
FT                   /gene="napC"
FT                   /locus_tag="t0609"
FT   CDS_pept        693477..694079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="t0609"
FT                   /product="cytochrome c-type protein NapC"
FT                   /note="corresponds to STY2481 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68314"
FT                   /db_xref="GOA:Q8Z573"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z573"
FT                   /protein_id="AAO68314.1"
FT                   /translation="MENSNRKLGWIKRVWRWWRSPSRLALGTLLLIGFIGGVIFWGGFN
FT                   TGMEKANTEEFCISCHEMRNTVYEEYMETVHYNNRSGVRATCPDCHVPHEWGPKMIRKI
FT                   KASKELYAKVFGLIDTPQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFDFMDLTAQKG
FT                   VAAKMHDQAVKDGQTCIDCHKGIAHKLPDMRDVKPGF"
FT   gene            694100..694717
FT                   /gene="ccmA"
FT                   /locus_tag="t0610"
FT   CDS_pept        694100..694717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="t0610"
FT                   /product="heme exporter protein A1"
FT                   /note="corresponds to STY2480 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68315"
FT                   /db_xref="GOA:P61377"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61377"
FT                   /protein_id="AAO68315.1"
FT                   /translation="MLEARDLYCERDERTLFRGLSFTVEAGEWVQVTGGNGAGKTTLLR
FT                   LLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGA
FT                   RLPEALAQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVAR
FT                   LTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGGAGL"
FT   gene            694714..695373
FT                   /gene="ccmB"
FT                   /locus_tag="t0611"
FT   CDS_pept        694714..695373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="t0611"
FT                   /product="heme exporter protein B1"
FT                   /note="corresponds to STY2479 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68316"
FT                   /db_xref="GOA:Q7CB58"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CB58"
FT                   /protein_id="AAO68316.1"
FT                   /translation="MMWRVFCLELRVAFRHGADIAGPLWFFLMVITLFPLSVGPQPQLL
FT                   ARIAPGIIQVAALLASLLALERLFRDDLQDGSLEQLMLLPVPLPAVVLAKVLAHWAVTG
FT                   LPLMMLSPLVALLLGMDVYGWKIMALTLLLGTPALGFLAAPGVGLTAGLRRGGVLLGIL
FT                   VLPLSVPVLIFATAAMDAASMHLPVDGYLAVLGALLAGSATLSPFATAAALRISTQ"
FT   gene            695425..696162
FT                   /gene="ccmC"
FT                   /locus_tag="t0612"
FT   CDS_pept        695425..696162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="t0612"
FT                   /product="heme exporter protein C1"
FT                   /note="corresponds to STY2478 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68317"
FT                   /db_xref="GOA:Q8Z575"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z575"
FT                   /protein_id="AAO68317.1"
FT                   /translation="MWKTLHQLAAPPRLYQICGRLVPWLAAAGIIVLATGWVRGFGFAP
FT                   ADYQQGESYRIMYLHVPAAIWSMGIYAAMAVAAFTGLVWQMKMASLAVAAMAPVGAVYT
FT                   FIALVTGAAWGKPMWGTWWVWDARLTSELVLLFLYAGVIALWHAFDDRKMAGRAAGILV
FT                   LVGVVNLPVIHYSVEWWNTLHQGSTRMQLSIDPAMRSPLRWAIAGFLLLFMTLALMRMR
FT                   NLILLMEKRRPWVSELILKRGHR"
FT   gene            696159..696371
FT                   /gene="ccmD"
FT                   /locus_tag="t0613"
FT   CDS_pept        696159..696371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /locus_tag="t0613"
FT                   /product="heme exporter protein D1"
FT                   /note="corresponds to STY2477 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68318"
FT                   /db_xref="GOA:Q8XGH4"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XGH4"
FT                   /protein_id="AAO68318.1"
FT                   /translation="MSPAFSSWSDFFAMGGYAFFVWLAVAMTVAPLALLALHTVLQRRA
FT                   ILRGVAQQRAREARMRAAQAQQEAA"
FT   gene            696368..696847
FT                   /gene="ccmE"
FT                   /locus_tag="t0614"
FT   CDS_pept        696368..696847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="t0614"
FT                   /product="cytochrome c-type biogenesis protein E1"
FT                   /note="corresponds to STY2476 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68319"
FT                   /db_xref="GOA:Q8XEN3"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEN3"
FT                   /protein_id="AAO68319.1"
FT                   /translation="MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILY
FT                   GKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKVNFSLYDAEGSVTVSYEGILPDLFR
FT                   EGQGVVVQGTLEKGNHVLAHEVLAKHDENYTPPEVEKAMQENHRRPQRADKDTSS"
FT   gene            696844..698775
FT                   /gene="ccmF"
FT                   /locus_tag="t0615"
FT   CDS_pept        696844..698775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="t0615"
FT                   /product="cytochrome c-type biogenesis protein F1"
FT                   /note="corresponds to STY2475 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68320"
FT                   /db_xref="GOA:Q8XFH4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFH4"
FT                   /protein_id="AAO68320.1"
FT                   /translation="MMPEYGHALLCLALGVALLLSVYPLWGVARGDARMMASAGVFAWL
FT                   LFICVAGAFFVLVHAFVVNDFTVAYVAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMS
FT                   GWTLAVAVFSRQVPADIVARVLAVMGMVCAGFLAFILFTSGPFARTLPAFPVEGRDLNP
FT                   LLQDPGLIFHPPLLYMGYVGFSVAFAFAIAALLSGRLDSAFTRFARPWTLAAWVFLTLG
FT                   IVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLSI
FT                   CAFSLCLLGTFLVRSGVLVSVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSR
FT                   VNNALWSRESLLLGNNVLLMAAMLVVLLGTLLPLVHKQLGLGSISVGEPFFNTMFTWLM
FT                   VPFALLLGVGPLVRWGRDRPRNIRKLLLTALVSTLVLSVLLPWLLEDRIIAMTAVGMAM
FT                   ACWIAVLAVAEAVQRVSRGTKTSLSYWGMVAAHLGLAVTITGIAFSQNYSVERDVRMRA
FT                   GDSVTIHDYRFTFREVRDITGPNYRGGVALIGVTRHGEPEAVLHAEKRLYNTSRMVMTE
FT                   AAIDGGLTRDLYAALGEELDNGAWAVRLYYKPFVRWIWAGGLLMALGGLLCLADPRYRR
FT                   RKPLPEAG"
FT   gene            698772..699329
FT                   /gene="dsbE"
FT                   /locus_tag="t0616"
FT   CDS_pept        698772..699329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="t0616"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="corresponds to STY2474 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68321"
FT                   /db_xref="GOA:Q8XFE5"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XFE5"
FT                   /protein_id="AAO68321.1"
FT                   /translation="MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPV
FT                   PAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWCPTCRAEHQYLNRLAAQGIRVVGLN
FT                   YKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHAGDL
FT                   NARVWESELKPLWDRYSREAAQ"
FT   gene            699326..700369
FT                   /gene="ccmH"
FT                   /locus_tag="t0617"
FT   CDS_pept        699326..700369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /locus_tag="t0617"
FT                   /product="cytochrome c-type biogenesis protein H1"
FT                   /note="corresponds to STY2473 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68322"
FT                   /db_xref="GOA:Q8XES8"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XES8"
FT                   /protein_id="AAO68322.1"
FT                   /translation="MRLLPGMVMLMLALVISGSARATTDVMPFKDEAQEQQFRQLTEQL
FT                   RCPKCQNNSIADSNAMIATDMRRRVYDLMQEGKSRQEIIDYMVARYGNFVTYDPPLTPL
FT                   TVLLWVLPLAAIVAGGWIIVARTRRRVRLRREPLPADTPVCGARAGWGVYVPGAVIALA
FT                   VGAGSYALTGSYPQVRAWQQATAQTPGLLARALDPQAQPLNEEEMARLALGLRTRLQND
FT                   AGNVEGWLMLGRTGMVLGNAGTATGAYANAYRLDPENRDAALGYAEALTRSSDPEDNRR
FT                   GGELLRQLVSRDHTDIRVLSLYAFSAFEQQRFGEAVAAWEMMLKLLPAGDARRAVIERS
FT                   IRLAQEK"
FT   gene            complement(700413..701060)
FT                   /gene="narP"
FT                   /locus_tag="t0618"
FT   CDS_pept        complement(700413..701060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narP"
FT                   /locus_tag="t0618"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /note="corresponds to STY2472 from Accession AL513382:
FT                   Salmonella typhi CT18"
FT                   /db_xref="EnsemblGenomes-Gn:t0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAO68323"
FT                   /db_xref="GOA:Q8Z576"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Z576"
FT                   /protein_id="AAO68323.1"
FT                   /translation="MPEVTPFQVLIVDDHPLMRRGIRQLLELDPAFYVVAEAGDGASAI
FT                   DLANRIEPDLILLDLNMKGLSGLDTLNALRRDGVTAQIIILTVSDSASDIYALIDAGAD
FT                   GYLLKDSDPEVLLEAIRKGANGGKVFSDRVNEYLRERERFGAQEDPFSILTERELDVLH
FT                   ELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQTRGMQ"
FT   gene            702092..702352
FT                   /locus_tag="t0619"
FT   CDS_pept        702092..702352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="t0619"
FT                   /product="hypothetical protein"
FT                   /note="corresponds to STY2471 from Accession AL513382: